RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddB 
           21,608 sequences; 5,994,473 total letters

Searching..................................................done

Query= gi|254780432|ref|YP_003064845.1| acetylornithine transaminase
protein [Candidatus Liberibacter asiaticus str. psy62]
         (392 letters)



>gnl|CDD|179270 PRK01278, argD, acetylornithine transaminase protein; Provisional.
          Length = 389

 Score =  635 bits (1641), Expect = 0.0
 Identities = 237/384 (61%), Positives = 293/384 (76%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
              L   Y+++D+ FE+G+G WL  E+G  +LDFASGIAVNSLGH+HP LV  LK Q+EK
Sbjct: 3   ISPLLPVYNRADLAFERGEGVWLIDEDGERYLDFASGIAVNSLGHAHPHLVEALKEQAEK 62

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWHVSNLY+  +QE  A  L+ ++FAD+VFFTNSGAE+VECAIKTARRYHY  G   ++R
Sbjct: 63  LWHVSNLYRIPEQERLAERLVENSFADKVFFTNSGAEAVECAIKTARRYHYGKGHPERYR 122

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           I+TFEGAFHGRTLATI+AGG+ +YLEGFGP + GFDQ  F D+++LK  I+ +TAAILIE
Sbjct: 123 IITFEGAFHGRTLATIAAGGQEKYLEGFGPLVPGFDQVPFGDIEALKAAITPNTAAILIE 182

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGG+R  P+EFL+ LR++CD+   LLIFDEVQ G GRTGKLFA+EWA V PDIM +
Sbjct: 183 PIQGEGGIRPAPDEFLKGLRQLCDENGLLLIFDEVQCGMGRTGKLFAHEWAGVTPDIMAV 242

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AKG+GGGFP+GACLAT E A  M  G+HGSTYGGN LAM +G  VL++I + GFL+NV  
Sbjct: 243 AKGIGGGFPLGACLATEEAAKGMTPGTHGSTYGGNPLAMAVGNAVLDVILAPGFLDNVQR 302

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVV 363
           +   L + L  + +RFP++  EVRG+GLL+GLK V     L    RDE LLT  + DNVV
Sbjct: 303 MGLYLKQKLEGLVDRFPDVIEEVRGKGLLLGLKCVVPNRDLVQALRDEGLLTVGAGDNVV 362

Query: 364 RILPPLTITAEEIHEGLERIERTA 387
           R+LPPL IT EEI E LER+ER A
Sbjct: 363 RLLPPLIITEEEIDEALERLERAA 386


>gnl|CDD|179453 PRK02627, PRK02627, acetylornithine aminotransferase; Provisional.
          Length = 396

 Score =  508 bits (1311), Expect = e-145
 Identities = 186/381 (48%), Positives = 253/381 (66%), Gaps = 2/381 (0%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L NTY +  I F +G+GA L+ ++G  +LDF +GIAVN+LGH HP+LV  ++ Q+ KL 
Sbjct: 13  YLMNTYGRLPIAFVRGEGARLWDDDGKEYLDFLAGIAVNNLGHCHPKLVEAIQEQAAKLI 72

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           H SNLY    QE  A  L+  +  D+VFF NSGAE+ E AIK AR+Y +  G   K  I+
Sbjct: 73  HTSNLYYIEPQEELAEKLVELSGMDKVFFCNSGAEANEAAIKLARKYGHKKGI-EKPEII 131

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
           T E +FHGRTLAT+SA G+ +Y EGF P +EGF    F D+++LK  I++ TAA+++EPI
Sbjct: 132 TAENSFHGRTLATLSATGQPKYQEGFEPLVEGFIYVPFNDIEALKAAITDKTAAVMLEPI 191

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGGV    +E+LQ LR++CD+   LLI DEVQTG GRTGKLFAY+   ++PDIMT+AK
Sbjct: 192 QGEGGVNPADKEYLQALRELCDENGILLILDEVQTGMGRTGKLFAYQHYGIEPDIMTLAK 251

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGG PIGA LA  +VA     G HGST+GGN LA      V+ II+ +G LEN   + 
Sbjct: 252 GLGGGVPIGAVLAKEKVADVFTPGDHGSTFGGNPLACAAALAVIEIIEEEGLLENAAEVG 311

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRI 365
           + L   L  +  ++P    EVRG GL+IG++     A +  K  ++ LL   + DNV+R+
Sbjct: 312 EYLRAKLRELLEKYP-GIKEVRGLGLMIGIELDRPAAEIVKKALEKGLLINVTGDNVLRL 370

Query: 366 LPPLTITAEEIHEGLERIERT 386
           LPPL I+ EEI E ++R+E  
Sbjct: 371 LPPLIISKEEIDEAVDRLEEV 391


>gnl|CDD|162005 TIGR00707, argD, acetylornithine and succinylornithine
           aminotransferases.  Members of this family may also act
           on ornithine, like ornithine aminotransferase (EC
           2.6.1.13) (see MEDLINE:90337349) and on
           succinyldiaminopimelate, like
           N-succinyldiaminopmelate-aminotransferase (EC 2.6.1.17,
           DapC, an enzyme of lysine biosynthesis) (see
           MEDLINE:99175097).
          Length = 379

 Score =  440 bits (1133), Expect = e-124
 Identities = 189/379 (49%), Positives = 249/379 (65%), Gaps = 3/379 (0%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +L NTY +  ++  +GKGA+++  NG  +LDF +GIAVNSLGH+HP+LV  LK Q EKL 
Sbjct: 1   YLMNTYGRLPVKIVRGKGAYVYDVNGKEYLDFVAGIAVNSLGHAHPKLVEALKEQLEKLV 60

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           HVSNLY +  QE  A  L+  + ADRVFF NSGAE+ E A+K AR+Y    GK  K +I+
Sbjct: 61  HVSNLYYTEPQEELAEKLVEHSGADRVFFCNSGAEANEAALKLARKYTGDKGK-EKKKII 119

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
            FE +FHGRT+  +SA G+ +Y +GF P + GF  A + D++SLK  I ++TAA+++EPI
Sbjct: 120 AFENSFHGRTMGALSATGQPKYQKGFEPLVPGFSYAPYNDIESLKKAIDDETAAVIVEPI 179

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGEGGV     EFL+ LR+IC D DALLIFDEVQTG GRTGK FAYE   ++PDI+T+AK
Sbjct: 180 QGEGGVNPASAEFLKALREICKDKDALLIFDEVQTGIGRTGKFFAYEHYGIEPDIITLAK 239

Query: 246 GMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIA 305
           G+GGG PIGA LA  EVA     G HGST+GGN LA      VL +I+ +  LENV    
Sbjct: 240 GLGGGVPIGATLAKEEVAEAFTPGDHGSTFGGNPLACAAALAVLEVIEKERLLENVKEKG 299

Query: 306 KILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRI 365
               E L  +   +PN   EVRG+GL++G++       +  K  ++ LL   +   V+R 
Sbjct: 300 DYFKERLEELGKNYPNK--EVRGKGLMLGIELEAPCKDIVKKALEKGLLVNCAGPKVLRF 357

Query: 366 LPPLTITAEEIHEGLERIE 384
           LPPL IT EEI E +  +E
Sbjct: 358 LPPLIITKEEIDEAVSALE 376


>gnl|CDD|179933 PRK05093, argD, bifunctional
           N-succinyldiaminopimelate-
           aminotransferase/acetylornithine transaminase protein;
           Reviewed.
          Length = 403

 Score =  412 bits (1062), Expect = e-116
 Identities = 177/379 (46%), Positives = 231/379 (60%), Gaps = 13/379 (3%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ ++ + G  ++DFA GIAV +LGH HP LV  LK Q EKLWH+SN++ +      
Sbjct: 28  RGEGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVKALKEQGEKLWHISNVFTNEPALRL 87

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI +TFA+RVFF NSGAE+ E A K ARRY        K  I+ F  +FHGRTL T+
Sbjct: 88  AKKLIDATFAERVFFANSGAEANEAAFKLARRYACDRHGPEKTEIIAFHNSFHGRTLFTV 147

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           S GG+ +Y +GFGPK        F DL ++K  I + T A+++EPIQGEGGV     EFL
Sbjct: 148 SVGGQPKYSDGFGPKPADITHVPFNDLAAVKAVIDDHTCAVVVEPIQGEGGVIPATPEFL 207

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q LR++CD  +ALLIFDEVQTG GRTG LFAY    V PDI+T AK +GGGFPIGA L T
Sbjct: 208 QGLRELCDQHNALLIFDEVQTGMGRTGDLFAYMHYGVTPDILTSAKALGGGFPIGAMLTT 267

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            E+A+    G+HGSTYGGN LA  + E V +II +   LE V    +   +GL  I  ++
Sbjct: 268 AEIASHFKVGTHGSTYGGNPLACAVAEAVFDIINTPEVLEGVKARRQRFVDGLQKINQKY 327

Query: 320 PNMFLEVRGQGLLIGLKTVFSPA--------LLAAKFRDECLLTAPSSDNVVRILPPLTI 371
             +F E+RG GLLIG      P         L AA   +E ++   +  +V+R  P L I
Sbjct: 328 -GVFSEIRGMGLLIG--AELKPQYKGRARDFLNAAA--EEGVMVLVAGPDVLRFAPSLVI 382

Query: 372 TAEEIHEGLERIERTAIKL 390
              +I EGL R E+   K+
Sbjct: 383 EEADIDEGLARFEKAVAKV 401


>gnl|CDD|132290 TIGR03246, arg_catab_astC, succinylornithine transaminase family.
           Members of the seed alignment for this protein family
           are the enzyme succinylornithine transaminase (EC
           2.6.1.81), which catalyzes the third of five steps in
           arginine succinyltransferase (AST) pathway, an
           ammonia-releasing pathway of arginine degradation. All
           seed alignment sequences are found within arginine
           succinyltransferase operons, and all proteins that score
           above 820.0 bits should function as succinylornithine
           transaminase. However, a number of sequences extremely
           closely related in sequence, found in different genomic
           contexts, are likely to act in different biological
           processes and may act on different substrates. This
           model is desigated subfamily rather than equivalog,
           pending further consideration, for this reason.
          Length = 397

 Score =  386 bits (993), Expect = e-108
 Identities = 175/392 (44%), Positives = 241/392 (61%), Gaps = 17/392 (4%)

Query: 4   NDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEK 63
           +  +   Y  +     +G+G+ ++ + G  ++DFA GIAVN+LGH+HPELV  L  Q++K
Sbjct: 7   DQVMVPNYAPAPFIPVRGEGSRVWDQQGKEYIDFAGGIAVNALGHAHPELVKALIEQADK 66

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           LWH+ N Y +      A  L+ +TFAD+VFF NSGAE+ E A+K ARRY       +K  
Sbjct: 67  LWHIGNGYTNEPVLRLAKKLVDATFADKVFFCNSGAEANEAALKLARRYALDKHGADKSE 126

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           IV F+ +FHGRTL T+S GG+ +Y +GF P   G   A + DL + K  IS+ T A+++E
Sbjct: 127 IVAFKNSFHGRTLFTVSVGGQPKYSQGFAPLPGGIKHAPYNDLAAAKALISDKTCAVIVE 186

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGEGGV      FL+ LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PDI+T 
Sbjct: 187 PIQGEGGVVPADPAFLKGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDILTS 246

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AK +GGGFPIGA L T E+AA +  G+HG+TYGGN LA  +  KVL+++ +   L  V  
Sbjct: 247 AKALGGGFPIGAMLTTTEIAAHLKVGTHGTTYGGNPLACAVAGKVLDLVNTPELLAGVKQ 306

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL----------KTVFSPALLAAKFRDECL 353
              +  +GL  I  R+ N+F E+RG+GLLIG           K   + A       +E +
Sbjct: 307 RHDLFVDGLEKINARY-NVFSEIRGKGLLIGAVLTEAYQGKAKQFVNAAA------EEGV 359

Query: 354 LTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
           +   +  NVVR  P L I+ ++I EGL R ER
Sbjct: 360 IALIAGPNVVRFAPSLVISDDDIDEGLARFER 391


>gnl|CDD|179505 PRK02936, argD, acetylornithine aminotransferase; Provisional.
          Length = 377

 Score =  369 bits (950), Expect = e-103
 Identities = 162/380 (42%), Positives = 232/380 (61%), Gaps = 11/380 (2%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           LF TY +  I   KGKG  +   NG  +LDF SGIAV +LGH HP +   ++ Q + +WH
Sbjct: 4   LFPTYGRFPIDIVKGKGTKVTDNNGKTYLDFTSGIAVCNLGHCHPTVTKAVQEQLDDIWH 63

Query: 67  VSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
           VSNL+ ++ QE  A+ L  ++  D VFF NSGAE+ E A+K AR++      T K +IVT
Sbjct: 64  VSNLFTNSLQEEVASLLAENSAGDLVFFCNSGAEANEAALKLARKH------TGKSKIVT 117

Query: 127 FEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQ 186
           FE +FHGRT  T+SA G+ +  EGFGP + GF    F D+++LK  ++ + AA+++E +Q
Sbjct: 118 FEQSFHGRTFGTMSATGQEKIKEGFGPLLPGFTHVPFNDIKALKEVMNEEVAAVMLEVVQ 177

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGGV      FLQ+++ +C    ALLI DEVQTG GRTG LFAYE   + PDI+T+AKG
Sbjct: 178 GEGGVIPADPAFLQEVQTLCKKFGALLIIDEVQTGIGRTGTLFAYEQFGLDPDIVTVAKG 237

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           +G G P+GA +   E+      GSHGST+GGN LAM   ++VL +I+   FLE V    +
Sbjct: 238 LGNGIPVGAMIGKKELGTAFGPGSHGSTFGGNPLAMAAAKEVLQVIKQPSFLEEVQEKGE 297

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRDECLLTAPSSDNVVR 364
              + L         +   +RG+GL+IG       +P +   + R+E LL   +  NV+R
Sbjct: 298 YFLQKLQEELEHLECV-KNIRGKGLMIGIECTEEVAPVI--EQLREEGLLVLSAGPNVIR 354

Query: 365 ILPPLTITAEEIHEGLERIE 384
           +LPPL +T EE+ + +  ++
Sbjct: 355 LLPPLVVTKEELDQAVYLLK 374


>gnl|CDD|183486 PRK12381, PRK12381, bifunctional succinylornithine
           transaminase/acetylornithine transaminase; Provisional.
          Length = 406

 Score =  367 bits (945), Expect = e-102
 Identities = 172/373 (46%), Positives = 227/373 (60%), Gaps = 11/373 (2%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G+ L+ + G  ++DFA GIAVN+LGH+HP L   L  Q+ K WH  N Y +      
Sbjct: 27  RGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQASKFWHTGNGYTNEPVLRL 86

Query: 80  ANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI 139
           A  LI +TFADRVFF NSGAE+ E A+K AR+Y +    ++K  IV F+ AFHGRTL T+
Sbjct: 87  AKKLIDATFADRVFFCNSGAEANEAALKLARKYAHDRYGSHKSGIVAFKNAFHGRTLFTV 146

Query: 140 SAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFL 199
           SAGG+ +Y + F P       A + DL S    I + T A+++EPIQGEGGV    + FL
Sbjct: 147 SAGGQPKYSQDFAPLPPDIRHAAYNDLNSASALIDDQTCAVIVEPIQGEGGVIPADKAFL 206

Query: 200 QQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLAT 259
           Q LR++CD  +ALLIFDEVQTG GRTG+L+AY    V PD++T AK +GGGFPIGA L T
Sbjct: 207 QGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDVLTTAKALGGGFPIGAMLTT 266

Query: 260 NEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            + A+ M  G+HG+TYGGN LA  +  KVL +I +   L  V        E L  I  R+
Sbjct: 267 EKCASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINARY 326

Query: 320 PNMFLEVRGQGLLIG--LKTVFSP-----ALLAAKFRDECLLTAPSSDNVVRILPPLTIT 372
             +F E+RG GLLIG  L   ++      +  AAK     ++   +  NVVR  P L I+
Sbjct: 327 -GLFSEIRGLGLLIGCVLNAEYAGKAKQISQEAAK---AGVMVLIAGPNVVRFAPALNIS 382

Query: 373 AEEIHEGLERIER 385
            EEI  GL+R  R
Sbjct: 383 EEEITTGLDRFAR 395


>gnl|CDD|179555 PRK03244, argD, acetylornithine aminotransferase; Provisional.
          Length = 398

 Score =  345 bits (887), Expect = 1e-95
 Identities = 152/382 (39%), Positives = 215/382 (56%), Gaps = 16/382 (4%)

Query: 7   LFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWH 66
           + N Y    +   +G+GA ++  +G  +LD   GIAVN+LGH+HP +V  +  Q   L H
Sbjct: 18  MMNNYGTPPLALVRGEGAVVWDVDGKEYLDLLGGIAVNALGHAHPAVVEAVTRQLATLGH 77

Query: 67  VSNLYQSTQQEIFANHLIHSTFAD---RVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           VSNL+ +  Q   A  L+    A    RVFF NSGAE+ E A K AR      G+T   +
Sbjct: 78  VSNLFATEPQIALAERLVELLGAPEGGRVFFCNSGAEANEAAFKLARLT----GRT---K 130

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE 183
           IV  EG FHGRT+  ++  G+      F P   G +   + D+ +L   + +DTAA+ +E
Sbjct: 131 IVAAEGGFHGRTMGALALTGQPAKRAPFEPLPGGVEHVPYGDVDALAAAVDDDTAAVFLE 190

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           PIQGE GV   P  +L   R+I D   ALL+ DEVQTG GRTG  FA++   V PD++T+
Sbjct: 191 PIQGEAGVVPPPAGYLAAAREITDRHGALLVLDEVQTGIGRTGAWFAHQHDGVTPDVVTL 250

Query: 244 AKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVIN 303
           AKG+GGG PIGACLA    A  +  G HGST+GGN +A      VL+ I S+G LEN   
Sbjct: 251 AKGLGGGLPIGACLAFGPAADLLTPGLHGSTFGGNPVACAAALAVLDTIASEGLLENAER 310

Query: 304 IAKILFEGLTAIKNRFPNMFLEVRGQGLLIG--LKTVFSPALLAAKFRDECLLTAPSSDN 361
           + + L  G+ A+ +  P +   VRG+GLL+G  L    + A+ AA  R+   L    + +
Sbjct: 311 LGEQLRAGIEALGH--P-LVDHVRGRGLLLGIVLTAPVAKAVEAAA-REAGFLVNAVAPD 366

Query: 362 VVRILPPLTITAEEIHEGLERI 383
           V+R+ PPL IT  ++   +  +
Sbjct: 367 VIRLAPPLIITDAQVDAFVAAL 388


>gnl|CDD|185461 PTZ00125, PTZ00125, ornithine aminotransferase-like protein;
           Provisional.
          Length = 400

 Score =  345 bits (886), Expect = 2e-95
 Identities = 131/398 (32%), Positives = 216/398 (54%), Gaps = 11/398 (2%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQS 61
            +N +  + Y    +  ++GKG +++   G  + DF S  +  + GH HP+++A L +Q+
Sbjct: 1   LENQYGAHNYHPLPVVLKRGKGVFVWDVEGKKYYDFLSAYSAVNQGHCHPKILAALINQA 60

Query: 62  EKLWHVSNLYQSTQQEIFANHLIHSTFA-DRVFFTNSGAESVECAIKTARRYHYMAGK-- 118
           +KL   S  + +    +   + I   F  D+V   NSGAE+ E A+K AR++ Y      
Sbjct: 61  QKLTLTSRAFYNDVLGLAEKY-ITDLFGYDKVLPMNSGAEAGETALKFARKWGYEVKGIP 119

Query: 119 TNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISND-T 177
            N+ +I+   G F GRT+   SA    +    FGP + GF+   + D+++L+  + +   
Sbjct: 120 ENQAKIIFCNGNFSGRTIGACSASTDPKCYNNFGPFVPGFELVDYNDVEALEKLLQDPNV 179

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
           AA ++EPIQGE GV    + +L+Q+ ++C   + LLI DE+QTG GRTGKL A++   VK
Sbjct: 180 AAFIVEPIQGEAGVIVPDDGYLKQVYELCKKYNVLLIVDEIQTGLGRTGKLLAHDHEGVK 239

Query: 238 PDIMTIAKGMGGGF-PIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDG 296
           PDI+ + K + GG  PI A LA ++V   +  G HGSTYGGN LA  +  + L +++ + 
Sbjct: 240 PDIVLLGKALSGGLYPISAVLANDDVMLVIKPGEHGSTYGGNPLACAVAVEALEVLKEEK 299

Query: 297 FLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL----KTVFSPALLAAKFRDEC 352
             EN   + ++  +GL  +  +      E+RG+GLL  +        +   L  K ++  
Sbjct: 300 LAENAQRLGEVFRDGLKELL-KKSPWVKEIRGKGLLNAIVFDHSDGVNAWDLCLKLKENG 358

Query: 353 LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKL 390
           LL  P+ DN++R  PPL IT E++ + LE I++     
Sbjct: 359 LLAKPTHDNIIRFAPPLVITKEQLDQALEIIKKVLKSF 396


>gnl|CDD|177748 PLN00144, PLN00144, acetylornithine transaminase.
          Length = 382

 Score =  343 bits (882), Expect = 5e-95
 Identities = 159/369 (43%), Positives = 214/369 (57%), Gaps = 12/369 (3%)

Query: 18  FEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQE 77
           F  GKG  L+   G  +LD A+GIAVN+LGH  P+ V  +  Q+  L HVSN+Y +  Q 
Sbjct: 1   FVSGKGCKLYDVEGKEYLDMAAGIAVNALGHGDPDWVKAVAEQAGTLAHVSNVYHTIPQV 60

Query: 78  IFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK-------FRIVTFEGA 130
             A  L+ S+FADRVFF NSG E+ E AIK AR+Y  +     K          V+F  +
Sbjct: 61  ELAKRLVASSFADRVFFCNSGTEANEAAIKFARKYQRVRAPDKKDPAASSATEFVSFSNS 120

Query: 131 FHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQI-SNDTAAILIEPIQGEG 189
           FHGRTL  ++   K QY   F P + G    ++ +L++ +  I    TAA+ +EP+QGEG
Sbjct: 121 FHGRTLGALALTSKEQYRTPFEPLMPGVTFVEYGNLEAARKLIQKGKTAAVFVEPVQGEG 180

Query: 190 GVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGG 249
           G+    +EFLQ LR +CD+  ALL+FDEVQ G GRTG L+A+E   V+PDIMT+AK + G
Sbjct: 181 GIYPATKEFLQGLRALCDEAGALLVFDEVQCGLGRTGYLWAHEAYGVEPDIMTLAKPLAG 240

Query: 250 GFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILF 309
           G PIGA L T +VA+ +N G HGST+ G  L       VL+ I   GFL +V    + L 
Sbjct: 241 GLPIGAVLVTEKVASAINPGDHGSTFAGGPLVCNAALAVLDKISKPGFLASVAKKGEYLR 300

Query: 310 EGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECL--LTAPSSDNVVRILP 367
           E L       P++  EVRG GLL+G++       L    RD  L  LTA    +VVR++P
Sbjct: 301 ELLRRKLGGNPHV-KEVRGVGLLVGIQLDVPAGPLVDACRDSGLLVLTA-GKGDVVRLVP 358

Query: 368 PLTITAEEI 376
           PL I+  E+
Sbjct: 359 PLVISEAEL 367


>gnl|CDD|179803 PRK04260, PRK04260, acetylornithine aminotransferase; Provisional.
          Length = 375

 Score =  324 bits (833), Expect = 2e-89
 Identities = 155/379 (40%), Positives = 224/379 (59%), Gaps = 15/379 (3%)

