RPSBLAST alignment for GI: 254780432 and conserved domain: PRK12381

>gnl|CDD|183486 PRK12381, PRK12381, bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional. Length = 406
 Score =  367 bits (945), Expect = e-102
 Identities = 172/373 (46%), Positives = 227/373 (60%), Gaps = 11/373 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ L+ + G  ++DFA GIAVN+LGH+HP L   L  Q+ K WH  N Y +      
Sbjct: 27  RGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQASKFWHTGNGYTNEPVLRL 86

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI +TFADRVFF NSGAE+ E A+K AR+Y +    ++K  IV F+ AFHGRTL T+
Sbjct: 87  AKKLIDATFADRVFFCNSGAEANEAALKLARKYAHDRYGSHKSGIVAFKNAFHGRTLFTV 146

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           SAGG+ +Y + F P       A + DL S    I + T A+++EPIQGEGGV    + FL
Sbjct: 147 SAGGQPKYSQDFAPLPPDIRHAAYNDLNSASALIDDQTCAVIVEPIQGEGGVIPADKAFL 206

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++T AK +GGGFPIGA L T
Sbjct: 207 QGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDVLTTAKALGGGFPIGAMLTT 266

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            + A+ M  G+HG+TYGGN LA  +  KVL +I +   L  V        E L  I  R+
Sbjct: 267 EKCASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINARY 326

Query: 320 PNMFLEVRGQGLLIG--LKTVFSP-----ALLAAKFRDECLLTAPSSDNVVRILPPLTIT 372
             +F E+RG GLLIG  L   ++      +  AAK     ++   +  NVVR  P L I+
Sbjct: 327 -GLFSEIRGLGLLIGCVLNAEYAGKAKQISQEAAK---AGVMVLIAGPNVVRFAPALNIS 382

Query: 373 AEEIHEGLERIER 385
            EEI  GL+R  R
Sbjct: 383 EEEITTGLDRFAR 395