RPSBLAST alignment for GI: 254780432 and conserved domain: COG0001

>gnl|CDD|30350 COG0001, HemL, Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism]. Length = 432
 Score =  168 bits (426), Expect = 3e-42
 Identities = 103/327 (31%), Positives = 158/327 (48%), Gaps = 32/327 (9%)

Query: 8   FNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHV 67
           F +     I  E+GKGA+L   +G  ++D+  G     LGH+HP +V  ++ Q E+    
Sbjct: 29  FKSVGGYPIFIERGKGAYLTDVDGNEYIDYVLGWGPLILGHAHPAVVEAVQEQLERGLSF 88

Query: 68  SNLYQSTQQEIFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
                 T+ E+    L+       ++V F NSG E+   AI+ AR Y      T + +I+
Sbjct: 89  GA---PTELEVELAELLIERVPSIEKVRFVNSGTEATMSAIRLARAY------TGRDKII 139

Query: 126 TFEGAFHGRTLAT-ISAGGKLQYLEGFGPKIEGFDQAK------FCDLQSLK---NQISN 175
            FEG +HG + +  + AG     L          D AK      + DL++L+    +  +
Sbjct: 140 KFEGCYHGHSDSLLVKAGSGAATLGSPSSPGVPADVAKHTLVLPYNDLEALEEAFEEYGD 199

Query: 176 DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWAN 235
           D AA+++EP+ G  GV      FL+ LR++ ++  ALLIFDEV TG+ R     A  +  
Sbjct: 200 DIAAVIVEPVAGNMGVVPPEPGFLEGLRELTEEHGALLIFDEVITGF-RVALGGAQGYYG 258

Query: 236 VKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGS------HGSTYGGNVLAMVLGEKVL 289
           V+PD+ T+ K +GGG PIGA     E+   M Q +         T  GN LAM  G   L
Sbjct: 259 VEPDLTTLGKIIGGGLPIGAFGGRAEI---MEQLAPLGPVYQAGTLSGNPLAMAAGLATL 315

Query: 290 NIIQS-DGFLENVINIAKILFEGLTAI 315
             + + +G  E +  + + L EGL A 
Sbjct: 316 EELMTEEGVYERLDALGERLAEGLRAA 342