Query: 6   FLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           +LF  Y ++ I F K +G +L   +G  +LDF+SGI V +LG  HP++   L+ Q+  +W
Sbjct: 3   YLFQNYKRAAIEFVKAEGNYLIDTDGKKYLDFSSGIGVTNLGF-HPQVQQALQKQAGLIW 61

Query: 66  HVSNLYQSTQQEIFANHLIHSTFADR---VFFTNSGAESVECAIKTARRYHYMAGKTNKF 122
           H  NLY ++ QE  A  LI     D+    FF NSGAE+ E AIK AR+       T K 
Sbjct: 62  HSPNLYLNSLQEEVAQKLI----GDKDYLAFFCNSGAEANEAAIKIARK------ATGKQ 111

Query: 123 RIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILI 182
            I+TF+ +FHGRT  ++SA G+ +  +GFG  +  F  A F DL S+K  ++ +TAA+++
Sbjct: 112 EIITFQNSFHGRTFGSMSATGQDKIKDGFGDGVPHFSYAIFNDLNSVKALVNKNTAAVML 171

Query: 183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMT 242
           E +QGE GV    ++F++ L   C +   LLI DEVQTG GRTGKL+A+E   ++PDI T
Sbjct: 172 ELVQGESGVLPADKDFVKALADYCQETGILLIVDEVQTGMGRTGKLYAFEHYGIEPDIFT 231

Query: 243 IAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVI 302
           +AKG+  G P+GA LA + +      GSHGST+GGN L+M      L+I+ + GFLE  +
Sbjct: 232 LAKGLANGVPVGAMLAKSSLGGAFGYGSHGSTFGGNKLSMAAASATLDIMLTAGFLEQAL 291

Query: 303 NIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNV 362
                L E L         +   VRG G +IG++T    + L    RD+ L+   +  NV
Sbjct: 292 ENGNYLQEQLQKALQDKETV-TTVRGLGYMIGIETTADLSQLVEAARDKGLIVLTAGTNV 350

Query: 363 VRILPPLTITAEEIHEGLE 381
           +R+LPPLT+T EEI +G+ 
Sbjct: 351 IRLLPPLTLTKEEIEQGIA 369


>gnl|CDD|179636 PRK03715, argD, acetylornithine transaminase protein; Provisional.
          Length = 395

 Score =  322 bits (828), Expect = 7e-89
 Identities = 161/376 (42%), Positives = 220/376 (58%), Gaps = 18/376 (4%)

Query: 15  DIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQST 74
           DI F  GKG+WL+  NG  +LDF  G AVN LGH +P +V  L +Q+EKL + S  + + 
Sbjct: 19  DIVFTHGKGSWLYDHNGKRYLDFIQGWAVNCLGHCNPGMVEALAAQAEKLINPSPAFYNE 78

Query: 75  QQEIFANHLI-HSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNK---FRIVTFEGA 130
                A  L  HS F D+VFF NSGAE+ E AIK AR++    G+ +K   + I+TF+ +
Sbjct: 79  PMAKLAGLLTQHSCF-DKVFFANSGAEANEGAIKLARKW----GRKHKNGAYEIITFDHS 133

Query: 131 FHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGG 190
           FHGRTLAT+SA GK  +   F P++ GF +A+  D+ S++  I++ T A+++EP+QGEGG
Sbjct: 134 FHGRTLATMSASGKPGWDTIFAPQVPGFPKAELNDIASVEKLITDKTVAVMLEPVQGEGG 193

Query: 191 VRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGG 250
           V     EF+QQLR +      LLI DEVQTG GRTG LFAYE + ++PDIMT+ KG+GGG
Sbjct: 194 VIPATREFMQQLRALTKQHGLLLIVDEVQTGCGRTGTLFAYELSGIEPDIMTLGKGIGGG 253

Query: 251 FPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFE 310
            P+ A LA  EV A    G  G TY GN L   +G  V++ + + GFLE V    + L E
Sbjct: 254 VPLAALLAKAEV-AVFEAGDQGGTYNGNPLMTAVGVAVISQLLAPGFLEGVRARGEYLKE 312

Query: 311 GLTAIKNRFPNMFLEVRGQGLLIGLKTV--FSPALLAAKFR---DECLLTAPSSDNVVRI 365
            L  +           RG+GLL  L       P ++        D  LL AP   N++R 
Sbjct: 313 KLLELSEERG--LEGERGEGLLRALLLGKDIGPQIVEKARDMQPDGLLLNAPRP-NLLRF 369

Query: 366 LPPLTITAEEIHEGLE 381
           +P L +T EEI + + 
Sbjct: 370 MPALNVTTEEIDQMIA 385


>gnl|CDD|180248 PRK05769, PRK05769, 4-aminobutyrate aminotransferase; Provisional.
          Length = 441

 Score =  315 bits (809), Expect = 1e-86
 Identities = 152/409 (37%), Positives = 220/409 (53%), Gaps = 49/409 (11%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS--NLYQSTQQ 76
           E+G+G W+   +G  +LDF +GIAV ++GH+HP++V  +K Q+EK  H S  + Y     
Sbjct: 41  ERGEGVWVEDVDGNVYLDFNAGIAVTNVGHAHPKVVKAVKEQAEKFLHYSLTDFYYEPAV 100

Query: 77  EIFANHLIHST---FADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHG 133
           E+ A  L+      F  +VFFTNSG ES E AIK AR +      T +  I+ F GAFHG
Sbjct: 101 EL-AERLVEIAPGGFEKKVFFTNSGTESNEAAIKIARYH------TGRKYIIAFLGAFHG 153

Query: 134 RTLATIS-AGGKLQYLEGFGPKIEGFDQAKFCD------------------LQSLKNQI- 173
           RT  ++S    K    +GF P + G     + +                  L  +++ + 
Sbjct: 154 RTYGSLSLTASKPVQRKGFFPLMPGVIHVPYPNPYRNPWGIENPEECGNAVLDFIEDYLF 213

Query: 174 -----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKL 228
                  + AAI++EPIQGEGG    P+ F ++LRK+ D    LLI DEVQTG GRTGK+
Sbjct: 214 KKLVPPEEVAAIIVEPIQGEGGYVVPPKNFFKELRKLADKYGILLIDDEVQTGMGRTGKM 273

Query: 229 FAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKV 288
           FA E   V+PDI+T+AK + GG P+GA +   E+   +  GSH +T+GGN +A       
Sbjct: 274 FAIEHFGVEPDIITLAKAIAGGLPLGAVIGRAELMF-LPPGSHANTFGGNPVAAAAALAT 332

Query: 289 LNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKF 348
           L  ++ +G LEN   + + L + L  +K ++  +  +VRG GL+IG++ V        K 
Sbjct: 333 LEELE-EGLLENAQKLGEYLRKELKELKEKYEFIG-DVRGLGLMIGVELVKDRKEPDPKL 390

Query: 349 RDECLLTA--------PSSDNVVRILPPLTITAEEIHEGLERIERTAIK 389
           RD+ L  A         +  + +RI+PPL IT EE   GLE I   AIK
Sbjct: 391 RDKVLYEAFKRGLLLLGAGKSAIRIIPPLIITEEEADIGLE-ILEEAIK 438


>gnl|CDD|179868 PRK04612, argD, acetylornithine transaminase protein; Provisional.
          Length = 408

 Score =  304 bits (780), Expect = 2e-83
 Identities = 163/387 (42%), Positives = 230/387 (59%), Gaps = 13/387 (3%)

Query: 11  YDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNL 70
           Y    +  E+G+G+ ++ + G  +LD A+GIAV  LGH+ P+LVA L  Q+ KLWH SN+
Sbjct: 19  YRPRQVVLERGQGSRVWDDQGREYLDLAAGIAVCGLGHNDPDLVAALTEQAGKLWHTSNV 78

Query: 71  YQSTQQEIFANHLIH-STFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR-IVTFE 128
           + S      A  L+  S FA++VF  NSG E+ E AIK  R++    G+    R IVTF 
Sbjct: 79  FYSAPPLKLAEELVTASRFAEKVFLCNSGTEANEAAIKLVRKWASSQGRPADKRVIVTFR 138

Query: 129 GAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQI-SNDTAAILIEPIQG 187
           G+FHGRTLA ++A  + +Y EG+ P   GF    F D+++L+  +   D AA+++EPIQG
Sbjct: 139 GSFHGRTLAAVTATAQPKYQEGYEPLPGGFRYVDFNDVEALEAAMAGGDVAAVMLEPIQG 198

Query: 188 EGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGM 247
           EGGV      FL ++R +CD  DALL+ DE+Q G GRTG LFA+    V PDI+T+AK +
Sbjct: 199 EGGVMPAAPGFLARVRALCDQHDALLVLDEIQCGMGRTGTLFAHWQEQVTPDIVTLAKAL 258

Query: 248 GGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKI 307
           GGGFPIGA LA  +VA  M  G+HG+T+GGN LA  +    L  + S     NV   +  
Sbjct: 259 GGGFPIGAMLAGPKVAETMQFGAHGTTFGGNPLAAAVARVALRKLASPQIAANVARQSAA 318

Query: 308 LFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALL--AAKFRDEC----LLTAPSSDN 361
           L  GL A+   F  +F +VRG+GL++G   V +PA    A    D      LL   +  +
Sbjct: 319 LRAGLEALNAEF-GVFAQVRGRGLMLG--AVLAPAHAGQAGAILDLAAEHGLLLLQAGPD 375

Query: 362 VVRILPPLTITAEEIHEGLERIERTAI 388
           V+R +P L +T  E+ +GL R+ R A+
Sbjct: 376 VLRFVPALNLTDAELADGLARL-RLAL 401


>gnl|CDD|130940 TIGR01885, Orn_aminotrans, ornithine aminotransferase.  This model
           describes the final step in the biosynthesis of
           ornithine from glutamate via the non-acetylated pathway.
           Ornithine amino transferase takes L-glutamate
           5-semialdehyde and makes it into ornithine, which is
           used in the urea cycle, as well as in the biosynthesis
           of arginine. This model includes low-GC bacteria and
           eukaryotic species. The genes from two species are
           annotated as putative acetylornithine aminotransferases
           - one from Porphyromonas gingivalis, and the other from
           Staphylococcus aureus. After homology searching using
           BLAST it was determined that these two sequences were
           most closely related to ornithine aminotransferases.
           This model's seed includes one characterized hit, from
           Bacillus subtilis.
          Length = 401

 Score =  296 bits (761), Expect = 5e-81
 Identities = 140/400 (35%), Positives = 216/400 (54%), Gaps = 22/400 (5%)

Query: 2   NKNDFLFNTYDQSDIRFEKGKGAWLFSENGIPFLDFASGI-AVNSLGHSHPELVAILKSQ 60
            +N +  + Y    + F K +G  ++   G  +LDF S   AVN  GH HP++V  L  Q
Sbjct: 7   RENKYGAHNYHPLPVVFSKAEGVHVWDVEGKRYLDFLSAYSAVNQ-GHCHPKIVKALTEQ 65

Query: 61  SEKLWHVSNLYQSTQQEIFANHLIHSTFA-DRVFFTNSGAESVECAIKTARRYHYMAGK- 118
           ++KL   S  + +     FA + +   F  D+V   N+GAE+VE AIK AR++ Y     
Sbjct: 66  AQKLTLSSRAFYNDVFGEFAEY-VTKLFGYDKVLPMNTGAEAVETAIKLARKWGYKVKGI 124

Query: 119 -TNKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISND- 176
             N+  IV+ +G FHGRTL  IS          FGP + GF +  + +L++L+  + +  
Sbjct: 125 PENQAIIVSAKGNFHGRTLGAISMSTDPDSRTNFGPYVPGFKKIPYNNLEALEEALEDHG 184

Query: 177 --TAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWA 234
               A ++EPIQGE GV    + +L+++R++C   + LLI DE+QTG GRTGKL   +  
Sbjct: 185 PNVCAFIVEPIQGEAGVVVPDDGYLKKVRELCTKHNVLLIADEIQTGLGRTGKLLCVDHE 244

Query: 235 NVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQ 293
           NVKPDI+ + K + GG  P+ A LA ++V   +  G HGSTYGGN LA  +    L +++
Sbjct: 245 NVKPDIVLLGKALSGGVYPVSAVLADDDVMLTIKPGEHGSTYGGNPLACAVAVAALEVLE 304

Query: 294 SDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAA------- 346
            +   EN   + +I  + L  +      +  EVRG+GLL  +  V   +           
Sbjct: 305 EEKLAENAEKLGEIFRDQLKKLPK---PIITEVRGRGLLNAI--VIDESKTGRTAWDLCL 359

Query: 347 KFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERT 386
           K +++ LL  P+  N++R+ PPL IT E++ EGLE I++ 
Sbjct: 360 KLKEKGLLAKPTHGNIIRLAPPLVITEEQLDEGLEIIKKV 399


>gnl|CDD|181234 PRK08117, PRK08117, 4-aminobutyrate aminotransferase; Provisional.
          Length = 433

 Score =  295 bits (758), Expect = 1e-80
 Identities = 153/410 (37%), Positives = 226/410 (55%), Gaps = 43/410 (10%)

Query: 12  DQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHV-SNL 70
           D  ++   KG+G + +  +G  +LDF SGIAV ++GH HP++V  +K Q++KL H  S +
Sbjct: 23  DHPNLPVVKGEGCYYYGVDGKEYLDFTSGIAVANVGHRHPKVVQAIKEQADKLMHGPSGV 82

Query: 71  YQSTQQEIFANHLIHSTFA--DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFE 128
                    A  L   T    D  FF+NSGAE++E A+K A+        T +  I++F 
Sbjct: 83  IYYESILKLAEELAEITPGGLDCFFFSNSGAEAIEGALKLAKHV------TKRPYIISFT 136

Query: 129 GAFHGRTLATIS-AGGKLQYLEGFGPKIEGFDQA--------------------KFCDLQ 167
           G FHGRTL  +S    K +Y + + P +    QA                       DL+
Sbjct: 137 GCFHGRTLGALSVTTSKSKYRKYYQPLLGSVYQAPYPYCDRCPKGEDPEVCFLECLRDLE 196

Query: 168 SL-KNQISND-TAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRT 225
           SL K+Q++ +  AA++IEP+ GEGG    P+ FL++LR+ICD    LLIFDEVQTG+GRT
Sbjct: 197 SLFKHQVTPEEVAAVIIEPVLGEGGYIVPPKSFLKKLREICDRHGILLIFDEVQTGFGRT 256

Query: 226 GKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLG 285
           G+ FA +   V PDIMTIAKG+  G P+ A +A+ E+      GSHG+T+GGN +A    
Sbjct: 257 GEWFAAQTFGVVPDIMTIAKGIASGLPLSAVVASKELMEQWPLGSHGTTFGGNPVACAAA 316

Query: 286 EKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVF---SPA 342
              L +I+ +  L+N   +     E L  +K + P +  +VRG GL+IG++ V     P 
Sbjct: 317 LATLEVIKEEKLLDNANEMGAYALERLEVLKEKHP-VIGDVRGIGLMIGIEIVDPDGEPD 375

Query: 343 -LLAAKFRDECL------LTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
                K  D+CL          ++ NV+R++PPLT+T EEI EGL+ ++ 
Sbjct: 376 GDAVEKILDKCLEKGLLFYLCGNAGNVLRMIPPLTVTKEEIDEGLDILDE 425


>gnl|CDD|179736 PRK04073, rocD, ornithine--oxo-acid transaminase; Provisional.
          Length = 396

 Score =  286 bits (733), Expect = 9e-78
 Identities = 145/381 (38%), Positives = 209/381 (54%), Gaps = 8/381 (2%)

Query: 9   NTYDQSDIRFEKGKGAWLFSENGIPFLDFASGI-AVNSLGHSHPELVAILKSQSEKLWHV 67
           + Y    I   + +G W+    G  ++D  S   AVN  GH HP+++  LK Q++K+   
Sbjct: 17  HNYHPLPIVISEAEGVWVKDPEGNRYMDMLSAYSAVNQ-GHRHPKIIQALKDQADKVTLT 75

Query: 68  SNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKT--NKFRIV 125
           S  + S Q   +   +   T  D V   N+GAE+VE AIK ARR+ Y       NK  I+
Sbjct: 76  SRAFHSDQLGPWYEKVAKLTGKDMVLPMNTGAEAVETAIKAARRWAYDVKGVEPNKAEII 135

Query: 126 TFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPI 185
             EG FHGRT+A +S   + +Y  GFGP + G  +  + DL++LK  I+ +TAA L+EPI
Sbjct: 136 ACEGNFHGRTMAAVSLSSEEEYKRGFGPMLPGIKKIPYGDLEALKAAITPNTAAFLVEPI 195

Query: 186 QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAK 245
           QGE G+   PE FL+  R++C + + L I DE+QTG GRTGKLFA +W NV PD+  + K
Sbjct: 196 QGEAGINIPPEGFLKAARELCKEENVLFIADEIQTGLGRTGKLFACDWDNVTPDMYILGK 255

Query: 246 GMGGG-FPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINI 304
            +GGG FPI    A  ++      GSHGST+GGN LA  +    L +++ +   E  + +
Sbjct: 256 ALGGGVFPISCVAANRDILGVFTPGSHGSTFGGNPLACAVSIAALEVLEEEKLPERSLEL 315

Query: 305 AKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVR 364
            +   E L  I N    M  EVRG+GL IG++            ++E LL   + + V+R
Sbjct: 316 GEYFKEQLKEIDN---PMIKEVRGRGLFIGVELNEPARPYCEALKEEGLLCKETHETVIR 372

Query: 365 ILPPLTITAEEIHEGLERIER 385
             PPL IT EE+    E+I+ 
Sbjct: 373 FAPPLVITKEELDWAFEKIKA 393


>gnl|CDD|178231 PLN02624, PLN02624, ornithine-delta-aminotransferase.
          Length = 474

 Score =  283 bits (725), Expect = 7e-77
 Identities = 143/378 (37%), Positives = 208/378 (55%), Gaps = 16/378 (4%)

Query: 18  FEKGKGAWLFSENGIPFLDFASGI-AVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQ 76
           F + KG+ ++   G  +LDF S   AVN  GH HP+++  L  Q+EKL   S  + + + 
Sbjct: 61  FSRAKGSRIWDPEGKKYLDFLSAYSAVNQ-GHCHPKIIKALTEQAEKLTLSSRAFYNDKF 119

Query: 77  EIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKT--NKFRIVTFEGAFHGR 134
             FA +L      D V   N+GAE VE AIK AR++ Y       N+  IV+  G FHGR
Sbjct: 120 PEFAEYLTSMFGYDMVLPMNTGAEGVETAIKLARKWGYEKKGIPKNEAIIVSCCGCFHGR 179

Query: 135 TLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISND---TAAILIEPIQGEGGV 191
           TLA IS     +   GFGP + G  +  F DL +L+     D    AA L EPIQGE GV
Sbjct: 180 TLAAISMSCDNEATRGFGPLLPGHLKVDFGDLDALEKIFEEDGDRIAAFLFEPIQGEAGV 239

Query: 192 RKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGG- 250
              P+ +L+ +R++C   + L+I DE+QTG  RTGK+ A +W  V+PD++ + K +GGG 
Sbjct: 240 VIPPDGYLKAVRELCSKHNVLMIADEIQTGLARTGKMLACDWEEVRPDVVILGKALGGGV 299

Query: 251 FPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFE 310
            P+ A LA  +V  C+  G HGST+GGN LA  +    L ++Q +   E    + + L +
Sbjct: 300 IPVSAVLADKDVMLCIKPGEHGSTFGGNPLASAVAMAALQVVQDEKLAERSAKLGQELRD 359

Query: 311 GLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDEC-------LLTAPSSDNVV 363
            L  I+ +FP +  EVRG+GLL  +  + SP L      D C       LL  P+ D ++
Sbjct: 360 QLQKIQKQFPKLIKEVRGRGLLNAV-VLNSPKLGPVSAYDVCLKLKERGLLAKPTHDTII 418

Query: 364 RILPPLTITAEEIHEGLE 381
           R+ PPL+I+ +E+ E  +
Sbjct: 419 RLAPPLSISEDELQECSK 436


>gnl|CDD|183175 PRK11522, PRK11522, putrescine--2-oxoglutarate aminotransferase;
           Provisional.
          Length = 459

 Score =  259 bits (664), Expect = 8e-70
 Identities = 131/384 (34%), Positives = 205/384 (53%), Gaps = 30/384 (7%)

Query: 30  NGIPFLDFASGIAVNSLGHSHPELVAILKSQ--------SEKLWHVSNLYQSTQQEIFAN 81
            G  F+D   G  + ++GH +P +V+ +++Q         E L  +  +   T   +   
Sbjct: 80  QGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALTPG 139

Query: 82  HLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISA 141
            L +S      FF NSG ESVE A+K A+ Y    GK   F  +   GAFHG++L  +SA
Sbjct: 140 KLKYS------FFCNSGTESVEAALKLAKAYQSPRGK---FTFIATSGAFHGKSLGALSA 190

Query: 142 GGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISN------DTAAILIEPIQGEGGVRKVP 195
             K  + + F P + GF    F ++++++  +S       D AA+++EPIQGEGGV   P
Sbjct: 191 TAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALSECKKTGDDVAAVILEPIQGEGGVILPP 250

Query: 196 EEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGG-FPIG 254
           E +L  +RK+CD+  ALLI DEVQTG GRTGK+FA E  NV+PDI+ +AK +GGG  PIG
Sbjct: 251 EGYLTAVRKLCDEFGALLILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIG 310

Query: 255 ACLATNEVAACM--NQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGL 312
           A +AT EV + +  N   H +T+GGN LA       +N++               L +G 
Sbjct: 311 ATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDYLLDGF 370

Query: 313 TAIKNRFPNMFLEVRGQGLLIGLKTVFSPA--LLAAKFRDECLLTAPSSDN--VVRILPP 368
             +   +P++  E RG+G+L+ ++ V +      A++   + +L A + +N   +RI PP
Sbjct: 371 RQLAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPP 430

Query: 369 LTITAEEIHEGLERIERTAIKLSH 392
           LT+T E+  + L+   +    +  
Sbjct: 431 LTLTIEQCEQVLKAARKALAAMRV 454


>gnl|CDD|167080 PRK00854, rocD, ornithine--oxo-acid transaminase; Reviewed.
          Length = 401

 Score =  252 bits (645), Expect = 1e-67
 Identities = 130/384 (33%), Positives = 204/384 (53%), Gaps = 13/384 (3%)

Query: 11  YDQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNL 70
           Y   D+   +G+G W++  +G  +LD  S  +  + GH HP+++A +  Q+ +L   S  
Sbjct: 20  YKPLDVVLTRGEGVWVWDTDGNRYLDCLSAYSAVNQGHCHPKILAAMVEQAGRLTLTSRA 79

Query: 71  YQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKT--NKFRIVTFE 128
           +++ Q       L   T + +V   NSGAE+VE AIK  R++ Y        +  I+   
Sbjct: 80  FRNDQLAPLYEELAALTGSHKVLPMNSGAEAVETAIKAVRKWGYEVKGVPEGQAEIIVCA 139

Query: 129 GAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGE 188
             FHGRTL+ +          GFGP   GF    F D ++L+  I+ +T A L+EPIQGE
Sbjct: 140 DNFHGRTLSIVGFSTDPDARGGFGPFTPGFRVVPFGDAEALEAAITPNTVAFLVEPIQGE 199

Query: 189 GGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMG 248
            GV   P  +  ++R++C   +  LI DE+QTG GRTGKL A E   ++ D+  I K + 
Sbjct: 200 AGVIIPPAGYFTRVRELCTANNVTLILDEIQTGLGRTGKLLAEEHEGIEADVTLIGKALS 259

Query: 249 GGF-PIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKI 307
           GGF P+ A L+ +EV   +  G HGST+GGN LA  +    L ++  +G +EN   +   
Sbjct: 260 GGFYPVSAVLSNSEVLGVLKPGQHGSTFGGNPLACAVARAALKVLTEEGMIENAAEMGAY 319

Query: 308 LFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAA-----KFRDECLLTAPSSDNV 362
             EGL +I++   N+  EVRG+GL++ ++    P    A       ++  LL   + D+ 
Sbjct: 320 FLEGLRSIRS---NIVREVRGRGLMLAVE--LEPEAGGARQYCEALKERGLLAKDTHDHT 374

Query: 363 VRILPPLTITAEEIHEGLERIERT 386
           +R+ PPL IT E++   LE+I + 
Sbjct: 375 IRLAPPLVITREQVDWALEQIAKV 398


>gnl|CDD|101376 PRK04013, argD, acetylornithine/acetyl-lysine aminotransferase;
           Provisional.
          Length = 364

 Score =  243 bits (621), Expect = 7e-65
 Identities = 132/369 (35%), Positives = 197/369 (53%), Gaps = 21/369 (5%)

Query: 16  IRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQ 75
           +R  +G+G +++   G  +LD  +GI VN LGH+HPE V  +  Q EKL     +++  +
Sbjct: 8   LRLVRGEGIYVWDSQGRRYLDLIAGIGVNVLGHNHPEWVEEMSEQLEKLVVAGPMFEHEE 67

Query: 76  QEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRT 135
           +E     L      + V+  NSG E+VE A+K AR Y      T +  I+    AFHGRT
Sbjct: 68  KEEMLEELSKWVNYEYVYMGNSGTEAVEAALKFARLY------TGRKEIIAMTNAFHGRT 121

Query: 136 LATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVP 195
           +  +SA  K +Y E F P + GF    F D+++ K  I+ +TAA++ EPIQGEGG+    
Sbjct: 122 MGALSATWKPKYREDFEPLVPGFKHIPFNDVEAAKEAITKETAAVIFEPIQGEGGIVPAK 181

Query: 196 EEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGA 255
           EEF++ LR + +D+ ALLI DEVQ+G  RTGK  A E   V+PDI+T+ KG+G G P+  
Sbjct: 182 EEFVKTLRDLTEDVGALLIADEVQSGL-RTGKFLAIEHYKVEPDIVTMGKGIGNGVPVSL 240

Query: 256 CLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAI 315
            L   +V     +G HGST+GGN LA       L I++ +  +E       I  +G   +
Sbjct: 241 TLTNFDV----ERGKHGSTFGGNPLACKAVAVTLRILRRERLVEKAGE-KFIEIKGERVV 295

Query: 316 KNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEE 375
                      RG+GL+IG+           + ++   L   +   V+R+LPPL I+ + 
Sbjct: 296 TT---------RGRGLMIGIVLKKPVGKYVEELQNRGYLVHTAGQRVIRLLPPLIISKDT 346

Query: 376 IHEGLERIE 384
           + E    IE
Sbjct: 347 MEEAKSAIE 355


>gnl|CDD|181002 PRK07495, PRK07495, 4-aminobutyrate aminotransferase; Provisional.
          Length = 425

 Score =  240 bits (615), Expect = 4e-64
 Identities = 134/412 (32%), Positives = 204/412 (49%), Gaps = 42/412 (10%)

Query: 13  QSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQ 72
            + I  ++ + A ++ + G  ++DFA+GIAV + GH HP ++A +K+Q ++  H    +Q
Sbjct: 21  TTQIYADRAENAEIWDKEGRRYIDFAAGIAVVNTGHRHPRVIAAVKAQLDRFTHTC--HQ 78

Query: 73  STQQEIFA------NHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
               E +       N L+   FA +  F  +GAE+VE A+K AR        T +  ++ 
Sbjct: 79  VVPYENYVRLAERLNALVPGDFAKKTIFVTTGAEAVENAVKIARAA------TGRSAVIA 132

Query: 127 FEGAFHGRTLATISAGGKLQ-YLEGFGPKIEGFDQAKF-CDLQ---------SLKNQISN 175
           F G FHGRT   +S  GK+  Y  GFG  +       F  +L          +L      
Sbjct: 133 FGGGFHGRTFMGMSLTGKVVPYKVGFGAMMPDVYHVPFPVELHGVSVEQSLAALDKLFKA 192

Query: 176 D-----TAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFA 230
           D      AAI+IEP+QGEGG    P  F++ LR++CD    LLI DEVQTG+ RTGKLFA
Sbjct: 193 DVDPQRVAAIIIEPVQGEGGFYPAPAAFMKALRELCDQHGILLIADEVQTGFARTGKLFA 252

Query: 231 YEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLN 290
            E   V  D+ T+AKG+ GGFP+ A     E+      G  G TYGGN L +     VL+
Sbjct: 253 MEHHEVAADLTTMAKGLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGNPLGIAAAHAVLD 312

Query: 291 IIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL-----KTVFSPALLA 345
           +I+ +   E    +   L + L +++   P +  ++RG G +  +      +    A  A
Sbjct: 313 VIEEEDLCERANQLGNRLKQRLASLRETVPEI-ADIRGPGFMNAVEFNDADSGLPSAEFA 371

Query: 346 AKFRDEC------LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLS 391
            + R +       LLT     NV+R L P+TI  +   E L+ +E + ++ S
Sbjct: 372 NRVRLKALEKGLILLTCGVHGNVIRFLAPITIQDDVFAEALDILEASILEAS 423


>gnl|CDD|129783 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransferase,
           prokaryotic type.  Alternate names include GABA
           transaminase, gamma-amino-N-butyrate transaminase, and
           beta-alanine--oxoglutarate aminotransferase.
          Length = 420

 Score =  228 bits (582), Expect = 2e-60
 Identities = 132/404 (32%), Positives = 193/404 (47%), Gaps = 48/404 (11%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           + +GA L   +G   +DFASGIAV ++GHSHP +V  +++Q  +  H    +  T  E +
Sbjct: 21  RAEGAILEDVDGNRLIDFASGIAVLNIGHSHPRVVDAVRTQVAEFTHTC--FMVTPYEGY 78

Query: 80  A------NHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHG 133
                  N +   +   +  F NSGAE+VE A+K AR Y      T +  +V F+  FHG
Sbjct: 79  VALAEKLNRIAPGSGPKKSVFFNSGAEAVENAVKIARSY------TGRPGVVAFDHGFHG 132

Query: 134 RTLATISAGGKLQ-YLEGFGP---------------KIEGFDQAKFCDLQSLKNQI---- 173
           RT  T++   K+  Y  GFGP                     Q       +    I    
Sbjct: 133 RTNMTMALTAKVMPYKSGFGPFAPEVYRAPLPYPYRDGLLDKQLSTDGELAAARAIFVID 192

Query: 174 --SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY 231
             +N+ AA++IEP+QGEGG     + F+  L   C +   + I DEVQTG+ RTG +FA 
Sbjct: 193 VGANNVAALVIEPVQGEGGFIVPAKGFVPALLDWCREHGIVFIADEVQTGFARTGAMFAC 252

Query: 232 EWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNI 291
           E    +PD++T AK +  G P+       E+      G  G TY GN LA      VL I
Sbjct: 253 EHEGPEPDLITTAKSLADGLPLSGVTGRAEIMDAPAPGGLGGTYAGNPLACAAALAVLAI 312

Query: 292 IQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS-----PALLAA 346
           I+S+G +E    I +++ + LT +K   P +  +VRG G +I ++ V        A LA 
Sbjct: 313 IESEGLIERARQIGRLVTDRLTTLKAVDPRI-GDVRGLGAMIAVELVDPGTTEPDAGLAE 371

Query: 347 KFRDEC------LLTAPSSDNVVRILPPLTITAEEIHEGLERIE 384
           +           LLT     N++R LPPLTI  E + EGL+ + 
Sbjct: 372 RIATAAHAAGLLLLTCGMFGNIIRFLPPLTIGDELLSEGLDILC 415


>gnl|CDD|180329 PRK05964, PRK05964, adenosylmethionine--8-amino-7-oxononanoate
           transaminase; Provisional.
          Length = 423

 Score =  227 bits (581), Expect = 4e-60
 Identities = 126/401 (31%), Positives = 197/401 (49%), Gaps = 57/401 (14%)

Query: 16  IRFEKGKGAWLFSENGIPFLDFASGIA---VNSLGHSHPELVAILKSQSEKLWHVSNLYQ 72
           I   + +GA+L+  +G   +D    I+   V + GH+HP +   ++ Q ++L HV     
Sbjct: 26  IPIVRAEGAYLYLADGRELID---AISSWWVATHGHNHPYIDQAIREQLDRLDHV----- 77

Query: 73  STQQEIFANH-----------LIHSTFA--DRVFFTNSGAESVECAIKTARRYHYMAGKT 119
                IFA             L+  T    D VFF++SG+ +VE A+K A +Y    G+ 
Sbjct: 78  -----IFAGFTHEPAERLAQRLVALTPGGLDHVFFSDSGSVAVEVALKMALQYWRNRGEP 132

Query: 120 NKFRIVTFEGAFHGRTLATISAGGKLQYLEGFGPKI----------EGFDQAKFCDLQSL 169
            + R ++  G +HG T+ T+S G +      + P +          +G++QA    L++L
Sbjct: 133 GRSRFLSLRGGYHGDTIGTMSVGDRGGMHALYTPLLFEQVTAPFPPDGYEQATLDALEAL 192

Query: 170 KNQISNDTAAILIEP-IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKL 228
             + + + AA ++EP +QG GG+      +L +LR+ICD    LLIFDE+ TG+GRTG L
Sbjct: 193 LEKHAGEIAAFIVEPLVQGAGGMLFYDPRYLAELRRICDRHGVLLIFDEIATGFGRTGTL 252

Query: 229 FAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGS------HGSTYGGNVLA 281
           FA E A V PDIM ++KG+ GG+ P+ A L T E+              H  +Y  N LA
Sbjct: 253 FACEQAGVSPDIMCLSKGLTGGYLPLAATLCTAEIFEAFYSDDRAKAFMHSPSYTANPLA 312

Query: 282 MVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP 341
                  L++ + +  LE V  ++  L EGL   ++  P    +VR  G  IG   +  P
Sbjct: 313 CAAANASLDLFEDEPVLERVAALSAGLAEGLEPFRD-LPG-VADVRVLG-AIGAVELDRP 369

Query: 342 AL------LAAKFRDECLLTAPSSDNVVRILPPLTITAEEI 376
            L      L A   +  +L  P   N + ++PP  ITAEE+
Sbjct: 370 VLERDGPALRAFALERGVLLRPLG-NTIYLMPPYIITAEEL 409


>gnl|CDD|180690 PRK06777, PRK06777, 4-aminobutyrate aminotransferase; Provisional.
          Length = 421

 Score =  225 bits (575), Expect = 1e-59
 Identities = 143/407 (35%), Positives = 210/407 (51%), Gaps = 56/407 (13%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
           E+ + A L+   G  ++DFA+GIAV + GH HP++VA ++ Q ++  H +  YQ      
Sbjct: 27  ERAENATLWDVEGREYIDFAAGIAVLNTGHRHPKVVAAVRQQLDQFTHTA--YQIVPYAS 84

Query: 79  FANHLIHSTFADRV-------------FFTNSGAESVECAIKTARRYHYMAGKTNKFRIV 125
           +       T A+R+             FFT +GAE+VE A+K AR Y      T +  ++
Sbjct: 85  YV------TLAERINALAPIDGPAKTAFFT-TGAEAVENAVKIARAY------TGRPGVI 131

Query: 126 TFEGAFHGRTLATISAGGKLQ-YLEGFGPKIEGFDQAKFCD----------LQSL----K 170
            F GAFHGRTL T++  GK+  Y  GFGP       A + +          L S+    K
Sbjct: 132 AFGGAFHGRTLLTMALTGKVAPYKVGFGPFPGSIFHALYPNELHGVSVEEALSSVERLFK 191

Query: 171 NQISND-TAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF 229
             I+ D  AAIL+EPIQGEGG    P EF+  LR +CD+   LLI DEVQTG+ RTGKLF
Sbjct: 192 ADIAPDQVAAILLEPIQGEGGFNVAPPEFMSALRTLCDEHGILLIADEVQTGFARTGKLF 251

Query: 230 AYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVL 289
           A E+ +VKPD++T+AK +GGG PI A +   EV      G  G TY GN LA+     VL
Sbjct: 252 AMEYYDVKPDLITMAKSLGGGMPISAVVGRAEVMDAPAPGGLGGTYAGNPLAVAAALAVL 311

Query: 290 NIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLK-----TVFSPALL 344
           ++I  +   +  + +   L E L   K   P + +++R +G ++ ++     T       
Sbjct: 312 DVIAEEKLCQRALILGAHLVEVLEKAKASCPAI-VDIRARGSMVAVEFNDPQTGKPSPEF 370

Query: 345 AAKFRDEC------LLTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
             +++ +       LL+     NV+R L PLTI   +  + L  + R
Sbjct: 371 TRQYQRQALEEGLLLLSCGVHGNVIRFLYPLTIPDAQFSKALNILTR 417


>gnl|CDD|181227 PRK08088, PRK08088, 4-aminobutyrate aminotransferase; Validated.
          Length = 425

 Score =  223 bits (569), Expect = 9e-59
 Identities = 139/400 (34%), Positives = 202/400 (50%), Gaps = 43/400 (10%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
           ++ +   ++   G  +LDFA GIAV + GH HP++VA +++Q +KL H    +Q    E 
Sbjct: 28  DRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTC--FQVLAYEP 85

Query: 79  FA------NHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFH 132
           +       N  +   FA +     +G+E+VE A+K AR     +G      ++ F GA+H
Sbjct: 86  YLELCEKMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAATKRSG------VIAFTGAYH 139

Query: 133 GRTLATISAGGKLQ-YLEGFGPKIEGFDQAKF-CDLQSL-------------KNQIS-ND 176
           GRT  T++  GK+  Y  G G       +A + C L  +             KN  +  D
Sbjct: 140 GRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGVSEDDAIASIERIFKNDAAPED 199

Query: 177 TAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANV 236
            AAI+IEP+QGEGG       F+Q+LR +CD+   +LI DEVQTG GRTG LFA E   V
Sbjct: 200 IAAIIIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADEVQTGAGRTGTLFAMEQMGV 259

Query: 237 KPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDG 296
             D+ T AK + GGFP+       EV   +  G  G TY GN +A      VL + + + 
Sbjct: 260 AADLTTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAGNPIACAAALAVLKVFEQEN 319

Query: 297 FLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLI-------GLKTVFSPALLA---A 346
            L+    + + L +GL AI  + P +  +VRG G +I       G  +  +  L A   A
Sbjct: 320 LLQKANALGEKLKDGLLAIAEKHPEI-GDVRGLGAMIAIELFEDGDHSKPNAKLTAQIVA 378

Query: 347 KFRDE--CLLTAPSSDNVVRILPPLTITAEEIHEGLERIE 384
           + RD+   LL+     NV+RIL PLTI   +I +GLE I 
Sbjct: 379 RARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIIA 418


>gnl|CDD|132415 TIGR03372, putres_am_tran, putrescine aminotransferase.  Members of
           this family are putrescine aminotransferase, as found in
           Escherichia coli, Erwinia carotovora subsp. atroseptica,
           and closely related species. This pyridoxal phosphate
           enzyme, as characterized in E. coli, can act also on
           cadaverine and, more weakly, spermidine.
          Length = 442

 Score =  220 bits (562), Expect = 4e-58
 Identities = 132/385 (34%), Positives = 198/385 (51%), Gaps = 30/385 (7%)

Query: 12  DQSDIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQ--------SEK 63
           D   + ++ G    L    G  F+D   G  + ++GH +P ++A +++Q         E 
Sbjct: 55  DYGAVEWQAGGLNTLIDTQGNEFIDCLGGFGIFNVGHRNPNVIAAVENQLAKQPLHSQEL 114

Query: 64  LWHVSNLYQSTQQEIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR 123
           L  +  L   T   +    L +S      FF NSG ESVE A+K A+ Y    GK   F 
Sbjct: 115 LDPLRALLAKTLAALTPGKLKYS------FFCNSGTESVEAALKLAKAYQSPRGK---FT 165

Query: 124 IVTFEGAFHGRTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQIS------NDT 177
            +   GAFHG++L  +SA  K  + + F P + GF    F D++++   ++      +D 
Sbjct: 166 FIAASGAFHGKSLGALSATAKPAFRKPFMPLLPGFHHVAFGDIEAMLKALNECKKTGDDV 225

Query: 178 AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVK 237
           AAI++EPIQGEGGV   PE +L  +R +CD+  ALLI DEVQTG GRTGK+FA E   V+
Sbjct: 226 AAIILEPIQGEGGVILPPEGYLPAVRALCDEFGALLILDEVQTGMGRTGKMFACEHEGVQ 285

Query: 238 PDIMTIAKGMGGG-FPIGACLATNEVAACM--NQGSHGSTYGGNVLAMVLGEKVLNIIQS 294
           PDI+ +AK +GGG  PIGA +AT  V + +  N   H +T+GGN LA       +N +  
Sbjct: 286 PDILCLAKALGGGVMPIGATIATEAVFSVLFDNPFLHTTTFGGNPLACAAALATINELLE 345

Query: 295 DGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV---FSPALLAAKFRDE 351
                        L +G   +   +P++ +E RG+GLL+ ++        A     F+  
Sbjct: 346 KNLPAQAAIKGDFLLDGFQQLAAEYPDLIIEARGKGLLMAIEFRDNEIGYAFAKELFQQN 405

Query: 352 CLLTAP-SSDNVVRILPPLTITAEE 375
            L+    ++   +RI PPLTIT E+
Sbjct: 406 ILVAGTLNNAKSIRIEPPLTITIEQ 430


>gnl|CDD|180748 PRK06918, PRK06918, 4-aminobutyrate aminotransferase; Reviewed.
          Length = 451

 Score =  218 bits (558), Expect = 1e-57
 Identities = 131/407 (32%), Positives = 208/407 (51%), Gaps = 50/407 (12%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS---NLYQSTQ 75
           +   GA +   +G  ++DFA  I   ++GHSHP++   L  Q ++  H      +Y+   
Sbjct: 41  QSANGALVTDVDGNQYIDFAGAIGTINVGHSHPKVKEALHKQVDQYIHTGFNVMMYEPYI 100

Query: 76  QEIFANHLIHST---FADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFH 132
           +   A  L       F  +V F NSGAE+VE A+K AR+Y      T +  I++F   FH
Sbjct: 101 E--LAEKLAALAPGSFDKKVLFLNSGAEAVENAVKIARKY------TKRQGIISFSRGFH 152

Query: 133 GRTLATISAGGKLQ-YLEGFGP---------------KIEGFDQAKFCD--LQSLKN--- 171
           GRTL T++   K++ Y  GFGP               + EG  + ++ D  ++  KN   
Sbjct: 153 GRTLMTMTMTSKVKPYKFGFGPFAPEVYKAPFPYEYRRPEGLTEEQYDDFMIEEFKNFFI 212

Query: 172 -QISNDT-AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF 229
            +++ +T AA+++EP+QGEGG     ++F+Q++R IC +   L + DE+QTG+ RTGK F
Sbjct: 213 SEVAPETIAAVVMEPVQGEGGFIVPSKKFVQEVRNICSEHGILFVADEIQTGFARTGKYF 272

Query: 230 AYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVL 289
           A E  +V PD++T++K +G G PI   +   E+      G  G TY G+ L       VL
Sbjct: 273 AIEHFDVVPDLITVSKSLGAGVPISGVIGRKEIMDESAPGELGGTYAGSPLGCAAALAVL 332

Query: 290 NIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPAL------ 343
           +II+ +   +  I + K++      +KN++  +  +VRG G +   + V           
Sbjct: 333 DIIEKENLNDRAIELGKVVMNRFEEMKNKYNCIG-DVRGLGAMCAFELVQDRKTKEPDKT 391

Query: 344 LAAKFRDEC------LLTAPSSDNVVRILPPLTITAEEIHEGLERIE 384
           L A    E       LL+A +  NV+R+L PL IT E++ EGL  IE
Sbjct: 392 LTANICKEANKRGLLLLSAGTYGNVIRVLMPLVITDEQLEEGLTIIE 438


>gnl|CDD|181737 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate
           aminotransferase; Validated.
          Length = 425

 Score =  210 bits (538), Expect = 4e-55
 Identities = 135/411 (32%), Positives = 206/411 (50%), Gaps = 66/411 (16%)

Query: 18  FEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKS--QSEKLWHVSNLYQSTQ 75
           F+K KG+WL+ E+G  ++DF +G    + GH++P L   L    Q + + H  +++ + +
Sbjct: 25  FDKAKGSWLYDEDGKEYIDFFAGAGALNYGHNNPVLKQALIDYLQRDGITHGLDMHTTAK 84

Query: 76  QEIFANHLIHSTFAD----------RVFFTN-SGAESVECAIKTARRYHYMAGKTNKFRI 124
           +E F       TF +          +V FT  +G  +VE A+K AR+     G+TN   I
Sbjct: 85  RE-FLE-----TFEETILKPRGLDYKVQFTGPTGTNAVEAALKLARKV---TGRTN---I 132

Query: 125 VTFEGAFHGRTLATIS----------AGGKLQ------YLEGFGPKIEGFDQAKFCDLQS 168
           V F   FHG TL +++          AG  L       Y   FG  ++         L+ 
Sbjct: 133 VAFTNGFHGMTLGSLAVTGNSHKRQGAGVPLNNVTRMPYDGYFGGDVDTLA-----YLEK 187

Query: 169 LKNQIS---NDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRT 225
           L    S   +  AA+++E +QGEGG+     E+LQ+L K+C   D LLI D++Q G GRT
Sbjct: 188 LLEDSSSGVDLPAAVIVETVQGEGGINVASAEWLQRLAKLCRKHDILLIVDDIQAGCGRT 247

Query: 226 GKLFAYEWANVKPDIMTIAKGMGG-GFPIGACLATNEVAACMNQ---GSHGSTYGGNVLA 281
           G  F++E A + PDI+T++K + G G P+   L   E    ++    G H  T+ GN LA
Sbjct: 248 GTFFSFERAGITPDIVTLSKSISGYGLPMALVLIKPE----LDVWKPGEHNGTFRGNNLA 303

Query: 282 MVLGEKVLNIIQSDG-FLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFS 340
            V     L    SD  F + V    +++ E L  I  ++P +  EVRG+G++ G+   F 
Sbjct: 304 FVTATAALEEYWSDDAFEKEVKAKGELVRERLEEIAAKYPGLGAEVRGRGMMQGID--FG 361

Query: 341 PALLAAKFRDEC----LL--TAPSSDNVVRILPPLTITAEEIHEGLERIER 385
              LA K   E     L+  T+   D VV++LPPLTI  EE+ EGL+ +E 
Sbjct: 362 DGELAGKIAAEAFENGLIIETSGPEDEVVKLLPPLTIDEEELEEGLDILEE 412


>gnl|CDD|181363 PRK08297, PRK08297, L-lysine aminotransferase; Provisional.
          Length = 443

 Score =  208 bits (531), Expect = 2e-54
 Identities = 124/422 (29%), Positives = 193/422 (45%), Gaps = 68/422 (16%)

Query: 19  EKGKGAWLFSEN-GIPFLDFASGIAVNSLGHSHPEL------------VAILKSQSEKLW 65
           E+ +G++L     G  +LD  +  A ++LG +HP L             A+ K  +    
Sbjct: 31  ERSQGSYLVDARTGRRYLDMFTFFASSALGMNHPALADDPEFRAELGRAALNKPSN---- 86

Query: 66  HVSNLYQSTQQ-----EIFANHLIHSTFADRVFFTNSGAESVECAIKTA----RRYHYMA 116
             S++Y  T +     + FA  L        +FF + GA +VE A+K A     R +   
Sbjct: 87  --SDVY--TVEMARFVDTFARVLGDPELP-HLFFVDGGALAVENALKVAFDWKSRKNEAR 141

Query: 117 GKTNK--FRIVTFEGAFHGRTLATISAG----GKLQYLEGFG------PKI------EGF 158
           G       +++   GAFHGR+  T+S       K      F       PK+      E  
Sbjct: 142 GIDPALGTKVLHLRGAFHGRSGYTLSLTNTDPRKTARFPKFDWPRIDNPKLRFPLPGEDL 201

Query: 159 DQAKFCDLQSLKNQI-------SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDA 211
           ++ +  + ++L  Q         +D A  + EPIQGEGG      EF   +R++CD+ DA
Sbjct: 202 EEVEALEAEALA-QARAAFERHPHDIACFIAEPIQGEGGDNHFRPEFFAAMRELCDEHDA 260

Query: 212 LLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGM--GGGFPIGACLATNEVAACMNQG 269
           LLIFDEVQTG G TG  +AY+   V+PDI+   K     G   I A    +EV   +   
Sbjct: 261 LLIFDEVQTGVGLTGTAWAYQQLGVRPDIVAFGKKTQVCG---IMAGRRVDEVEDNVFAV 317

Query: 270 SH--GSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVR 327
           S    ST+GGN++ MV   ++L +I+ DG +EN     + L   L  +   FP +   VR
Sbjct: 318 SSRINSTWGGNLVDMVRARRILEVIEEDGLVENAARQGEYLLARLEELAAEFPAVVSNVR 377

Query: 328 GQGLLIGLKTVFSPAL---LAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIE 384
           G+GL+     + + A    +  +  +E +L  P  +  +R  P LT+T EEI   ++ + 
Sbjct: 378 GRGLMCAF-DLPTTADRDEVIRRLWEEGVLVLPCGERSIRFRPALTVTTEEIDAAIDALR 436

Query: 385 RT 386
           R 
Sbjct: 437 RA 438


>gnl|CDD|180372 PRK06058, PRK06058, 4-aminobutyrate aminotransferase; Provisional.
          Length = 443

 Score =  208 bits (531), Expect = 2e-54
 Identities = 125/390 (32%), Positives = 184/390 (47%), Gaps = 47/390 (12%)

Query: 34  FLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFA------NHLIHST 87
            +D  SGIAV S+G+S P +V  ++ Q  +  H    +  T  E +       N L    
Sbjct: 58  LIDLGSGIAVTSVGNSAPRVVEAVREQVARFTHTC--FMVTPYEGYVAVAEQLNRLTPGD 115

Query: 88  FADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGK-LQ 146
              R    NSGAE+VE A+K AR Y      T +  +V F+ A+HGRT  T++   K + 
Sbjct: 116 HEKRSALFNSGAEAVENAVKIARSY------TGRQAVVVFDHAYHGRTNLTMALTAKSMP 169

Query: 147 YLEGFGP-----------------KIEGFD--QAKFCDLQSLKNQI-SNDTAAILIEPIQ 186
           Y  GFGP                 K    D  +A    +  ++ Q+ +++ AA++IEPIQ
Sbjct: 170 YKSGFGPFAPEVYRAPMSYPYRDPKGLATDGEEAAARAITVIEKQVGADNLAAVIIEPIQ 229

Query: 187 GEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKG 246
           GEGG     E FL  L + C +   + I DEVQTG+ RTG  FA E   + PD++T AKG
Sbjct: 230 GEGGFIVPAEGFLPALLEWCRENGVVFIADEVQTGFARTGAWFACEHEGIVPDLITTAKG 289

Query: 247 MGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAK 306
           + GG P+ A     E+    + G  G TYGGN +A       +  I+ D  +     I  
Sbjct: 290 IAGGLPLSAVTGRAEIMDAPHPGGLGGTYGGNPVACAAALAAIETIEEDDLVARARQIEA 349

Query: 307 ILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP-----ALLAAKFRDEC------LLT 355
           ++ + L A+         +VRG+G +I ++ V        A L              +LT
Sbjct: 350 LMTDRLRALAAEDD-RIGDVRGRGAMIAIELVKPGTTEPDAELTKALAAAAHAAGVIVLT 408

Query: 356 APSSDNVVRILPPLTITAEEIHEGLERIER 385
             +  NV+R+LPPL I  E + EGL+ +E 
Sbjct: 409 CGTYGNVIRLLPPLVIGDELLREGLDVLEA 438


>gnl|CDD|181401 PRK08360, PRK08360, 4-aminobutyrate aminotransferase; Provisional.
          Length = 443

 Score =  199 bits (508), Expect = 1e-51
 Identities = 121/402 (30%), Positives = 195/402 (48%), Gaps = 44/402 (10%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI- 78
           K + A ++   G  ++DF S  AV ++GH++P +V  +K Q++KL H + +Y    + + 
Sbjct: 29  KAENAKVWDIEGNEYIDFLSDAAVQNVGHNNPRVVKAIKEQTDKLIHYTPIYGFPVEPLL 88

Query: 79  FANHLIHSTFAD--RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTL 136
            A  LI     D  +V F  SG+++ + AIK AR Y      T + +I+++  +++G T 
Sbjct: 89  LAEKLIEIAPGDNPKVSFGLSGSDANDGAIKFARAY------TKRRKILSYLRSYYGSTY 142

Query: 137 ATISAGG-KLQYLEGFGPKIE--------------GFDQAKFCDLQS---LKNQI----- 173
             +S  G         G   +              G +    C ++    +K +      
Sbjct: 143 GAMSLTGLDFPVRALVGELSDVHYIPYPDCYRCPFGKEPGS-CKMECVEYIKEKFEGEVY 201

Query: 174 SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEW 233
           +   AA+  EPIQG+ G+   PE++ ++L+KI D+   LL+ DEVQ+G GRTGK FA E 
Sbjct: 202 AEGVAALFAEPIQGDAGMIVPPEDYFKKLKKILDEHGILLVVDEVQSGLGRTGKWFAIEH 261

Query: 234 ANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQ 293
             V+PDI+T+ K +GGG PI A +   E+   +   +H  T  GN +A      V+  I+
Sbjct: 262 FGVEPDIITLGKPLGGGLPISATIGRAEIMDSLPPLAHAFTLSGNPVASAAALAVIEEIE 321

Query: 294 SDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALL------AAK 347
               L+    +     + L  +K +   +  +VRG GL+IG+  V            AAK
Sbjct: 322 EKNLLKRAEKLGNYTKKRLEEMKKKHE-LIGDVRGIGLMIGVDLVKDRETKERAYEEAAK 380

Query: 348 FRDEC----LLTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
                    L+    S NV+RI PPLTI  E + EGL+ +E 
Sbjct: 381 VVWRAWELGLIVTFFSGNVLRIQPPLTIEKEVLDEGLDILEE 422


>gnl|CDD|162844 TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglutarate
           aminotransferase.  Members of this family of class III
           pyridoxal-phosphate-dependent aminotransferases are
           diaminobutyrate--2-oxoglutarate aminotransferase (EC
           2.6.1.76) that catalyze the first step in ectoine
           biosynthesis from L-aspartate beta-semialdehyde. This
           family is readily separated phylogenetically from
           enzymes with the same substrate and product but involved
           in other process such as siderophore or
           1,3-diaminopropane biosynthesis. The family TIGR00709
           previously included both groups but has now been revised
           to exclude the ectoine biosynthesis proteins of this
           family. Ectoine is a compatible solute particularly
           effective in conferring salt tolerance.
          Length = 412

 Score =  199 bits (507), Expect = 1e-51
 Identities = 122/400 (30%), Positives = 205/400 (51%), Gaps = 44/400 (11%)

Query: 18  FEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKS--QSEKLWHVSNLYQSTQ 75
           FEK KG+ L+ E+G  ++DF +G    + GH++P+L   L      + + H  ++    +
Sbjct: 21  FEKAKGSTLWDEDGKEYIDFFAGAGALNYGHNNPKLKQALIDYLADDGIIHSLDMATEAK 80

Query: 76  Q---EIFANHLIHSTFAD-RVFFTN-SGAESVECAIKTARRYHYMAGKTNKFRIVTFEGA 130
           +   E F   ++     D +V F   +G  +VE A+K AR+     G++N   +V+F  A
Sbjct: 81  REFLETFNEIILKPRGLDYKVQFPGPTGTNAVESALKLARKV---TGRSN---VVSFTNA 134

Query: 131 FHGRTLATISAGGKLQYLEGFGPKI--------EGFDQAKFCDLQSLKNQISNDT----- 177
           FHG TL ++S  G     +G G  +        +G+       +   +  + + +     
Sbjct: 135 FHGMTLGSLSVTGNRFKRQGAGVPLSNVSRMPYDGYLGGDVDTIAYFEKLLEDSSSGVDL 194

Query: 178 -AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANV 236
            AA+++E +QGEGG+    +E+LQ+L K+C   D LLI D++Q G GRTG  F++E A +
Sbjct: 195 PAAVILETVQGEGGINVASDEWLQRLEKLCRRHDILLIVDDIQAGCGRTGTFFSFEPAGI 254

Query: 237 KPDIMTIAKGMGG-GFPIGACLATNEVAACMNQ---GSHGSTYGGNVLAMVLGEKVLNII 292
           +PDI+ ++K + G G P+   L   E    ++    G H  T+ GN LA V     L   
Sbjct: 255 EPDIVCLSKSISGYGLPLALTLIKPE----LDVWKPGEHNGTFRGNNLAFVTATAALEYY 310

Query: 293 QSDG-FLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPALLAAKFRDE 351
            SD  F + V   ++I+ E L  I   +P +  +VRG+GL+ G++       LA K    
Sbjct: 311 WSDDAFEKAVQRKSEIIQERLDRIVAEYPELIKQVRGRGLMQGIE-CGDGD-LAGKIAKA 368

Query: 352 C----LL--TAPSSDNVVRILPPLTITAEEIHEGLERIER 385
                L+  T+  +D V+++LPPLTI  E + +GL+ +E+
Sbjct: 369 AFENGLIIETSGPNDEVIKLLPPLTIDEETLQQGLDILEQ 408


>gnl|CDD|129792 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminases.  This family
           consists of L-diaminobutyric acid transaminases. This
           general designation covers both 2.6.1.76
           (diaminobutyrate-2-oxoglutarate transaminase, which uses
           glutamate as the amino donor in DABA biosynthesis), and
           2.6.1.46 (diaminobutyrate--pyruvate transaminase, which
           uses alanine as the amino donor). Most members with
           known function are 2.6.1.76, and at least some
           annotations as 2.6.1.46 in current databases at time of
           model revision are incorrect. A distinct branch of this
           family contains examples of 2.6.1.76 nearly all of which
           are involved in ectoine biosynthesis. A related enzyme
           is 4-aminobutyrate aminotransferase (EC 2.6.1.19), also
           called GABA transaminase. These enzymes all are
           pyridoxal phosphate-containing class III
           aminotransferase.
          Length = 442

 Score =  198 bits (505), Expect = 2e-51
 Identities = 125/416 (30%), Positives = 189/416 (45%), Gaps = 55/416 (13%)

Query: 18  FEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKS--QSEKLWHVSNLYQSTQ 75
           F K +G W+    G  +LDF +G    +LGH+HP +   +    QS    H  +L    +
Sbjct: 25  FAKAQGCWVTDVEGKEYLDFLAGAGTLALGHNHPNMKQKILDYLQSGLPLHTLDLTTPLK 84

Query: 76  QEI---FANHLIHSTFADRVFFTN-SGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAF 131
                   N +       ++ F   SGA++VE AIK A+ Y    G+TN   +++F G F
Sbjct: 85  DAFIEALLNIIPKRKMDYKLQFPGPSGADAVEAAIKLAKTY---TGRTN---VISFSGGF 138

Query: 132 HGRTLATISAGGKLQYLEGFGPKIEG-----FDQAKFCDL------------QSLKNQIS 174
           HG T+  ++  G L      G  + G     +     C              +  +N I 
Sbjct: 139 HGMTIGALAVTGNLFAKNAVGMLMPGVQFMPYPHEYRCPFGIGGEAGSNASIEYFENFIE 198

Query: 175 N------DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKL 228
           +        AA+++E IQGEGGV   P E+LQ++R++    D  LI DEVQ G+GR+G +
Sbjct: 199 DVESGVDKPAAVILEAIQGEGGVVAAPSEWLQKIREVTRKHDIKLILDEVQAGFGRSGTM 258

Query: 229 FAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKV 288
           FA+E A ++PD + ++K +GGG P+   L   E  A      H  T+ GN LAMV G + 
Sbjct: 259 FAFEHAGIEPDFVVMSKAVGGGLPLAVLLIAPEFDA-WQPAGHTGTFRGNQLAMVTGTEA 317

Query: 289 LNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV---------- 338
           LN  + D   +N     + +   L  +    P +   VRG+GL+ G+  V          
Sbjct: 318 LNYWKDDNLAQNAQERGERITSFLDDMIKEHPCI-GNVRGRGLMQGIMIVDERQSKDATG 376

Query: 339 --FSPALLAAKFRDEC------LLTAPSSDNVVRILPPLTITAEEIHEGLERIERT 386
                  LAA  +  C      L T      V R+L P+TI  EE  EG+ R ++ 
Sbjct: 377 AYPRDCELAAAIQGACFENGLLLETGGREGEVFRLLCPITIDQEECEEGISRFKQA 432


>gnl|CDD|180996 PRK07483, PRK07483, hypothetical protein; Provisional.
          Length = 443

 Score =  196 bits (500), Expect = 1e-50
 Identities = 134/417 (32%), Positives = 203/417 (48%), Gaps = 56/417 (13%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL--WHVSNLYQSTQQE 77
            G+G +L    G  +LD + G AV+ LGHSHP ++A + +Q ++L   H S  + +   E
Sbjct: 18  AGEGIYLIDATGKRYLDASGGAAVSCLGHSHPRVIAAIHAQIDRLAYAHTS-FFTTEPAE 76

Query: 78  IFANHLIHSTFA--DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRT 135
             A+ L+ +  A  + V+F + G+E+VE A+K AR+Y    G+  +   +    ++HG T
Sbjct: 77  ALADRLVAAAPAGLEHVYFVSGGSEAVEAALKLARQYFVEIGQPQRRHFIARRQSYHGNT 136

Query: 136 LATISAGGKLQYLEGFGP----------------KIEGFDQAKFCD--LQSLKNQI---- 173
           L  ++ GG     E F P                +  G     +       L+ +I    
Sbjct: 137 LGALAIGGNAWRREPFAPLLIEAHHVSPCYAYREQRAGESDEAYGQRLADELEAKILELG 196

Query: 174 SNDTAAILIEPIQGE--GGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY 231
            +  AA + E + G   G V  VP  F +++R++CD    LLI DEV  G GRTG LFA 
Sbjct: 197 PDTVAAFVAETVVGATAGAVPPVPGYF-KRIREVCDRYGVLLILDEVMCGMGRTGTLFAC 255

Query: 232 EWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGS----HGSTYGGNVLAMVLGE 286
           E   V PD++TIAKG+G G+ PIGA LA++ +   +  GS    HG TY G+  A     
Sbjct: 256 EEDGVAPDLVTIAKGLGAGYQPIGAVLASDRIYDAIADGSGFFQHGHTYLGHATACAAAL 315

Query: 287 KVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL--------KTV 338
            V  +I  DG L NV    + L   L     + P++  ++RG+GL +G+        K  
Sbjct: 316 AVQRVIAEDGLLANVRARGEQLRARLRERLGQHPHVG-DIRGRGLFVGVELVADRATKAP 374

Query: 339 FSPAL-LAAKFRDEC----LLTAPSSDNV-------VRILPPLTITAEEIHEGLERI 383
           F PAL L A+ + E     L+  P    +       V + PP  ITA +I E +ER+
Sbjct: 375 FDPALKLHARIKREAMARGLMVYPMGGTIDGVRGDHVLLAPPFIITAAQIDEIVERL 431


>gnl|CDD|132295 TIGR03251, LAT_fam, L-lysine 6-transaminase.  Characterized members
           of this protein family are L-lysine 6-transaminase, also
           called lysine epsilon-aminotransferase (LAT). The
           immediate product of the reaction of this enzyme on
           lysine, 2-aminoadipate 6-semialdehyde, becomes
           1-piperideine 6-carboxylate, or P6C. This product may be
           converted subsequently to pipecolate or
           alpha-aminoadipate, lysine catabolites that may be
           precursors of certain seconary metabolites.
          Length = 431

 Score =  193 bits (492), Expect = 7e-50
 Identities = 124/415 (29%), Positives = 191/415 (46%), Gaps = 54/415 (13%)

Query: 19  EKGKGAWLFSEN-GIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQE 77
           ++ +G+ L     G  +LD  S  A  +LG +HP LV  L  +  +L   + + + +  +
Sbjct: 24  DRSRGSVLVDARDGRRYLDMFSFFASMALGMNHPALVDDLAFR-ARLGAAA-VNKPSNSD 81

Query: 78  IFANHLIH--STFADRV---------FFTNSGAESVECAIKTA----RRYHYMAGKTNKF 122
           ++   +     TFA RV         FF   GA +VE A+KTA     R++   G     
Sbjct: 82  VYTVAMARFVDTFA-RVLGDPALPHLFFIEGGALAVENALKTAFDWKSRHNQARGIPAAL 140

Query: 123 --RIVTFEGAFHGRTLATISAGG----KLQYLEGFG-PKI-----------EGFDQAKFC 164
             +++    AFHGR+  T+S       K      F  P+I              DQ    
Sbjct: 141 GTQVLHLRQAFHGRSGYTLSLTNTDPRKTARFPKFDWPRIDNPKLTFPLDAPNLDQVIAL 200

Query: 165 DLQSLKNQI-------SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDE 217
           + ++L+ Q         +D A  + EPIQGEGG      EFL+ +R +CD+ DALLIFDE
Sbjct: 201 EEEALR-QARAAFAERPHDIACFIAEPIQGEGGDNHFRPEFLRAMRALCDEHDALLIFDE 259

Query: 218 VQTGYGRTGKLFAYEWANVKPDIMTIAKG--MGGGFPIGACLATNEVAACMNQGSH--GS 273
           VQTG G TG  +AY+   V+PDI+   K   + G   I A    +EVA  +        S
Sbjct: 260 VQTGVGLTGTAWAYQQLGVQPDIVAFGKKTQVCG---IMAGRRVDEVADNVFAVPSRLNS 316

Query: 274 TYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLL- 332
           T+GGN++ MV   ++L II+ +  ++N       L   L  +   FP++    RG+GL+ 
Sbjct: 317 TWGGNLVDMVRATRILEIIEEERLVDNARVQGAHLLARLHELAAEFPHLVSNPRGRGLMC 376

Query: 333 -IGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERT 386
              L +      +  +   E +L     +  +R  PPLT+T EEI   ++ I R 
Sbjct: 377 AFDLPSTADRDEVIRQLYREGVLLLGCGERSIRFRPPLTVTREEIDAAIDAIRRV 431


>gnl|CDD|180376 PRK06062, PRK06062, hypothetical protein; Provisional.
          Length = 451

 Score =  192 bits (491), Expect = 1e-49
 Identities = 117/416 (28%), Positives = 195/416 (46%), Gaps = 67/416 (16%)

Query: 21  GKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFA 80
            +G++++   G  +LDF+S +   ++GH HP++VA ++ Q+ +L         T     A
Sbjct: 42  AEGSYVWDYEGRRYLDFSSQLVNTNIGHQHPKVVAAIQEQAARL--------CTVAPAHA 93

Query: 81  NHLIHSTFA-----------DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEG 129
           N    S  A            +VFFTN GA++ E A++ AR +      T + ++++   
Sbjct: 94  N-DARSEAARLIAERAPGDLSKVFFTNGGADANEHAVRMARLH------TGRPKVLSAYR 146

Query: 130 AFHGRTLATISAGGKLQYLEG----------FGP-----KIEGFDQAKFCD--LQSLKNQ 172
           ++HG T + I+  G  +              FGP     +     + + C+  L  L+  
Sbjct: 147 SYHGGTGSAINLTGDPRRWPNDTGRAGVVHFFGPFLYRSEFHATTEEEECERALAHLERV 206

Query: 173 IS----NDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKL 228
           I     +  AAIL+E + G  G+   P  +L  +R++CD    +LI DEV  G+GRTGK 
Sbjct: 207 IELEGPSTIAAILLESVPGTAGILVPPPGYLAGVRELCDRHGIVLIADEVMAGFGRTGKW 266

Query: 229 FAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGSH--GSTYGGNVLAMVLG 285
           FA E   V PD++T AKG+  G+ P+G    +  +AA      +  G TY G+ LA    
Sbjct: 267 FAIEHFGVVPDLITFAKGVNSGYVPLGGVAISEAIAATFADRPYPGGLTYSGHPLACAAA 326

Query: 286 EKVLNIIQSDGFLENVINI-AKILFEGLTAIKNRFPNMFLEVRGQGLLIGL--------K 336
              +N ++ +G +EN   I A++L  GL  +  R P    EVRG G+   L        +
Sbjct: 327 VATINAMEEEGIVENAARIGAEVLGPGLRELAERHP-SVGEVRGLGVFWALELVADRETR 385

Query: 337 TVFSPALLA----AKFRDECL---LTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
              +P   +    A  +  C    L    + N + ++PP T+T +E+ EGL  ++ 
Sbjct: 386 EPLAPYGASSAAMAAVKAACKERGLLPFVNGNRIHVVPPCTVTEDEVREGLAILDA 441


>gnl|CDD|182078 PRK09792, PRK09792, 4-aminobutyrate transaminase; Provisional.
          Length = 421

 Score =  192 bits (488), Expect = 2e-49
 Identities = 131/392 (33%), Positives = 191/392 (48%), Gaps = 43/392 (10%)

Query: 31  GIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIFA------NHLI 84
           G  ++DFA+GIAV + GH HP+LVA ++ Q ++  H +  YQ    E +       N L 
Sbjct: 39  GNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTA--YQIVPYESYVTLAEKINALA 96

Query: 85  HSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGK 144
             +   +  F  +GAE+VE A+K AR +      T +  ++ F G FHGRT  T++  GK
Sbjct: 97  PVSGQAKTAFFTTGAEAVENAVKIARAH------TGRPGVIAFSGGFHGRTYMTMALTGK 150

Query: 145 LQ-YLEGFGPKIEGFDQAKF-CDLQSLKNQISNDT--------------AAILIEPIQGE 188
           +  Y  GFGP         +  DL  +  Q S D               AAI+ EP+QGE
Sbjct: 151 VAPYKIGFGPFPGSVYHVPYPSDLHGISTQDSLDAIERLFKSDIEAKQVAAIIFEPVQGE 210

Query: 189 GGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMG 248
           GG    P+E +  +R++CD+   ++I DEVQ+G+ RTGKLFA +    KPD+MT+AK + 
Sbjct: 211 GGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFARTGKLFAMDHYADKPDLMTMAKSLA 270

Query: 249 GGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKIL 308
           GG P+   +    +      G  G TY GN LA+     VLNII  +   E    + + L
Sbjct: 271 GGMPLSGVVGNANIMDAPAPGGLGGTYAGNPLAVAAAHAVLNIIDKESLCERANQLGQRL 330

Query: 309 FEGLTAIKNRFPNMFLEVRGQGLLIGL-----KTVFSPALLAAKFRDEC------LLTAP 357
              L   K   P +   VRG G +I       +T    A +A K +         LLT  
Sbjct: 331 KNTLIDAKESVPAI-AAVRGLGSMIAAEFNDPQTGEPSAAIAQKIQQRALAQGLLLLTCG 389

Query: 358 SSDNVVRILPPLTITAEEIHEGLERIERTAIK 389
           +  NV+R L PLTI   +    + +I + A+ 
Sbjct: 390 AYGNVIRFLYPLTIPDAQFDAAM-KILQDALS 420


>gnl|CDD|180747 PRK06917, PRK06917, hypothetical protein; Provisional.
          Length = 447

 Score =  189 bits (482), Expect = 1e-48
 Identities = 122/430 (28%), Positives = 197/430 (45%), Gaps = 69/430 (16%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQS------ 73
            GKG +L+ +NG  + D +SG     +GH   E+   +K Q+E+   VS +Y+S      
Sbjct: 19  HGKGVYLYDQNGNKYFDGSSGAVTAGIGHGVKEIADAIKEQAEE---VSFVYRSQFTSEP 75

Query: 74  TQQ------EIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTF 127
            ++      ++    L  S      FF NSG+E+ E A+K A ++    G   K +I++ 
Sbjct: 76  AEKLAKKLSDLSPGDLNWS------FFVNSGSEANETAMKIAIQHFQERGIQGKHKILSR 129

Query: 128 EGAFHGRTLATISAGGKLQYLEGFGPKIEGF------------------DQAKFC--DLQ 167
             ++HG T+  +S  G     + F   +E +                       C  +L+
Sbjct: 130 WMSYHGITMGALSMSGHPLRRQRFVSLLEDYPTISAPYCYRCPVQKVYPTCQLACATELE 189

Query: 168 SLKNQI-SNDTAAILIEPIQGEGGVRKVP-EEFLQQLRKICDDIDALLIFDEVQTGYGRT 225
           +   +I +   AA + EPI G  G   VP + + + +++ICD  D L I DEV TG GRT
Sbjct: 190 TAIERIGAEHIAAFIAEPIIGAAGAAVVPPKGYYKVIKEICDHYDILFIADEVMTGLGRT 249

Query: 226 GKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGSH----GSTYGGNVL 280
           G +FA E   V+PDIMT+ KG+G G+ PI A + ++ V   + +GS     G T   N L
Sbjct: 250 GAMFAMEHWGVEPDIMTLGKGLGAGYTPIAATVVSDRVMEPILRGSRSIMSGHTLSANPL 309

Query: 281 AMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL----- 335
           +      VL  ++     E      + L +GL  ++ +   +  +VRG+GLLIG+     
Sbjct: 310 SAATALAVLEYMEKHNLPEKAAEKGEYLIKGLQKVQQQST-IIGDVRGKGLLIGVEFVAD 368

Query: 336 ---KTVFSP-----ALLAAKFRDECLLTAPSS-------DNVVRILPPLTITAEEIHEGL 380
              K  FS      + L +      LL  P+         + V I PP+TIT  E+ E L
Sbjct: 369 KKTKQPFSKSQAVASELISVAAKNGLLLYPAVAGQDGKEGDAVIIAPPMTITYSELDELL 428

Query: 381 ERIERTAIKL 390
               ++  ++
Sbjct: 429 SIFAKSVEEM 438


>gnl|CDD|180746 PRK06916, PRK06916, adenosylmethionine--8-amino-7-oxononanoate
           transaminase; Provisional.
          Length = 460

 Score =  188 bits (478), Expect = 3e-48
 Identities = 129/416 (31%), Positives = 200/416 (48%), Gaps = 49/416 (11%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
           E+G+G  L+  NG  + D  S I +N  GH  PEL   ++ Q  K+ H + L  +    I
Sbjct: 43  ERGEGRKLYDVNGNEYYDGVSSIWLNVHGHQVPELDEAIREQLNKIAHSTLLGLANVPSI 102

Query: 79  -FANHLIHSTFA--DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRT 135
             A  LI        +VF+++SGA +VE AIK A +Y    GK  K R VT + A+HG T
Sbjct: 103 LLAEKLIEVVPEGLKKVFYSDSGATAVEIAIKMAFQYWQNKGKPKKQRFVTLKNAYHGDT 162

Query: 136 LATISAGGKLQYLEGFGP------KI---------EGFDQAKFCD-----LQSLKNQISN 175
           +  +S G    + + +        K+          G D+A+        L+ L  +   
Sbjct: 163 IGAVSVGAIDLFHQVYSSLLFEAIKMPYPYTYRSPYGNDKAEIVKKHLEELEELLKEKHE 222

Query: 176 DTAAILIEP-IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWA 234
           + AAI++EP +QG GG+  +P+ +L+ LR +C   + L I DEV TG+GRTGK+FA E  
Sbjct: 223 EIAAIIVEPLVQGAGGMITMPKGYLKGLRNLCTKYNVLFITDEVATGFGRTGKMFACEHE 282

Query: 235 NVKPDIMTIAKGMGGGF-PIGACLATNEV-----AACMNQGS--HGSTYGGNVLAMVLGE 286
           NV PDIMT  KG+ GG+ PI   + T+E+          Q +  HG +Y GN L   +  
Sbjct: 283 NVTPDIMTAGKGLTGGYLPIAITVTTDEIYNAFYGDYEEQKTFFHGHSYTGNPLGCAVAL 342

Query: 287 KVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPAL--- 343
             L + +    +E V    + +   L  +         ++R  GL++G++ V +      
Sbjct: 343 ANLELYEKTNLIEQVARKTEYVATQLEDLFAL--KHVGDIRQLGLMVGIELVKNKETKEP 400

Query: 344 ----------LAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIK 389
                     +  + R+  +LT P  + +V  +PPL  T +E+ E L RI   AI 
Sbjct: 401 FEWTERVGVQVCKRSRELGMLTRPLGNTIV-FMPPLASTIDELDEML-RILYKAIS 454


>gnl|CDD|168967 PRK07481, PRK07481, hypothetical protein; Provisional.
          Length = 449

 Score =  187 bits (477), Expect = 4e-48
 Identities = 116/410 (28%), Positives = 187/410 (45%), Gaps = 52/410 (12%)

Query: 16  IRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQST- 74
           I   +G G +++  +G   LD   G+   ++GH+  E+   +  Q ++L + S    +T 
Sbjct: 26  IIIVRGDGVYVYDIDGKKLLDGVGGLWNVNVGHNREEVKEAIVRQLDELEYYSTFDGTTH 85

Query: 75  -QQEIFANHLIHSTFAD---RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGA 130
            +    +  LI     +   RVFF++ G++SVE A+K AR+Y  + G+  + + ++ +  
Sbjct: 86  PRAIELSYELIDMFAPEGMRRVFFSSGGSDSVETALKLARQYWKVRGQPERTKFISLKQG 145

Query: 131 FHGRTLATISAGGKLQYLEGFGPKIEGFDQ-------------------AKFCDLQSLKN 171
           +HG      S  G   +   + P + G                      A+ C  + L+ 
Sbjct: 146 YHGTHFGGASVNGNTVFRRNYEPLLPGCFHVETPWLYRNPFTEQDPEELARIC-ARLLER 204

Query: 172 QI---SNDT-AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGK 227
           +I     DT AA + EP+QG GGV   P  F   +R++CD    LLI DEV TG+GRTG 
Sbjct: 205 EIAFQGPDTIAAFIAEPVQGAGGVIVPPANFWPLVREVCDRHGILLIADEVVTGFGRTGS 264

Query: 228 LFAYEWANVKPDIMTIAKGMGGG-FPIGACLATNEVAACMNQGS-------HGSTYGGNV 279
            F      VKPDIM +AKG+  G  P+GA +    +A      +       HG TY G+ 
Sbjct: 265 WFGSRGWGVKPDIMCLAKGITSGYVPLGATMVNARIADAFEANADFGGAIMHGYTYSGHP 324

Query: 280 LAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL---- 335
           +A       L+I+  +    N       L EGL  +K RF  +  +VRG+GL++ L    
Sbjct: 325 VACAAALATLDIVVREDLPANAAKRGAYLLEGLQPLKERFE-LVGDVRGKGLMLALDLVA 383

Query: 336 -KTVFSPALLAAKF--------RDECLLTAPSSDNVVRILPPLTITAEEI 376
            K    P   +  +        R+  +L  PS   ++ + PPL I  E++
Sbjct: 384 DKATREPIDPSKGYANAVADVARENGVLVRPSGTKII-LSPPLVIQREDV 432


>gnl|CDD|168145 PRK05639, PRK05639, 4-aminobutyrate aminotransferase; Provisional.
          Length = 457

 Score =  185 bits (470), Expect = 2e-47
 Identities = 134/416 (32%), Positives = 207/416 (49%), Gaps = 58/416 (13%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
           ++G GA +   +G  F+DF +G A  S G+SHP+LV  ++ Q   + H    Y  +++ I
Sbjct: 40  KRGFGALIEDVDGNVFIDFLAGAAAASTGYSHPKLVKAVQEQVALIQHSMIGYTHSERAI 99

Query: 79  -FANHLIHSTFAD--RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRT 135
             A  L   +  +  +V F  SG+++V+ AIK ++        T +  I+ F GA+HG+T
Sbjct: 100 RVAEKLAEISPIENPKVLFGLSGSDAVDMAIKVSKF------STRRPWILAFIGAYHGQT 153

Query: 136 L-ATISAGGKLQYLEGFGP------------------KIEGFDQA-----KFCDLQSLKN 171
           L AT  A  +     GF P                   I G+++      +F D   L+N
Sbjct: 154 LGATSVAAFQSSQKRGFSPLMPNVVWIPYPNPYRNPWGINGYEEPDELINRFLDY--LEN 211

Query: 172 QI------SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRT 225
            +       ++ AA+  EPIQG+ G+   PE F ++L+K+ D+   LL+ DEVQTG GRT
Sbjct: 212 YVFSHVVPPDEVAALFAEPIQGDAGIVVPPENFFKELKKLLDEHGILLVMDEVQTGIGRT 271

Query: 226 GKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLG 285
           GK FA EW  VKPD++   KG+  G  +   +   E+   +  GS   T   N +     
Sbjct: 272 GKWFASEWFEVKPDLIIFGKGVASGMGLSGVIGRKELMD-LTSGSALLTPAANPVISAAA 330

Query: 286 EKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV------- 338
           E  L II+ +  L+N + + + + + L  +K  F  +  +VRG+GL+IG++ V       
Sbjct: 331 EATLEIIEEENLLKNALKVGEFIKKRLLEMKESF-EVIGDVRGKGLMIGVEIVKENGKPD 389

Query: 339 --FSPALLAAKFRDECLLTAPSS---DNVVRILPPLTITAEEIHEGLERIERTAIK 389
              +  +    F  E  L  PS     NV+RI PPL IT E   +GLE +ER AIK
Sbjct: 390 PELTGKICWRAF--ELGLILPSYGMFGNVIRITPPLVITKEIAEKGLEIMER-AIK 442


>gnl|CDD|183999 PRK13360, PRK13360, omega amino acid--pyruvate transaminase;
           Provisional.
          Length = 442

 Score =  181 bits (461), Expect = 3e-46
 Identities = 120/415 (28%), Positives = 194/415 (46%), Gaps = 50/415 (12%)

Query: 18  FEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQE 77
               KG +  + +G   LD  +G+   + GH  PE+V  +++Q+ +L +    +Q    +
Sbjct: 32  LVAAKGMYYTTHDGRRVLDGTAGLWCVNAGHGRPEIVEAVRAQAGELDYAPA-FQMGHPK 90

Query: 78  IF--ANHLIHSTFAD--RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHG 133
            F  AN +          VFFTNSG+ESV+ A+K A  YH   G+ ++ R++  E  +HG
Sbjct: 91  AFELANRIAEIAPGGLNHVFFTNSGSESVDTALKIALAYHRARGEGSRTRLIGRERGYHG 150

Query: 134 RTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQIS------------------- 174
                IS GG +   + FG  + G D      L   +N  S                   
Sbjct: 151 VGFGGISVGGIVPNRKAFGALLPGVDHLPHT-LDLARNAFSKGQPEHGAELADELERLVT 209

Query: 175 ----NDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFA 230
               +  AA+++EP+ G  GV   P+ +LQ+LR+ICD    LLIFDEV TG+GR G  FA
Sbjct: 210 LHDASTIAAVIVEPVAGSTGVLIPPKGYLQRLREICDKHGILLIFDEVITGFGRLGAPFA 269

Query: 231 YEWANVKPDIMTIAKGM-GGGFPIGACLATNEVAACMNQGS-------HGSTYGGNVLAM 282
            ++  V PD++T AKG+  G  P+GA   ++E+     QG        HG TY G+ LA 
Sbjct: 270 AQYFGVTPDLLTCAKGLTNGAIPMGAVFVSSEIHDAFMQGPEAGIEFFHGYTYSGHPLAC 329

Query: 283 VLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPA 342
                 L++ + +G L     +A    + L ++++  P++ +++R  GL+  ++   +P 
Sbjct: 330 AAALATLDLYEREGLLTRAARLAPYWEDALHSLRD-APHV-IDIRNLGLVGAVE--LAPR 385

Query: 343 LLAAKFRD-ECLLTAPSSDNVVRIL-------PPLTITAEEIHEGLERIERTAIK 389
                 R  E  L       ++R         PPL I   +I E  + +   A+K
Sbjct: 386 DGKPGKRAYEVFLKCFEKGLMIRYTGDILALSPPLIIEEAQIDELFDIL-AQALK 439


>gnl|CDD|180758 PRK06931, PRK06931, diaminobutyrate--2-oxoglutarate
           aminotransferase; Provisional.
          Length = 459

 Score =  181 bits (460), Expect = 4e-46
 Identities = 126/415 (30%), Positives = 197/415 (47%), Gaps = 59/415 (14%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKS--QSEKLWHVSNLYQSTQQE 77
           K +G W+    G  +LD  +G    +LGH+HP+++  ++    S    H  +L    +  
Sbjct: 46  KAQGVWVTDVEGNQYLDCLAGAGTLALGHNHPDVLQSIQDVLTSGLPLHTLDLTTPLKDA 105

Query: 78  IFANHLIHSTFADR------VFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAF 131
            F+ +L+ S    +       F   SGA++VE AIK A+ Y      T +  +++F G +
Sbjct: 106 -FSEYLL-SLLPGQGKEYCLQFTGPSGADAVEAAIKLAKTY------TGRSNVISFSGGY 157

Query: 132 HGRTLATISAGGKL---QYLEGFGPKIEGF-------------DQAKFCDLQSLKNQISN 175
           HG T   ++  G L     + G  P ++                +A    L         
Sbjct: 158 HGMTHGALAVTGNLSPKNAVNGLMPGVQFMPYPHEYRCPLGIGGEAGVKALTYYFENFIE 217

Query: 176 DT-------AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKL 228
           D        AA+++E IQGEGGV   P E+LQ++R++      LLI DEVQ G+ RTGK+
Sbjct: 218 DVESGVRKPAAVILEAIQGEGGVNPAPVEWLQKIREVTQKHGILLIVDEVQAGFARTGKM 277

Query: 229 FAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKV 288
           FA+E A ++PDI+ ++K +GGG P+ A L   +       G H  T+ GN LAM  G   
Sbjct: 278 FAFEHAGIEPDIIVMSKAVGGGLPL-AVLGIKKEFDAWQPGGHTGTFRGNQLAMATGLTT 336

Query: 289 LNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV---------- 338
           L I++ +   +N     + L   L  ++ R+P     VRG+GL+IG++ V          
Sbjct: 337 LKILKEENLAQNAAERGEWLKAQLAELQKRYP-CIGNVRGRGLMIGIEIVDERQPADAMG 395

Query: 339 -------FSPALLAAKFRDECLLT-APSSDNVVRILPPLTITAEEIHEGLERIER 385
                   + A+  A F +  LL     + NVVR+LPPL IT  E  E ++R E+
Sbjct: 396 SYPADGELAAAIQKACFENGLLLERGGRNGNVVRLLPPLLITQAECEEFIDRFEQ 450


>gnl|CDD|180390 PRK06082, PRK06082, 4-aminobutyrate aminotransferase; Provisional.
          Length = 459

 Score =  178 bits (454), Expect = 2e-45
 Identities = 106/398 (26%), Positives = 178/398 (44%), Gaps = 40/398 (10%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
              +G ++   +G  ++DF  G  V+ LG+ HP ++  +K Q  KL      + +     
Sbjct: 59  ASAEGIYIEDVDGKKYMDF-HGNNVHQLGYGHPHVIEKVKEQMAKLPFSPRRFTNETAIE 117

Query: 79  FANHLIHSTFAD--RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTL 136
            A  L      +  RV F   G  ++  A+K AR        T  F++V+   +FHG +L
Sbjct: 118 CAEKLTEIAGGELNRVLFAPGGTSAIGMALKLARHI------TGNFKVVSLWDSFHGASL 171

Query: 137 ATISAGGKLQYLEGFGPKIEG-------------FDQAKFCDLQSLKN-----QISNDTA 178
             IS GG+  + +G GP + G             F  A   D+          +      
Sbjct: 172 DAISVGGEACFRQGMGPLMAGVERIPPAVSYRGAFPDADGSDVHYADYLEYVIEKEGGIG 231

Query: 179 AILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKP 238
           A + E ++    V+   + + +++R+ICD  + LLI DE+  G GRTG+ F ++   ++P
Sbjct: 232 AFIAEAVRNT-DVQVPSKAYWKRVREICDKHNVLLIIDEIPNGMGRTGEWFTHQAYGIEP 290

Query: 239 DIMTIAKGMGGG-FPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGF 297
           DI+ I KG+GGG  PI A +  ++            T+  + L        + +I+ +G 
Sbjct: 291 DILCIGKGLGGGLVPIAAMITKDKYNTAAQISLGHYTHEKSPLGCAAALATIEVIEQEGL 350

Query: 298 LENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP------ALLAAKFRDE 351
           LE V   ++ + E L  +K ++P +  +VRG GLL G++ V            A      
Sbjct: 351 LEKVKADSQFMRERLLEMKAKYP-LIGDVRGIGLLWGVELVTDRHTKERAYDEAEAVLYR 409

Query: 352 CLLTA----PSSDNVVRILPPLTITAEEIHEGLERIER 385
           CL        S  NV+++ PPL IT EE+ + L  +E 
Sbjct: 410 CLNNGLSFKVSQGNVIQLSPPLIITREELTQALAILEE 447


>gnl|CDD|181078 PRK07678, PRK07678, aminotransferase; Validated.
          Length = 451

 Score =  176 bits (449), Expect = 7e-45
 Identities = 123/409 (30%), Positives = 199/409 (48%), Gaps = 57/409 (13%)

Query: 19  EKGKGAWLFSENGIPFLDFASGI-AVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQE 77
            K +GAW+    G  +LD  SG+  VN +G+   EL      Q + L +   L QS +  
Sbjct: 34  AKAEGAWVTDIQGNRYLDGMSGLWCVN-VGYGRKELAEAAYEQLKTLSYFP-LTQSHEPA 91

Query: 78  IFANHLIHSTFAD--RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRT 135
           I     ++        +FF+NSG+E+ E A K AR+YH   G+ ++++ ++   A+HG +
Sbjct: 92  IKLAEKLNEWLGGEYVIFFSNSGSEANETAFKIARQYHAQKGEPHRYKFISRYRAYHGNS 151

Query: 136 LATISAGG----KLQY---LEGF----------GPKIEGFDQAKFCDLQSLKN------- 171
           +  ++A G    K +Y     GF           P IE  D     DL+ +K        
Sbjct: 152 MGALAATGQAQRKYKYEPLAPGFLHVPPPDCYRMPGIESEDI---YDLECVKEIDRVMTW 208

Query: 172 QISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY 231
           ++S   AA+++EPI   GGV   P+++++ +++IC    ALLI DEV  G+GRTGK F +
Sbjct: 209 ELSETIAAVIMEPIITGGGVLMPPQDYMKAVKEICQKHGALLISDEVICGFGRTGKAFGF 268

Query: 232 EWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGS------HGSTYGGNVLAMVL 284
               VKPDI+T+AKG+   + P+ A     E+              H +T+GGN  A  L
Sbjct: 269 MNYGVKPDIITMAKGITSAYLPLSATAVKKEIYEAFKGKGEYEHFRHVNTFGGNPAACAL 328

Query: 285 GEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVF----- 339
             K L I++++  +E    + ++L E L       P +  ++RG+GLL+G++ V      
Sbjct: 329 ALKNLEIMENENLIERSAQLGELLLEQLKEELGEHPLVG-DIRGKGLLVGIELVNDKETK 387

Query: 340 --SPALLAAKFRDEC----LL------TAPSSDNVVRILPPLTITAEEI 376
             +     A     C    L+      T    +NV+ + PPL I++EEI
Sbjct: 388 EPADNDKVASVVAACKEKGLIIGKNGDTVAGYNNVLTLSPPLVISSEEI 436


>gnl|CDD|180800 PRK07030, PRK07030, adenosylmethionine--8-amino-7-oxononanoate
           transaminase; Provisional.
          Length = 466

 Score =  174 bits (444), Expect = 3e-44
 Identities = 121/428 (28%), Positives = 197/428 (46%), Gaps = 55/428 (12%)

Query: 16  IRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQ 75
           I   +G+G WL    G  +LD  S   VN  GH++P +   +K Q ++L HV     S +
Sbjct: 31  IPIRRGEGVWLEDFEGKRYLDAVSSWWVNVFGHANPRINQRIKDQVDQLEHVILAGFSHE 90

Query: 76  QEI-FANHLIHSTFA--DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFH 132
             I  +  L+  T     R F+ ++G+ ++E A+K +  Y    GK  K R VT   ++H
Sbjct: 91  PVIELSERLVKITPPGLSRCFYADNGSSAIEVALKMSFHYWRNRGKPRKKRFVTLTNSYH 150

Query: 133 GRTLATISAGGKLQYLEGFGPKI--------------------EGFDQAKFCDLQSLKNQ 172
           G TLA +S G    + E + P +                    E   +  F  ++    +
Sbjct: 151 GETLAAMSVGDVALFTETYKPLLLDTIKVPSPDCYLRPEGMSWEEHSRRMFAHMEQTLAE 210

Query: 173 ISNDTAAILIEP-IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY 231
             ++ AA+++EP IQG GG+R     +L+ LR+ CD     LI DE+  G+GRTG +FA 
Sbjct: 211 HHDEIAAVIVEPLIQGAGGMRMYHPVYLKLLREACDRYGVHLIHDEIAVGFGRTGTMFAC 270

Query: 232 EWANVKPDIMTIAKGMGGGF-PIGACLATNEVA-------ACMNQGSHGSTYGGNVLAMV 283
           E A ++PD + ++K + GG+ P+ A L T+ V          +    H  +Y GN LA  
Sbjct: 271 EQAGIRPDFLCLSKALTGGYLPLAAVLTTDTVYQAFYDDYPTLRAFLHSHSYTGNPLACA 330

Query: 284 LGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSPAL 343
                L+I + D  +EN   +A+ + E    + +  P++  EVR  G+++ ++ V   A 
Sbjct: 331 AALATLDIFEQDNVIENNRALARRMAEATAHLADH-PHV-AEVRQTGMILAIEMVQDKAS 388

Query: 344 LAA---------KFRDECL----LTAPSSDNVVRILPPLTITAEEIH-------EGLERI 383
                       K     L    L  P   +VV  LPP  IT E+I        EG++  
Sbjct: 389 KTPYPWQERRGLKVYQHALERGALLRPLG-SVVYFLPPYVITPEQIDFLAEVASEGIDIA 447

Query: 384 ERTAIKLS 391
            R ++ ++
Sbjct: 448 TRDSVSVA 455


>gnl|CDD|180611 PRK06541, PRK06541, hypothetical protein; Provisional.
          Length = 460

 Score =  174 bits (444), Expect = 3e-44
 Identities = 116/432 (26%), Positives = 190/432 (43%), Gaps = 77/432 (17%)

Query: 18  FEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQE 77
             +G+G +++ + G  +LD  +G+ V  +GH   EL      Q+  L        +    
Sbjct: 38  IVRGEGCYIWDDRGKRYLDGLAGLFVVQVGHGRAELAEAAAKQAGTLAFFPLWSYAHPPA 97

Query: 78  IFANHLIHSTFA----DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHG 133
           I     + +  A    +RVFFT  G+E+VE A K A++Y  + GK  K ++++   A+HG
Sbjct: 98  IELAERL-AALAPGDLNRVFFTTGGSEAVESAWKLAKQYFKLTGKPGKHKVISRAIAYHG 156

Query: 134 RTLATISAGGKLQYLEGFGPKIEGF----------------DQAKFCDLQSLKNQISN-- 175
            T   ++  G   +   F P + G                 D   F   +   ++I    
Sbjct: 157 TTQGALAITGLPAFKAPFEPLVPGGFRVPNTNFYRAPELGDDPEAFG--RWAADRIEEAI 214

Query: 176 -----DT-AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF 229
                DT AA+ +EP+Q  GG    P  + +++R+ICD  D LL+ DEV   +GR G++F
Sbjct: 215 EFEGPDTVAAVFLEPVQNAGGCFPPPPGYFERVREICDRYDVLLVSDEVICAFGRLGEMF 274

Query: 230 AYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGS----HGSTYGGNVLAMVL 284
             E     PDI+T AKG+  G+ P+GA +A++ +      G     HG T+GG+ ++  +
Sbjct: 275 GCERFGYVPDIITCAKGITSGYSPLGAMIASDRLFEPFLDGPTMFLHGYTFGGHPVSAAV 334

Query: 285 GEKVLNIIQSDGFLENVINIAKIL---FEGLTAIKNRFPNMFLEVRGQGLLIG------- 334
               L+I + +G L++V +         E L  +      +  +VRG G   G       
Sbjct: 335 ALANLDIFEREGLLDHVRDNEPAFRATLEKLLDLP-----IVGDVRGDGYFYGIELVKDK 389

Query: 335 --------------LKTVFSPALLAA----KFRDECLLTAPSSDNVVRILPPLTITAEEI 376
                         L+   SPAL  A    +  D         D VV++ PPL    EE 
Sbjct: 390 ATKETFTDDESERLLRGFLSPALFEAGLYCRADDR-------GDPVVQLAPPLISGQEEF 442

Query: 377 HEGLERIERTAI 388
            E +E+I R+ +
Sbjct: 443 DE-IEQILRSVL 453


>gnl|CDD|181707 PRK09221, PRK09221, beta alanine--pyruvate transaminase;
           Provisional.
          Length = 445

 Score =  174 bits (444), Expect = 3e-44
 Identities = 112/350 (32%), Positives = 171/350 (48%), Gaps = 37/350 (10%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
             +G +    +G   LD  +G+   + GH  PE+V  +  Q+  L   +  +Q      F
Sbjct: 37  SAEGMYYTDADGRKILDGTAGLWCCNAGHGRPEIVEAVARQAATL-DYAPAFQMGHPLAF 95

Query: 80  --ANHLIHSTFA--DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRT 135
             A  L        D VFFTNSG+ESV+ A+K A  YH   G+  + R++  E  +HG  
Sbjct: 96  ELAERLAELAPGGLDHVFFTNSGSESVDTALKIALAYHRARGQGTRTRLIGRERGYHGVG 155

Query: 136 LATISAGGKLQYLEGFGPKIEGFD---------QAKFC------------DLQSLKNQIS 174
              IS GG +   + FG  + G D         +  F             DL+ L     
Sbjct: 156 FGGISVGGIVNNRKMFGGLLPGVDHLPHTLDLPENAFSKGQPEHGAELADDLERLVALHD 215

Query: 175 NDT-AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEW 233
             T AA+++EP+ G  GV   P+ +LQ+LR+ICD    LLIFDEV TG+GR G  FA E 
Sbjct: 216 ASTIAAVIVEPMAGSAGVLVPPKGYLQRLREICDKHGILLIFDEVITGFGRLGAAFAAER 275

Query: 234 ANVKPDIMTIAKGM-GGGFPIGACLATNEV-AACMN--QGS----HGSTYGGNVLAMVLG 285
             V PDI+T AKG+  G  P+GA +A++E+  A M   + +    HG TY  + +A   G
Sbjct: 276 FGVTPDIITFAKGLTNGAIPMGAVIASDEIYDAFMQGPEYAIEFFHGYTYSAHPVACAAG 335

Query: 286 EKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL 335
              L+I + +   E    +A    + + ++K   P++ +++R  GL+ G+
Sbjct: 336 LATLDIYREEDLFERAAELAPYFEDAVHSLKGL-PHV-IDIRNIGLVAGI 383


>gnl|CDD|180764 PRK06938, PRK06938, diaminobutyrate--2-oxoglutarate
           aminotransferase; Provisional.
          Length = 464

 Score =  172 bits (437), Expect = 2e-43
 Identities = 121/420 (28%), Positives = 206/420 (49%), Gaps = 60/420 (14%)

Query: 16  IRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELV-AILKSQSEKL-WHVSNLYQS 73
           +  ++ +G ++    G  F+D  +G    +LGH+HP ++ AI +  +++L  H  +L   
Sbjct: 47  LALKRARGIYVEDVEGRQFIDCLAGAGTLALGHNHPVVIEAIQQVLADELPLHTLDLTTP 106

Query: 74  TQ----QEIFANHLIHSTFADRV---FFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT 126
            +    Q++FA   +   FA      F   +G ++VE A+K  +        T +  +++
Sbjct: 107 VKDQFVQDLFA--SLPEAFAREAKIQFCGPTGTDAVEAALKLVKT------ATGRSTVLS 158

Query: 127 FEGAFHGRTLATISAGGKL---QYLEGFGPKIE--------------GFDQAKFCDLQSL 169
           F+G +HG +   +S  G L   + L    P ++              G +     +L  L
Sbjct: 159 FQGGYHGMSQGALSLMGNLGPKKPLGALLPGVQFLPYPYDYRCPFGLGGEAGVRANLHYL 218

Query: 170 KNQISNDT------AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYG 223
           +N + +        AA+++E +QGEGGV   P E+L+ LR+I ++    LI DE+Q+G+G
Sbjct: 219 ENLLDDPESGVVLPAAVILEVVQGEGGVIPAPIEWLRGLRRITEEAGIPLIVDEIQSGFG 278

Query: 224 RTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMV 283
           RTGK+FA+E A + PD++ ++K +GG  P+ A +   E       G+H  T+ GN +AM 
Sbjct: 279 RTGKMFAFEHAGIIPDVVVLSKAIGGSLPL-AVVVYREWLDTWQPGAHAGTFRGNQMAMA 337

Query: 284 LGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV----- 338
            G   L  I+     E+   + + L E L  ++  +P +  +VRG+GL++G++ V     
Sbjct: 338 AGSATLRYIKEHRLAEHAAAMGERLREHLRQLQRDYPQLG-DVRGRGLMLGVEIVDPQGE 396

Query: 339 -----FSPAL--LAAKFRDECLL------TAPSSDNVVRILPPLTITAEEIHEGLERIER 385
                  PA   LA+  + ECL             +VVR LPPL ITAE+I E  E    
Sbjct: 397 PDALGHPPANGELASLIQRECLRRGLILELGGRHGSVVRFLPPLIITAEQIDEVAEIFAE 456


>gnl|CDD|181493 PRK08593, PRK08593, 4-aminobutyrate aminotransferase; Provisional.
          Length = 445

 Score =  168 bits (428), Expect = 2e-42
 Identities = 107/416 (25%), Positives = 184/416 (44%), Gaps = 46/416 (11%)

Query: 15  DIRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQST 74
            +  + G GA L   +G  ++D  +  +  ++GH+ P +V  +K+Q++K  H +  Y   
Sbjct: 25  PLVIDHGYGATLTDVDGKTYIDLLASASSQNVGHAPPRVVEAIKAQADKFIHYTPAYMYH 84

Query: 75  QQEI-FANHLIHS---TFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGA 130
           +  +  A  L       F  RV F  SG+++ +  IK AR Y      T +  I++F  A
Sbjct: 85  EPLVRLAKKLCELAPGDFEKRVTFGLSGSDANDGIIKFARAY------TGRPYIISFTNA 138

Query: 131 FHGRTLATISAGG-KLQYLEGFGPKIEGFDQAKFCDL-QSLKNQISNDT----------- 177
           +HG T  ++S  G  L     +GP + GF    F D  + +  +   +            
Sbjct: 139 YHGSTYGSLSMSGISLNMRRKYGPLLPGFVHIPFPDKYRGMYEEPDANFVEEYLAPLKEM 198

Query: 178 ----------AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGK 227
                     A I+IE IQG+GG+ +    + + L K C +   L   D++Q G GRTGK
Sbjct: 199 FEKYLPADEVACIVIETIQGDGGLLEPVPGYFEALYKFCREHGILFAVDDIQQGLGRTGK 258

Query: 228 LFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSHGSTYGGNVLAMVLGEK 287
             +    N+ PD+M+  K + GG P+ A +   E+   +   +H  T G N ++      
Sbjct: 259 WSSISHFNITPDLMSFGKSLAGGMPMSAIVGRKEIMESLEAPAHLFTTGANPVSCAAALA 318

Query: 288 VLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFL-EVRGQGLLIGLKTVFSPAL--- 343
            +++I+ +  L+      +   +      +++   F+ +VRG GL IG+  V    L   
Sbjct: 319 TIDMIEDESLLQRSAEKGEYARKRFDQWVSKYN--FVGDVRGYGLSIGIDIVSDKKLKTR 376

Query: 344 ---LAAKFRDEC----LLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLSH 392
               A K  + C    ++    + NV+R  PPL IT E++   L  IE+    L  
Sbjct: 377 DNEAALKICNYCFEHGVVIIAVAGNVLRFQPPLVITYEQLDTALNTIEQAFTALEA 432


>gnl|CDD|180401 PRK06105, PRK06105, aminotransferase; Provisional.
          Length = 460

 Score =  167 bits (424), Expect = 6e-42
 Identities = 109/416 (26%), Positives = 185/416 (44%), Gaps = 52/416 (12%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKL--WHVSNLYQSTQQ 76
           E+G+G +++ + G  +++  +G+   +LG S   LV     Q +KL  +H  + ++S   
Sbjct: 35  ERGEGIYVYDDAGKRYIEGMAGLWSVALGFSEQRLVEAAARQMKKLPFYHTFS-HKSHGP 93

Query: 77  EI-FANHLIHSTFAD--RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHG 133
            I  A  L+        +VFFTNSG+E+ +  +K    Y+   G+  K +I++ +  +HG
Sbjct: 94  VIDLAEKLVAMAPVPMSKVFFTNSGSEANDTVVKLVWYYNNALGRPEKKKIISRQRGYHG 153

Query: 134 RTLATISAGGKLQYLEGFGPKIEGF----------------DQAKFCD--LQSLKNQI-- 173
            T+A+ S  G       F   ++                   +  F       L+  I  
Sbjct: 154 VTIASASLTGLPNNHRSFDLPLDRILHTGCPHYYRFGLPGESEEAFATRLANELEALILA 213

Query: 174 -SNDT-AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAY 231
              DT AA + EP+ G GGV   P+ + ++++ +    D LL+ DEV  G+GRTG +F  
Sbjct: 214 EGPDTIAAFIGEPVMGAGGVIVPPKTYWEKIQAVLRKYDILLVADEVICGFGRTGNMFGC 273

Query: 232 EWANVKPDIMTIAKGMGGG-FPIGACLATNEVAACMNQGS-------HGSTYGGNVLAMV 283
           E   +KPDI+ ++K +     P+ A L   +V   +   S       HG T  G+ +A  
Sbjct: 274 ETFGIKPDILVMSKQLSSSYQPLSAVLMNEKVYDPIADESGKIGTFGHGFTASGHPVAAA 333

Query: 284 LGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL-------- 335
           +  + L II+    + N       L   L A+ +  P +  EVRG GL+  +        
Sbjct: 334 VALENLAIIEERDLVGNAAERGARLQARLRALADH-P-LVGEVRGVGLIAAVELVADKAT 391

Query: 336 KTVFSPAL-----LAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERT 386
           KT F P         A   +  +++    D +    PPL ITA ++ E ++R  R 
Sbjct: 392 KTPFEPPGKVGARANAAAHEHGVISRAMGDTLA-FCPPLIITAAQVDEMVDRFGRA 446


>gnl|CDD|161905 TIGR00508, bioA, adenosylmethionine-8-amino-7-oxononanoate
           transaminase.  All members of the seed alignment have
           been demonstrated experimentally to act as EC 2.6.1.62,
           an enzyme in the biotin biosynthetic pathway. Alternate
           names include 7,8-diaminopelargonic acid
           aminotransferase, DAPA aminotransferase, and
           adenosylmethionine-8-amino-7-oxononanoate
           aminotransferase. The gene symbol is bioA in E. coli and
           BIO3 in S. cerevisiae.
          Length = 427

 Score =  164 bits (418), Expect = 3e-41
 Identities = 106/365 (29%), Positives = 176/365 (48%), Gaps = 46/365 (12%)

Query: 47  GHSHPELVAILKSQSEKLWHVS----------NLYQSTQQEIFANHLIHSTFADRVFFTN 96
           G++HP L A  + Q +K+ HV            L Q   + +  N L      D VF  +
Sbjct: 60  GYNHPRLNAAAQKQIDKMSHVMFGGFTHKPAIELCQKLVK-MTPNAL------DCVFLAD 112

Query: 97  SGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISA-----------GGKL 145
           SG+ +VE A+K A +Y    G+ N+ + +T    +HG T   +S             G L
Sbjct: 113 SGSVAVEVALKMALQYWQAKGEKNRQKFLTIRSGYHGDTFGAMSVCDPENSMHSLYKGYL 172

Query: 146 -QYLEGFGPKIEGFDQAKFCDLQSLKNQI---SNDTAAILIEPI-QGEGGVRKVPEEFLQ 200
            + +    P+    ++     +  L   +   S++ AA+++EPI QG GG+R     +L+
Sbjct: 173 PEQIFAPAPQNRFDEEWNEEAITPLAKLMELHSDEIAAVILEPIVQGAGGMRFYHPTYLK 232

Query: 201 QLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLAT 259
           +++ +C   D LLI DE+ TG+GRTGKLFA E A V PDI+ + K + GG+  + A + T
Sbjct: 233 RVQALCKQYDILLIADEIATGFGRTGKLFACEHAGVVPDILCVGKALTGGYMTLSATVTT 292

Query: 260 NEVAACMNQGS-----HGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLT- 313
           ++VA  ++ G      HG T+ GN LA  + E  L I+    + + V  I   L   L+ 
Sbjct: 293 DKVAQTISSGEAGCFMHGPTFMGNPLACAVAEASLAILLEGEWQKQVSAIENQLKRELSP 352

Query: 314 AIKNRFPNMFLEVRGQGLL--IGLKTVFSPALLAAKFRDECLLTAPSSDNVVRILPPLTI 371
             KN    +  +VR  G +  + +    +   L  KF ++ +   P    ++ ++PP  I
Sbjct: 353 LRKNP---VVKDVRVLGAIGVVEMYKPVNVEELQKKFVEQGVWIRPFG-KLIYVMPPYII 408

Query: 372 TAEEI 376
           T E++
Sbjct: 409 TTEQL 413


>gnl|CDD|180426 PRK06148, PRK06148, hypothetical protein; Provisional.
          Length = 1013

 Score =  163 bits (414), Expect = 9e-41
 Identities = 120/416 (28%), Positives = 196/416 (47%), Gaps = 65/416 (15%)

Query: 16   IRFEKGKGAWLFSENGIPFLDFASGIAVNS---LGHSHPELVAILKSQSEKLWHVSNLYQ 72
            I+F +G G WL    G  +LD       N+   +GH+HP +VA    Q+ +L + +  Y 
Sbjct: 608  IKFVRGWGVWLIDNRGRAYLD-----CFNNVCHVGHAHPRVVAAAARQAARL-NTNTRYL 661

Query: 73   STQQEIFANHLIHSTFADRV---FFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEG 129
                  +A  L  +T  D +   FF NSG+E+   A++ AR +      T +   +  + 
Sbjct: 662  HDAIVAYAERLT-ATLPDGLTVAFFVNSGSEANSLALRLARAH------TGQRDAIVLDH 714

Query: 130  AFHGRT--LATISA------GGKLQ------------YLEGFG-PKIEGFDQAKFCDLQS 168
            A+HG T  L  +S       GGK +            Y      P  E     +F +  S
Sbjct: 715  AYHGTTTELIDLSPYKFNRKGGKGRPDHVEVAEVPDSYRGPERWPDAE--HGRRFAE--S 770

Query: 169  LKNQIS------NDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGY 222
            +  QI+         A  + E I    G   +PE +L+++  +      + I DEVQ G+
Sbjct: 771  VAEQIAAMAAKGRGPAFFIAESIPSVAGQIFLPEGYLREVYAMVRAAGGVCIADEVQVGF 830

Query: 223  GRTGK-LFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQG-SHGSTYGGNVL 280
            GR G   +A+E   V PDI+T+ K +G G P+GA + T E+A   + G  + +T+GGN +
Sbjct: 831  GRVGSHWWAFETQGVVPDIVTMGKPIGNGHPMGAVVTTREIADSFDNGMEYFNTFGGNPV 890

Query: 281  AMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVF- 339
            +  +G  VL+II+ +    N + I   L  GL  +++RF  +  +VRG GL +G++ V  
Sbjct: 891  SCAIGLAVLDIIEDEDLQRNALEIGNYLLAGLRELQDRFD-IIGDVRGMGLFLGIELVTD 949

Query: 340  ----SPALLAAKF-----RDECLL--TAPSSDNVVRILPPLTITAEEIHEGLERIE 384
                +PA   A++     R+  +L  T    DNV++I PPL  +  +    LE ++
Sbjct: 950  RKTKAPATAIARYVKNGARERGILIGTEGPHDNVLKIRPPLIFSRADADHLLEVLD 1005


>gnl|CDD|180994 PRK07480, PRK07480, putative aminotransferase; Validated.
          Length = 456

 Score =  163 bits (414), Expect = 1e-40
 Identities = 122/420 (29%), Positives = 200/420 (47%), Gaps = 65/420 (15%)

Query: 19  EKGKGAWLFSENGIPFLDFASGI-AVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQ- 76
            + +G +L+   G   LD  +G+  VN +G+   EL      Q  +L + +  +++T   
Sbjct: 37  TRAEGVYLWDSEGNKILDGMAGLWCVN-VGYGRKELADAAARQMRELPYYNTFFKTTHPP 95

Query: 77  ---------EIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTF 127
                    E+           + VFFTNSG+E+ +  ++  R Y  + GK  K  I++ 
Sbjct: 96  AIELAAKLAEVAPPGF------NHVFFTNSGSEANDTVLRMVRHYWALKGKPQKKVIISR 149

Query: 128 EGAFHGRTLATISAGGKLQYLEGFGP-KIEGF---------------DQAKFCDL--QSL 169
           +  +HG T+A  S GG ++Y+   G   I G                   +F     + L
Sbjct: 150 KNGYHGSTVAGASLGG-MKYMHEQGDLPIPGIVHIDQPYWFGEGGDMTPEEFGLAAARQL 208

Query: 170 KNQI----SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRT 225
           + +I    +++ AA + EPIQG GGV   P  +  ++++IC   D LL+ DEV  G+GRT
Sbjct: 209 EAKILELGADNVAAFIGEPIQGAGGVIIPPATYWPEIQRICRKYDILLVADEVICGFGRT 268

Query: 226 GKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACM-NQG---SHGSTYGGNVL 280
           G+ F  +   +KPD+MTIAKG+  G+ P+GA    + VA  +  +G   +HG TY G+ +
Sbjct: 269 GEWFGSQHFGIKPDLMTIAKGLTSGYIPMGAVGVGDRVAEVLIEEGGEFNHGFTYSGHPV 328

Query: 281 AMVLGEKVLNIIQSDGFLENVIN-IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVF 339
           A  +    L I++ +G +E V +     L + L  + +  P +  EVRG GL+  ++ V 
Sbjct: 329 AAAVALANLRILRDEGIVERVRDDTGPYLQKRLRELAD-HP-LVGEVRGVGLVGAIELVK 386

Query: 340 SPALLAAKF----------RDEC----LLTAPSSDNVVRILPPLTITAEEIHEGLERIER 385
             A    +F          RD C    L+     D ++ I PPL IT  EI E +E+  +
Sbjct: 387 DKA-TRERFEAGGGVGTICRDHCFANGLIMRAVGDRMI-ISPPLVITHAEIDELVEKARK 444


>gnl|CDD|180174 PRK05630, PRK05630, adenosylmethionine--8-amino-7-oxononanoate
           transaminase; Provisional.
          Length = 422

 Score =  158 bits (401), Expect = 2e-39
 Identities = 109/318 (34%), Positives = 157/318 (49%), Gaps = 26/318 (8%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHV--SNLYQSTQQE 77
              G +L  E+G   +D  S     + GH HP L A    Q + + HV    L      +
Sbjct: 28  STDGVFLTLEDGSTVIDAMSSWWSAAHGHGHPRLKAAAHKQIDTMSHVMFGGLTHEPAIK 87

Query: 78  IFANHLIHSTFA--DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRT 135
           +    L++ T    D VF+++SG+ SVE AIK A +Y    G   + R++T+   +HG T
Sbjct: 88  L-TRKLLNLTDNGLDHVFYSDSGSVSVEVAIKMALQYSKGQGHPERTRLLTWRSGYHGDT 146

Query: 136 LATISA----GGKLQYLEG------FGPK--IEGFDQAKFCD-LQSLKNQISNDTAAILI 182
            A +S     GG     +G      F P   + G    +  + L+SL+  I    AAI+I
Sbjct: 147 FAAMSVCDPEGGMHSLWKGTLPEQIFAPAPPVRGSSPQEISEYLRSLELLIDETVAAIII 206

Query: 183 EPI-QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIM 241
           EPI QG GG+R      ++ +R +CD  D LLI DE+ TG+GRTG+LFA   A V PDIM
Sbjct: 207 EPIVQGAGGMRFHDVALIEGVRTLCDKHDILLIADEIATGFGRTGELFATLAAGVTPDIM 266

Query: 242 TIAKGMGGGF-PIGACLATNEVAACMN--QGS----HGSTYGGNVLAMVLGEKVLNIIQS 294
            + K + GGF    A L T++VA  ++   G     HG T+  N LA  +    L II++
Sbjct: 267 CVGKALTGGFMSFAATLCTDKVAQLISTPNGGGALMHGPTFMANPLACAVAHASLEIIET 326

Query: 295 DGFLENVINIAKILFEGL 312
             + + V  I   L  GL
Sbjct: 327 GMWRKQVKRIEAELIAGL 344


>gnl|CDD|162007 TIGR00713, hemL, glutamate-1-semialdehyde-2,1-aminomutase.  This
           enzyme, glutamate-1-semialdehyde-2,1-aminomutase
           (glutamate-1-semialdehyde aminotransferase, GSA
           aminotransferase), contains a pyridoxal phosphate
           attached at a Lys residue at position 283 of the seed
           alignment. It is in the family of class III
           aminotransferases.
          Length = 423

 Score =  158 bits (401), Expect = 2e-39
 Identities = 96/313 (30%), Positives = 145/313 (46%), Gaps = 33/313 (10%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLY-QSTQQE 77
            +GKGA+L+  +G  ++D+        LGH+HP +V  +K   E+       Y   T+ E
Sbjct: 35  ARGKGAYLYDVDGNEYIDYVLSWGPLILGHAHPRVVEAVKEALERGT----SYGAPTEAE 90

Query: 78  IFANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHG-- 133
           I     I S     + V F NSG E+   A++ AR      G T + +I+ FEG +HG  
Sbjct: 91  ILLAKEIISRVPSVEMVRFVNSGTEATMSAVRLAR------GYTGRDKIIKFEGCYHGHH 144

Query: 134 --------RTLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLK---NQISNDTAAILI 182
                      AT+         E F           + DL++L+    +   + A +++
Sbjct: 145 DALLVKAGSGAATLGLPTSPGVPEDFAKLTL---VLPYNDLEALEEVFEEYGEEIAGVIV 201

Query: 183 EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMT 242
           EP+ G  GV     EFL  LR + ++  +LLIFDEV TG+ R     A E+  V+PD+ T
Sbjct: 202 EPVAGNMGVVPPKPEFLAGLRALTEEYGSLLIFDEVMTGF-RVALGGAQEYFGVEPDLTT 260

Query: 243 IAKGMGGGFPIGACLATNEV-AACMNQGS--HGSTYGGNVLAMVLGEKVLNIIQSDGFLE 299
           + K +GGG P+GA     E+      +G      T  GN LAM  G   L ++  +G   
Sbjct: 261 LGKIIGGGLPVGAFGGRREIMERLAPEGPVYQAGTLSGNPLAMAAGLATLKLLDEEGVYT 320

Query: 300 NVINIAKILFEGL 312
            +  +AK L EGL
Sbjct: 321 ELDELAKRLAEGL 333


>gnl|CDD|178360 PLN02760, PLN02760, 4-aminobutyrate:pyruvate transaminase.
          Length = 504

 Score =  156 bits (396), Expect = 1e-38
 Identities = 117/409 (28%), Positives = 191/409 (46%), Gaps = 53/409 (12%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
           EK +G++++  NG  +LD  +G+   +LG S P LVA    Q  KL    + +  T +  
Sbjct: 76  EKSEGSYVYDINGKKYLDALAGLWCTALGGSEPRLVAAATEQLNKLPFYHSFWNRTTKPS 135

Query: 79  F--ANHLIHSTFADR----VFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFH 132
              A  L+   F  R    VFFTNSG+E+ +  +K    Y+   G+ NK + +    ++H
Sbjct: 136 LDLAKELL-EMFTARKMGKVFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARSKSYH 194

Query: 133 GRTLATISAGGKLQYLEGF---------------------GPKIEGFDQAKFCDLQSLKN 171
           G TL + S  G     + F                     G   E F      +L++L  
Sbjct: 195 GSTLISASLSGLPALHQKFDLPAPFVLHTDCPHYWRFHLPGETEEEFSTRLADNLENLIL 254

Query: 172 QISNDT-AAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFA 230
           +   +T AA + EP+ G GGV   P  + ++++ +    D L I DEV   +GR G +F 
Sbjct: 255 KEGPETIAAFIAEPVMGAGGVIPPPATYFEKIQAVLKKYDILFIADEVICAFGRLGTMFG 314

Query: 231 YEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGS-------HGSTYGGNVLAM 282
            +  N+KPD++++AK +   + PIGA L + E++  ++  S       HG TY G+ ++ 
Sbjct: 315 CDKYNIKPDLVSLAKALSSAYMPIGAVLVSPEISDVIHSQSNKLGSFAHGFTYSGHPVSC 374

Query: 283 VLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTV---- 338
            +  + L I +     E+V  IA    +G+ A       +  E+RG GL++G + V    
Sbjct: 375 AVALEALKIYKERNIPEHVNKIAPRFQDGIKAFSGS--PIIGEIRGTGLILGTEFVDNKS 432

Query: 339 ----FSPAL-LAAKFRDEC----LLTAPSSDNVVRILPPLTITAEEIHE 378
               F     + A F  EC    +L   + DN++ + PPL IT EE+ E
Sbjct: 433 PNDPFPAEWGVGAYFGAECKKRGMLVRVAGDNIM-MSPPLIITPEEVDE 480


>gnl|CDD|180330 PRK05965, PRK05965, hypothetical protein; Provisional.
          Length = 459

 Score =  154 bits (391), Expect = 3e-38
 Identities = 119/418 (28%), Positives = 188/418 (44%), Gaps = 56/418 (13%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQ-STQQE 77
              KGA L   +G   LD  +G+   ++G+    +V     Q  +L + +  +   ++  
Sbjct: 33  ASAKGATLTDASGHQLLDAFAGLWCVNVGYGQESIVEAAAEQMRELPYATGYFHFGSEPA 92

Query: 78  I-FANHLIHSTFAD--RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGR 134
           I  A  L          V+FT  G+++V+ A++  R Y    G+ +K + ++ E  +HG 
Sbjct: 93  IRLAAKLAERAPGSLNHVYFTLGGSDAVDSAVRFIRHYWNATGRPSKKQFISLERGYHGS 152

Query: 135 TLATISAGGKLQYL----EGFG-P-----KI---------EGFDQAKFCD--LQSLKNQI 173
           +    S G  L  L     GF  P     KI          G D        + +L+ ++
Sbjct: 153 S----SVGAGLTALPAFHRGFDLPLPWQHKIPSPYPYRNPVGDDPQAIIAASVAALRAKV 208

Query: 174 S----NDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLF 229
           +    ++ AA   EPIQG GGV   P+ +L+ +R+ C ++  L + DEV TG+GRTG LF
Sbjct: 209 AELGADNVAAFFCEPIQGSGGVIVPPKGWLKAMREACRELGILFVADEVITGFGRTGPLF 268

Query: 230 AYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGS-------HGSTYGGNVLA 281
           A E   V PD+MT+AKG+  G+ P+GA L ++ V   +  G+       HG TY  + ++
Sbjct: 269 ACEAEGVVPDLMTVAKGLTSGYVPMGAVLMSDHVYQGIADGAGAAAPVGHGYTYSAHPVS 328

Query: 282 MVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL------ 335
             +G +VL +    G L N          GL A++   P +  +VRG+GLL  L      
Sbjct: 329 AAVGLEVLRLYHEGGLLANGQKAGPRFAAGLDALRAH-P-LVGDVRGRGLLGALELVADK 386

Query: 336 --KTVFSPAL-----LAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERT 386
             KT F  AL     +  +     L+     D V+   P L  T  E     ER  +T
Sbjct: 387 ATKTPFDAALDPADRIFDRAYANGLVFRAFGDGVLGFAPALCCTEGEFDLIFERTRKT 444


>gnl|CDD|168777 PRK07036, PRK07036, hypothetical protein; Provisional.
          Length = 466

 Score =  154 bits (390), Expect = 5e-38
 Identities = 112/429 (26%), Positives = 180/429 (41%), Gaps = 59/429 (13%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQ-- 76
            + +G ++   +G  +LD   G+   ++G+   E+   +  Q+ +L + +     T    
Sbjct: 38  VEAEGIYVTDADGRRYLDGIGGMWCVNVGYGREEMADAIADQARRLPYYTPFGDMTNAPA 97

Query: 77  EIFANHLIHSTFAD--RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGR 134
              A  L      D   VF T  G+ +V+ A++    Y  + G+  K  I+T   A+HG 
Sbjct: 98  AELAAKLAELAPGDLNHVFLTTGGSTAVDSALRFVHYYFNVRGRPAKKHIITRGDAYHGS 157

Query: 135 TLATISAGGK------LQYLEGFGPKI---------EGFDQAKFCDL--QSLKNQI---- 173
           T  T S  GK        Y       +          G  +A FCD      +++I    
Sbjct: 158 TYLTASLTGKAADRTEFDYASDLVHHLSSPNPYRRPAGMSEAAFCDFLVDEFEDKILSLG 217

Query: 174 SNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEW 233
           +++ AA + EPI G GGV   P  +  ++R+IC   D L I DEV TG+GR G  FA E 
Sbjct: 218 ADNIAAFIAEPILGSGGVIVPPPGYHARMREICRRYDILYISDEVVTGFGRLGHFFASEA 277

Query: 234 A-NVKPDIMTIAKGMGGG-FPIGACLATNEVAACM-------NQGSHGSTYGGNVLAMVL 284
              ++PDI+T AKG+  G  P+GA + +  +   +       N  +HG TY G+ +A   
Sbjct: 278 VFGIQPDIITFAKGLTSGYQPLGAVIISERLLDVISGPNAKGNVFTHGFTYSGHPVACAA 337

Query: 285 GEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP--- 341
             K + I++ +G  E+V  +     E L +++   P +  +VRG  L+  ++ V      
Sbjct: 338 ALKNIEIMEREGLCEHVREVGPYFEERLASLRE-LP-LVGDVRGDHLMACVECVADKGSK 395

Query: 342 ALLAAKFR------DEC----LLTAPSSD-NVVRILPPLTITAEEI-------HEGLERI 383
           ALL             C    LL  P     V+   PPL IT  +I          +E  
Sbjct: 396 ALLPEDIAIGQRIDRHCQERGLLVRPLEHLCVLS--PPLIITRAQIDEIVAILRAAIEET 453

Query: 384 ERTAIKLSH 392
                    
Sbjct: 454 ADELAAHGL 462


>gnl|CDD|178834 PRK00062, PRK00062, glutamate-1-semialdehyde aminotransferase;
           Provisional.
          Length = 426

 Score =  152 bits (388), Expect = 1e-37
 Identities = 107/334 (32%), Positives = 160/334 (47%), Gaps = 67/334 (20%)

Query: 18  FEKGKGAWLFSENGIPFLDFASGIAVNS-----LGHSHPELVAILKSQSEKLWHVSNLY- 71
            E+ KGA+L+  +G  ++D+     V S     LGH+HPE+V  +   +EK       + 
Sbjct: 36  IERAKGAYLYDVDGNEYIDY-----VGSWGPMILGHAHPEVVEAVIEAAEKGL----SFG 86

Query: 72  QSTQQEI-FANHLI-HSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEG 129
             T+ E+  A  +I      + V   NSG E+   AI+ AR Y      T + +I+ FEG
Sbjct: 87  APTELEVELAELVIELVPSIEMVRMVNSGTEATMSAIRLARGY------TGRDKIIKFEG 140

Query: 130 AFHGR---TLATISAG-GKLQYLEGFG-------PKIEGFDQAK------FCDLQSLK-- 170
            +HG     L  + AG G        G       P+    D AK      + DL++++  
Sbjct: 141 CYHGHADSLL--VKAGSGAA----TLGLPDSPGVPE----DFAKHTLTAPYNDLEAVEEL 190

Query: 171 -NQISNDTAAILIEPIQGEGGVRKVP--EEFLQQLRKICDDIDALLIFDEVQTGYGRTGK 227
             +  ++ AA+++EP+ G  GV  VP    FL+ LR++CD+  ALLIFDEV TG+ R   
Sbjct: 191 FEEYGDEIAAVIVEPVAGNMGV--VPPKPGFLEGLRELCDEHGALLIFDEVMTGF-RVAL 247

Query: 228 LFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGS------HGSTYGGNVLA 281
             A  +  V PD+ T+ K +GGG P+GA     E+   M Q +         T  GN LA
Sbjct: 248 GGAQGYYGVTPDLTTLGKIIGGGLPVGAFGGRREI---MEQLAPLGPVYQAGTLSGNPLA 304

Query: 282 MVLGEKVLNIIQSDGFLENVINIAKILFEGLTAI 315
           M  G   L +++  GF E +  + K L EGL   
Sbjct: 305 MAAGLATLKLLKEPGFYEELEALTKRLAEGLKEA 338


>gnl|CDD|180441 PRK06173, PRK06173, adenosylmethionine--8-amino-7-oxononanoate
           transaminase; Provisional.
          Length = 429

 Score =  147 bits (373), Expect = 4e-36
 Identities = 111/393 (28%), Positives = 185/393 (47%), Gaps = 46/393 (11%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHV-------SNLY 71
           E+  G  +  ++G   +D  S       G++HP L A   +Q  K+ H+           
Sbjct: 31  ERADGVMITLKDGRRLIDGMSSWWAALHGYNHPRLNAAATNQLAKMSHIMFGGFTHEPAV 90

Query: 72  QSTQQ--EIFANHLIHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEG 129
           +  Q+  EI    L      +++FF +SG+ +VE A+K A +Y    G+  + +  T   
Sbjct: 91  ELAQKLLEILPPSL------NKIFFADSGSVAVEVAMKMALQYQQAKGEVQRTKFATIRS 144

Query: 130 AFHGRTLATISAGGKLQYLEGF------------GPKIEGFDQA-KFCDLQSLKN---QI 173
            +HG T   +S    +  + G              P I+ F +      ++ L++   Q 
Sbjct: 145 GYHGDTWHAMSVCDPVTGMHGLFNHSLPVQYFLPQPSIK-FGEEWNDEAIEPLQDLLEQK 203

Query: 174 SNDTAAILIEPI-QGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYE 232
            ++ AA+++EP+ QG GG+      +L + R++CD    LLIFDE+ TG+GRTGKLFA E
Sbjct: 204 GDEIAALILEPVVQGAGGMYFYSPTYLVKARELCDQYGVLLIFDEIATGFGRTGKLFALE 263

Query: 233 WANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGS-----HGSTYGGNVLAMVLGE 286
            A V PDIM I K + GG+  + A + T  +A  +  G      HG T+  N LA  +  
Sbjct: 264 HAGVVPDIMCIGKALTGGYLTLSATITTEAIAQTICSGEAKCFMHGPTFMANPLACAIAA 323

Query: 287 KVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP---AL 343
           + + ++    + +N+  I   L + L A    F ++  EVR  G  IG+  +  P   A 
Sbjct: 324 ESIRLLLESPWQQNIQRIEAQLKQEL-APAAEFDSV-AEVRVLG-AIGVVEMKEPVNMAT 380

Query: 344 LAAKFRDECLLTAPSSDNVVRILPPLTITAEEI 376
           L  +F +  +   P    +V I+PP  I+ +E+
Sbjct: 381 LQPRFVEHGIWVRPFG-KLVYIMPPFIISPDEL 412


>gnl|CDD|181189 PRK07986, PRK07986, adenosylmethionine--8-amino-7-oxononanoate
           transaminase; Validated.
          Length = 428

 Score =  146 bits (371), Expect = 9e-36
 Identities = 111/361 (30%), Positives = 177/361 (49%), Gaps = 37/361 (10%)

Query: 47  GHSHPELVAILKSQSEKLWHVSNLYQS-TQQEIFA--NHLIHSTFA--DRVFFTNSGAES 101
           G++HP+L A +KSQ + + HV  ++   T          L+  T    + VF  +SG+ +
Sbjct: 58  GYNHPQLNAAMKSQIDAMSHV--MFGGITHPPAIELCRKLVAMTPQPLECVFLADSGSVA 115

Query: 102 VECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISA---GGKLQYL-EGFGPK--- 154
           VE A+K A +Y    G+  + R +T    +HG T   +S       +  L +G+ P+   
Sbjct: 116 VEVAMKMALQYWQAKGEPRQ-RFLTLRHGYHGDTFGAMSVCDPDNSMHSLYKGYLPENLF 174

Query: 155 ----IEGFDQA----KFCDLQSLKNQISNDTAAILIEPI-QGEGGVRKVPEEFLQQLRKI 205
                  FD             L     ++ AA+++EPI QG GG+R    E+L+++RK+
Sbjct: 175 APAPQSRFDGEWDERDIAPFARLMAAHRHEIAAVILEPIVQGAGGMRIYHPEWLKRVRKL 234

Query: 206 CDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAA 264
           CD    LLI DE+ TG+GRTGKLFA E A + PDI+ + K + GG   + A L T EVA 
Sbjct: 235 CDREGILLIADEIATGFGRTGKLFACEHAGIAPDILCLGKALTGGTMTLSATLTTREVAE 294

Query: 265 CMNQGS-----HGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRF 319
            ++ G      HG T+ GN LA  +    L++++S  + + V  I   L E L  +++  
Sbjct: 295 TISNGEAGCFMHGPTFMGNPLACAVANASLSLLESGDWQQQVAAIEAQLREELAPLRDA- 353

Query: 320 PNMFLEVRGQGLLIGLKTVFSP---ALLAAKFRDECLLTAPSSDNVVRILPPLTITAEEI 376
             M  +VR  G  IG+     P   A L   F ++ +   P    ++ ++PP  I  E++
Sbjct: 354 -PMVADVRVLG-AIGVVETTRPVNMAALQRFFVEQGVWIRPFG-KLIYLMPPYIILPEQL 410

Query: 377 H 377
            
Sbjct: 411 Q 411


>gnl|CDD|181545 PRK08742, PRK08742, adenosylmethionine--8-amino-7-oxononanoate
           transaminase; Provisional.
          Length = 472

 Score =  143 bits (362), Expect = 7e-35
 Identities = 115/410 (28%), Positives = 184/410 (44%), Gaps = 58/410 (14%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNL-YQSTQQEI 78
           +G+GAWL   +G  +LD  S    N  GH+ P + A + +Q+ +L  V    +       
Sbjct: 52  RGEGAWLVGHDGRRYLDAVSSWWTNLFGHAEPRIGAAIAAQAGELEQVMLAGFTHEPAVQ 111

Query: 79  FANHLIHSTFADR---------VFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEG 129
            A  L+    A R         VF+ ++G+  VE A+K A  Y +  G+  + R +  E 
Sbjct: 112 LAEQLL--AIAPRQDGRAPLSKVFYADNGSAGVEVALKMAFHYFHNRGEHRRTRFIALEN 169

Query: 130 AFHGRTLATISAGGKLQY--------LEG-FGPKIEGF------------DQAKFCDLQS 168
            +HG T+  ++ G    Y        LE  F P  + +             QA    LQ+
Sbjct: 170 GYHGETIGALAVGDIPLYRRVYAPLLLESLFAPSPDAYLAEPGQSAEDYALQAADA-LQA 228

Query: 169 LKNQISNDTAAILIEP-IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGK 227
           L  Q   +  A+++EP +Q  GG+R     +L++ R++CD   A LI DE+ TG+GRTG 
Sbjct: 229 LFEQSPGEICALILEPRLQCAGGMRMHHPAYLRRARELCDAHGAFLIADEIATGFGRTGT 288

Query: 228 LFAYEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGS------HGSTYGGNVL 280
           LFA E A V PD++ ++KG+ GGF P+ A LAT ++       S      H  +Y GN L
Sbjct: 289 LFACEQAGVMPDLLCLSKGLTGGFLPLSAVLATQQLYDAFLDDSRERAFLHSHSYTGNPL 348

Query: 281 AMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL----- 335
           A       L+I   D  +      A  + + L A     P++  +VR  G+++       
Sbjct: 349 ACAAALATLDIFADDDVIARNQPTAARMTQ-LAAQIGEHPHV-ADVRQAGMVVAFELTRG 406

Query: 336 ---KTVFSPALLAA--KFR---DECLLTAPSSDNVVRILPPLTITAEEIH 377
              +T F PA       +R      ++  P  D V+  +PP  +   ++ 
Sbjct: 407 GNKRTPFPPAARVGLHAYRAALARGVVLRPLGD-VLYWMPPYCVDEAQLA 455


>gnl|CDD|171472 PRK12403, PRK12403, putative aminotransferase; Provisional.
          Length = 460

 Score =  141 bits (357), Expect = 3e-34
 Identities = 104/348 (29%), Positives = 173/348 (49%), Gaps = 33/348 (9%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEIF 79
           +G+G  L+  +G  +LD  SG+   +LG+   +L A    Q E+L + +  + +T   + 
Sbjct: 42  RGEGLHLWDNDGKRYLDGMSGLWCTNLGYGRKDLAAAAARQMEQLPYYNMFFHTTHPAVI 101

Query: 80  A-NHLIHSTFADR---VFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRT 135
             + L+ S          +TNSG+E+ E  I+T RRY  + GK  K  ++     +HG T
Sbjct: 102 ELSELLFSLLPGHYSHAIYTNSGSEANEVLIRTVRRYWQVLGKPQKKIMIGRWNGYHGST 161

Query: 136 LATISAGGK--LQYLEGFGPKIEGFDQ------------AKF---CDLQSLKNQI----S 174
           LA  + GG   +  + G  P +   D+            A+F     LQ L+ +I    +
Sbjct: 162 LAATALGGMKFMHEMGGLIPDVAHIDEPYWYANGGELTPAEFGRRAALQ-LEEKILELGA 220

Query: 175 NDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWA 234
            + A  + EP QG GG+   PE +  ++++IC   D LL  DEV  G+GRTG+ FA+E  
Sbjct: 221 ENVAGFVAEPFQGAGGMIFPPESYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFAHEHF 280

Query: 235 NVKPDIMTIAKGMGGGF-PIGACLATNEVA-ACMNQG---SHGSTYGGNVLAMVLGEKVL 289
             +PD ++IAKG+  G+ P+G  + +  +A A + QG   +HG TY G+ +A  +    L
Sbjct: 281 GFEPDTLSIAKGLTSGYVPMGGLVLSKRIAEALVEQGGVFAHGLTYSGHPVAAAVAIANL 340

Query: 290 NIIQSDGFLENVIN-IAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLK 336
             ++ +G +  V +     L   L  +    P +  EV+G GL+  L+
Sbjct: 341 KALRDEGVVTRVKDDTGPYLQRCLREVFGDHP-LVGEVQGAGLVAALQ 387


>gnl|CDD|180427 PRK06149, PRK06149, hypothetical protein; Provisional.
          Length = 972

 Score =  137 bits (348), Expect = 4e-33
 Identities = 112/410 (27%), Positives = 179/410 (43%), Gaps = 76/410 (18%)

Query: 17  RFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQ 76
           + E+G    LF   G  +LD  + + V  LGH HP L A    Q   L   S  + +   
Sbjct: 570 QIERGWRHHLFDMAGRSYLDMVNNVTV--LGHGHPRLAAAAARQWSLLNTNSRFHYAAVA 627

Query: 77  EIFANHLIHSTFA----DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFH 132
           E F+  L  +  A    D VF  NSG+E+ + AI+ A      +G+ +   +V+   A+H
Sbjct: 628 E-FSERL--AALAPDGLDTVFLVNSGSEANDLAIRLAWAA---SGRRD---VVSVLEAYH 678

Query: 133 GRTLAT--IS--------------------------------AGGKLQYLEGFGPKIEGF 158
           G T+AT  +S                                A     Y+     ++E  
Sbjct: 679 GWTVATDAVSTSIADNPQALETRPDWVHPVESPNTYRGRFRGADSAADYVRDVVAQLEEL 738

Query: 159 DQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEV 218
           D +     + L        A  + EP+ G  G   +P  +LQQ+         + I DEV
Sbjct: 739 DASG----RGL--------AGFICEPVYGNAGGIALPPGYLQQVYAAVRARGGVCIADEV 786

Query: 219 QTGYGRTGKLF-AYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACM-NQGSHGSTYG 276
           Q GYGR G  F  +E   V PDI+T+AKGMG G P+GA +   E+A  +  +G   S+ G
Sbjct: 787 QVGYGRLGHYFWGFEQQGVVPDIITMAKGMGNGHPLGAVITRREIAEALEAEGYFFSSTG 846

Query: 277 GNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLK 336
           G+ ++  +G  VL++++ +   EN   +   L   L A+ +R P +   V G GL +G++
Sbjct: 847 GSPVSCRIGMAVLDVLREEKLQENARRVGDHLKARLEALADRHP-LIGAVHGMGLYLGVE 905

Query: 337 TVFSP----------ALLAAKFRDECLLTAPSSD--NVVRILPPLTITAE 374
            V             A +  +  +  ++  P+ D  N+++I PPL +  E
Sbjct: 906 LVRDRQTLEPATEETAAICDRLLELGVIMQPTGDHLNILKIKPPLCLDRE 955


>gnl|CDD|129782 TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotransferase,
           eukaryotic type.  Alternate names include GABA
           transaminase, gamma-amino-N-butyrate transaminase, and
           beta-alanine--oxoglutarate aminotransferase.
          Length = 464

 Score =  126 bits (318), Expect = 1e-29
 Identities = 102/425 (24%), Positives = 173/425 (40%), Gaps = 63/425 (14%)

Query: 18  FEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVS-----NLYQ 72
           +EK +G +L   +G   LD  S I+   +G+++P L+   +S       ++     N   
Sbjct: 44  YEKSRGNYLVDVDGNRLLDLYSQISSIPIGYNNPALLKAAQSPEMATTLINRPALGNFPS 103

Query: 73  STQQEIFANHLIHST--FADRVFFTNSGAESVECAIKTARRYH------YMAGKTNK--- 121
               +I    ++       D+V+   SG+++ E A K A  Y+      Y A  + +   
Sbjct: 104 KDWAKILKEGILKVAPKGQDQVWTGMSGSDANELAFKAAFMYYRSKQRGYQADFSEEENE 163

Query: 122 ------------FRIVTFEGAFHGRTLATISAG--------------------GKLQY-L 148
                         I++F+GAFHGR   ++S                        L+Y L
Sbjct: 164 SCMDNQAPGSPDLSILSFKGAFHGRLFGSLSTTRSKPIHKLDIPAFDWPQAPFPSLKYPL 223

Query: 149 EGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICDD 208
           E    +    +Q    +++ L  +     AAI++EPIQ EGG      +F ++LR I   
Sbjct: 224 EEHVKENAKEEQRCLEEVEDLIKKWHKPVAAIIVEPIQSEGGDNHASPDFFRKLRDITKK 283

Query: 209 IDALLIFDEVQTGYGRTGKLFAYEWANVK--PDIMTIAKGM--GGGFPIGACLATNEVAA 264
            +   I DEVQTG G TGK +A+E  N+   PD++T +K     G F        N+   
Sbjct: 284 HNVAFIVDEVQTGVGATGKFWAHEHWNLDDPPDMVTFSKKFQTAGYFFHDPAFRPNKPYR 343

Query: 265 CMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFL 324
             N      T+ G+    ++  +++  I+    LENV ++   L+ GL  ++ ++P    
Sbjct: 344 QFN------TWMGDPSRALILREIIQEIKRKDLLENVAHVGDYLYTGLEDLQKKYPEFIQ 397

Query: 325 EVR--GQGLLIGLKTVFSPA--LLAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGL 380
            +R  G+G  I   T        L  K R+  +         +R+ P L          L
Sbjct: 398 NLRGKGRGTFIAWDTPDEAKRDKLLKKARNNGVNIGGCGVKAIRLRPMLVFQKHHADIFL 457

Query: 381 ERIER 385
           E I +
Sbjct: 458 EIISK 462


>gnl|CDD|183493 PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase;
           Provisional.
          Length = 428

 Score =  124 bits (314), Expect = 3e-29
 Identities = 95/324 (29%), Positives = 152/324 (46%), Gaps = 55/324 (16%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQS-TQQE 77
           E+GKGA+ +  +G  ++D+ +       GH+HP +   +   +E       LY + T+ E
Sbjct: 40  ERGKGAYFYDVDGNKYIDYLAAYGPIITGHAHPHITKAITEAAEN----GVLYGTPTELE 95

Query: 78  I-FANHL---IHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHG 133
           I FA  L   I S   ++V F NSG E+V   I+ AR Y      T + +I+ F G +HG
Sbjct: 96  IEFAKMLKEAIPSL--EKVRFVNSGTEAVMTTIRVARAY------TGRTKIIKFAGCYHG 147

Query: 134 RT-LATISAGGKLQYLEGFGPKIEGF-DQA-------------KFCDLQSLKNQIS---N 175
            + L  ++AG         GP   G  D A              F D+++LK  +    +
Sbjct: 148 HSDLVLVAAGS--------GPSTLGTPDSAGVPKSIAQEVITVPFNDIEALKEALDKWGD 199

Query: 176 DTAAILIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTG----YGRTGKLFAY 231
           + AA+L+EPI G  G+ +    FL+ + ++  +  AL+I+DEV T     YG    L   
Sbjct: 200 EVAAVLVEPIVGNFGIVEPKPGFLEAVNELAHEAGALVIYDEVITAFRFMYGGAQDLL-- 257

Query: 232 EWANVKPDIMTIAKGMGGGFPIGACLATNEV---AACMNQGSHGSTYGGNVLAMVLGEKV 288
               V+PD+  + K +GGG PIGA     ++    A +       T  GN  +M  G   
Sbjct: 258 ---GVEPDLTALGKIIGGGLPIGAYGGRKDIMEQVAPLGPAYQAGTMAGNPASMAAGIAC 314

Query: 289 LNIIQSDGFLENVINIAKILFEGL 312
           L ++Q +G  E +  +  +L EG+
Sbjct: 315 LEVLQQEGVYEKLDRLGAMLEEGI 338


>gnl|CDD|180767 PRK06943, PRK06943, adenosylmethionine--8-amino-7-oxononanoate
           transaminase; Provisional.
          Length = 453

 Score =  122 bits (307), Expect = 2e-28
 Identities = 101/396 (25%), Positives = 160/396 (40%), Gaps = 43/396 (10%)

Query: 20  KGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI- 78
           +G+GAWL+  +G  +LD  S   VN  GH++P + A LK Q + L H   L   T +   
Sbjct: 42  RGEGAWLYDRDGRRYLDAISSWWVNLFGHANPRINAALKDQLDTLEHAM-LAGCTHEPAI 100

Query: 79  -FANHLIHST--FADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRT 135
             A  L   T       FF + GA +VE A+K +       G+ +K   V     +HG T
Sbjct: 101 ELAERLAALTGGTLGHAFFASDGASAVEIALKMSFHAWRNRGRGDKREFVCLANGYHGET 160

Query: 136 LATISAGGKLQYLEGFGPKI---------------EGFDQAK-----FCDLQSLKNQISN 175
           +  +       + + + P I                G   A        D++ L  + + 
Sbjct: 161 IGALGVTDVALFKDAYDPLIRHAHVVASPDARGARPGETAADVAARALADVRRLFAERAG 220

Query: 176 DTAAILIEP-IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWA 234
             AA+++EP +Q   G+      +L+ LR +CD     LI DE+  G GRTG  FA E A
Sbjct: 221 KIAALIVEPLVQCAAGMAMHDPSYLRGLRALCDRYGVHLIADEIAVGCGRTGTFFACEQA 280

Query: 235 NVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGS------HGSTYGGNVLAMVLGEK 287
            V PD + ++KG+ GG+ P+   L+ + + A            H  +Y GN LA      
Sbjct: 281 GVWPDFLCLSKGISGGYLPLSLVLSRDAIFAAFYDDDVTRGFLHSHSYTGNPLACRAALA 340

Query: 288 VLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGLKTVFSP---ALL 344
            L++   D  L      +  L   L  +          +R +G +               
Sbjct: 341 TLDLFAEDDVLARNARKSARLRAALAPLAAHPQ--VRHLRQRGTIFAFDVALDGDAARTF 398

Query: 345 AAKF----RDECLLTAPSSDNVVRILPPLTITAEEI 376
           + +F     +  LL  P     V ++PP  +  +EI
Sbjct: 399 SRRFFEAALERELLLRPIG-TTVYLMPPYVLDDDEI 433


>gnl|CDD|178100 PLN02482, PLN02482, glutamate-1-semialdehyde 2,1-aminomutase.
          Length = 474

 Score =  113 bits (285), Expect = 8e-26
 Identities = 94/316 (29%), Positives = 151/316 (47%), Gaps = 29/316 (9%)

Query: 16  IRFEKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQ 75
           I F++ KG++ +  +G  ++D+        +GH+  E++A L    +K    S       
Sbjct: 83  IVFDRVKGSYAWDVDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKK--GTSFGAPCLL 140

Query: 76  QEIFANHLIHSTFA-DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGR 134
           + + A  +I +  + + V F NSG E+    ++ AR Y      T + +I+ FEG +HG 
Sbjct: 141 ENVLAEMVIDAVPSVEMVRFVNSGTEACMGVLRLARAY------TGREKIIKFEGCYHGH 194

Query: 135 TLA-TISAGGKLQYL---EGFG-PKIEGFDQ--AKFCDLQSLKNQISN---DTAAILIEP 184
             +  + AG  +  L   +  G PK        A + DL+++K        + AA+++EP
Sbjct: 195 ADSFLVKAGSGVATLGLPDSPGVPKAATSATLTAPYNDLEAVKKLFEANKGEIAAVILEP 254

Query: 185 IQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA 244
           + G  G     +EFL+ LR+I  +  ALL+FDEV TG+ R     A E+  + PD+ T+ 
Sbjct: 255 VVGNSGFIVPKKEFLEGLREITKENGALLVFDEVMTGF-RIAYGGAQEYFGITPDLTTLG 313

Query: 245 KGMGGGFPIGACLATNEV------AACMNQGSHGSTYGGNVLAMVLGEKVLNIIQSDGFL 298
           K +GGG P+GA     E+      A  M Q     T  GN LAM  G   L  +Q  G  
Sbjct: 314 KVIGGGLPVGAYGGRREIMEMVAPAGPMYQ---AGTLSGNPLAMTAGIHTLKRLQQPGTY 370

Query: 299 ENVINIAKILFEGLTA 314
           E +  I K L +G+  
Sbjct: 371 EYLDKITKKLIQGILE 386


>gnl|CDD|180995 PRK07482, PRK07482, hypothetical protein; Provisional.
          Length = 461

 Score =  113 bits (284), Expect = 1e-25
 Identities = 105/414 (25%), Positives = 178/414 (42%), Gaps = 61/414 (14%)

Query: 19  EKGKGAWLFSENGIPFLD-FASGIAVNSLGHSHPELVAILKSQSEKL--WHVSNLYQSTQ 75
           E G+G  +    G  ++D FA    VN +G+   E+   +  Q+++L  +H + +   T+
Sbjct: 37  EGGEGIRITDAQGRRYIDAFAGLYCVN-VGYGRTEVAEAIAEQAKELAYYH-TYVGHGTE 94

Query: 76  QEI-FANHLIHSTFA--DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFH 132
             I  +  +I    A   +V++  SG+++ E  IK    Y+ + G+  K +I++    +H
Sbjct: 95  ASITLSKRIIDRAPAGMSKVYYGLSGSDANETQIKLVWYYNNVLGRPEKKKIISRWRGYH 154

Query: 133 GRTLATISAGGKLQYLEGFGPKIEG---------------------FDQAKFCDLQSLKN 171
           G  + T S  G   + + F   I                       F      +L+ L  
Sbjct: 155 GSGVVTGSLTGLSLFHQHFDLPIARVLHTEAPHYYRRADAGMSEEQFSAYCADELEELIL 214

Query: 172 QISNDTAAILI-EPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFA 230
               DT A  I EP+ G GG+   P  +   ++ +    D LLI DEV TG+GR G +F 
Sbjct: 215 AEGPDTIAAFIAEPVLGTGGIVPPPAGYWPAIQAVLKKYDILLIADEVVTGFGRLGSMFG 274

Query: 231 YEWANVKPDIMTIAKGMGGGF-PIGACLATNEVAACMNQGS-------HGSTYGGNVLAM 282
            +   ++PD++T+AKG+   + P+   +   +V   + QGS       HG TY G+ +  
Sbjct: 275 SDHYGIEPDLITVAKGLTSAYAPLSGSIVGEKVWDVLEQGSDEHGAIGHGWTYSGHPICA 334

Query: 283 VLGEKVLNIIQSDGFLENVINIAKILFEGLTAIKNRFPNMFLEVRGQGLLIGL------- 335
                 L+I++ +  + N   +       L A     P +  EVRG G+L  +       
Sbjct: 335 AAALANLDILERENLVGNAAEVGAYFRARLRAAFGDHPLVG-EVRGVGMLAAVEFVADRD 393

Query: 336 -KTVFSPAL-----LAAKFRDECLL--TAPSSDNVVRIL---PPLTITAEEIHE 378
            +T F PAL     ++A   +  ++    P  D    IL   PPL +T  E  E
Sbjct: 394 DRTPFDPALKIGPQVSAAALERGVIARAMPHGD----ILGFAPPLVLTRAEADE 443


>gnl|CDD|134334 PRK00615, PRK00615, glutamate-1-semialdehyde aminotransferase;
           Provisional.
          Length = 433

 Score = 86.0 bits (213), Expect = 1e-17
 Identities = 78/297 (26%), Positives = 123/297 (41%), Gaps = 30/297 (10%)

Query: 31  GIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI-FANHLIHS-TF 88
           G  F+DF         GHSHP+   I  +  +     ++   +++QEI FA  L      
Sbjct: 52  GKTFIDFCGSWGSLIHGHSHPK---ICDAIQQGAERGTSYGLTSEQEILFAEELFSYLGL 108

Query: 89  AD-RVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGK--- 144
            D ++ F +SG E+   A++ AR      G T +  I+ F G +HG   A     G    
Sbjct: 109 EDHKIRFVSSGTEATMTAVRLAR------GITGRSIIIKFLGCYHGH--ADTLLQGISFS 160

Query: 145 ------LQYLEGFGPKIEGFDQAKFCDLQSLK---NQISNDTAAILIEPIQGEGGVRKVP 195
                 L +L              + D Q  +   N + +  A ++ EPI    GV    
Sbjct: 161 ETSLDTLTHLVDTDLAHPLTLSLPYNDFQIFQTVMNSLGHRVAGVIFEPICANMGVVLPK 220

Query: 196 EEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGA 255
             F++ + + C    +L I DEV TG+ R  +  A    +VKPDI    K +GGG P  A
Sbjct: 221 PGFIEGIIQTCRRTGSLSIMDEVVTGF-RVAQGGAAAIYHVKPDITVYGKILGGGLPAAA 279

Query: 256 CLATNEVAA-CMNQGS--HGSTYGGNVLAMVLGEKVLNIIQSDGFLENVINIAKILF 309
            +A   +      +G+     T  GN LAM  G+  +N+ +  GF   +  + +   
Sbjct: 280 VVAHKSIMDHLAPEGTIFQAGTLSGNPLAMAAGKASINLCREQGFYTQLSTLEQNFL 336


>gnl|CDD|180471 PRK06209, PRK06209, glutamate-1-semialdehyde 2,1-aminomutase;
           Provisional.
          Length = 431

 Score = 81.6 bits (202), Expect = 3e-16
 Identities = 57/252 (22%), Positives = 108/252 (42%), Gaps = 40/252 (15%)

Query: 19  EKGKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLWHVSNLYQSTQQEI 78
           ++G GA ++  +G  ++++  G+    LGH++P +V  ++     L    N  + +  E+
Sbjct: 35  QRGSGAHVWDVDGNEYIEYGMGLRAVGLGHAYPPVVEAVREA---LQDGCNFTRPSAIEL 91

Query: 79  FANHLIHSTF--ADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIV--------TFE 128
            A          AD V F  +G+++   A++ AR Y      T +  +         + +
Sbjct: 92  DAAESFLELIDGADMVKFCKNGSDATSAAVRLARAY------TGRDLVARCADHPFFSTD 145

Query: 129 GAFHGRTLATISAGGKLQYLEGFGPK--IEGFDQAKFCDLQSLKNQIS---NDTAAILIE 183
             F G T   +SAG          P          ++ D+ SL+          A +++E
Sbjct: 146 DWFIGTT--PMSAGI---------PASVSALTVTFRYNDIASLEALFEDHPGRIACVILE 194

Query: 184 PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTI 243
           P   +    +  + FL ++R++C +  AL I DE+ TG+ R     A +   + PD+   
Sbjct: 195 PATAD----EPQDGFLHEVRRLCHENGALFILDEMITGF-RWHMRGAQKLYGIVPDLSCF 249

Query: 244 AKGMGGGFPIGA 255
            K +G GF + A
Sbjct: 250 GKALGNGFAVSA 261


>gnl|CDD|178557 PLN02974, PLN02974, adenosylmethionine-8-amino-7-oxononanoate
           transaminase.
          Length = 817

 Score = 70.9 bits (174), Expect = 6e-13
 Identities = 68/248 (27%), Positives = 100/248 (40%), Gaps = 76/248 (30%)

Query: 89  ADRVFFTNSGAESVECAIKTARRYHYM-------------AGKTNKFRIVTFEGAFHGRT 135
           A RVFF+++G+ ++E A+K A R   +              G   + +++  +G++HG T
Sbjct: 427 ASRVFFSDNGSTAIEVALKMAFRKFIVDHGFLENSGNEKRGGDLIELKVLALDGSYHGDT 486

Query: 136 LATISA------GGKLQ---------YL-----------------EGFGPKIEG------ 157
           L  + A       G LQ         +L                 EGF   +EG      
Sbjct: 487 LGAMEAQAPSVFTGFLQQPWYSGRGLFLDPPTVGMRNGRWNISLPEGFSSGLEGEETTWE 546

Query: 158 -----FDQAKFCDLQSLKNQIS----------------NDTAAILIEP-IQGEGGVRKVP 195
                FD+ +  D   L                        AA++IEP + G GG+  + 
Sbjct: 547 SRDEVFDKTR--DSTPLAKAYRSYIEQQLDEYEASAKNGHIAALIIEPVLHGAGGMLLID 604

Query: 196 EEFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIAKGMGGGF-PIG 254
             F + L ++C      +IFDEV TG  R G   A+E    KPDI   AK + GG  P+ 
Sbjct: 605 PLFQRALVQVCRSRKIPVIFDEVFTGLWRLGVESAWELLGCKPDIACYAKLLTGGLVPLA 664

Query: 255 ACLATNEV 262
           A LAT EV
Sbjct: 665 ATLATEEV 672


>gnl|CDD|180807 PRK07046, PRK07046, aminotransferase; Validated.
          Length = 453

 Score = 60.0 bits (146), Expect = 1e-09
 Identities = 49/193 (25%), Positives = 74/193 (38%), Gaps = 44/193 (22%)

Query: 119 TNKFRIVTFEGAFHG------------RTLATISAGGKLQYLEGFGPKIEGFDQAKFCDL 166
           T + +I+ F G +HG            R +      G++  L      +E      F DL
Sbjct: 154 TGRPKILVFNGCYHGTVDDVFVDLVDGRPVQRPGLLGQVHDLTATTRVVE------FNDL 207

Query: 167 QSLKNQI-SNDTAAILIEPIQGEGGVRKVPEE-FLQQLRKICDDIDALLIFDEVQT---- 220
            +L+  +   D AA+L EP     G+  +PE  F + LR++      LL+ DE  T    
Sbjct: 208 AALEAALADGDVAAVLAEPAMTNIGM-VLPEPGFHEALRELTRRYGTLLVIDETHTISSG 266

Query: 221 --GYGRTGKLFAYEWANVKPDIMTIAKGMGGGFPIGACLATNEVAACMNQGSH------- 271
             GY R   L        +PD + + K + GG P      + E+A               
Sbjct: 267 PGGYTRAHGL--------EPDFLVVGKPIAGGVPCAVYGFSAELAERAQAAKASAPPGHS 318

Query: 272 --GSTYGGNVLAM 282
             G+T   N LAM
Sbjct: 319 GIGTTLSANALAM 331


>gnl|CDD|163191 TIGR03235, DNA_S_dndA, cysteine desulfurase DndA.  This model
           describes DndA, a protein related to IscS and part of a
           larger family of cysteine desulfurases. It is encoded,
           typically, divergently from a conserved, sparsely
           distributed operon for sulfur modification of DNA. This
           modification system is designated dnd, after the
           phenotype of DNA degradation during electrophoresis. The
           system is sporadically distributed in bacteria, much
           like some restriction enzyme operons. DndB is described
           as a putative ATPase.
          Length = 353

 Score = 34.4 bits (79), Expect = 0.054
 Identities = 31/120 (25%), Positives = 46/120 (38%), Gaps = 19/120 (15%)

Query: 90  DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATISAGGKLQYLE 149
           + V FT+   ES   AI    R     GK +   I+T     H   L  I      + LE
Sbjct: 60  EEVIFTSGATESNNLAILGLARAGEQKGKKH---IIT-SAIEHPAVLEPI------RALE 109

Query: 150 --GFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICD 207
             GF       D++   D+  L + I  DT  + I  +  E G        +Q +R+I +
Sbjct: 110 RNGFTVTYLPVDESGRIDVDELADAIRPDTLLVSIMHVNNETGS-------IQPIREIAE 162


>gnl|CDD|131061 TIGR02006, IscS, cysteine desulfurase IscS.  This model represents
           IscS, one of several cysteine desulfurases from a larger
           protein family designated (misleadingly, in this case)
           class V aminotransferases. IscS is one of at least 6
           enzymes characteristic of the IscSUA-hscAB-fsx system of
           iron-sulfur cluster assembly. Scoring almost as well as
           proteobacterial sequences included in the model are
           mitochondrial cysteine desulfurases, apparently from an
           analogous system in eukaryotes. The sulfur, taken from
           cysteine, may be used in other systems as well, such as
           tRNA base modification and biosynthesis of other
           cofactors.
          Length = 402

 Score = 32.9 bits (75), Expect = 0.16
 Identities = 43/169 (25%), Positives = 67/169 (39%), Gaps = 33/169 (19%)

Query: 92  VFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVTFEGAFHGRTLATI----SAGGKLQY 147
           + FT+   ES   AIK    ++   G      I+T +   H   L T       G ++ Y
Sbjct: 67  IVFTSGATESNNLAIKGIAHFYKSKGN----HIITSKTE-HKAVLDTCRYLEREGFEVTY 121

Query: 148 LEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKICD 207
           L    PK  G       DL+ LK  I +DT  + I  +  E GV +     +  + +IC 
Sbjct: 122 LP---PKSNGL-----IDLEELKAAIRDDTILVSIMHVNNEIGVIQD----IAAIGEICR 169

Query: 208 DIDALLIFDEVQTGYGRTGKLFAYEWANVKPDIMTIA-------KGMGG 249
           +       D  Q+     GK+       +K D+M+I+       KG+G 
Sbjct: 170 ERKVFFHVDAAQS----VGKI-PINVNELKVDLMSISGHKIYGPKGIGA 213


>gnl|CDD|132443 TIGR03402, FeS_nifS, cysteine desulfurase NifS.  Members of this
           protein family are NifS, one of several related families
           of cysteine desulfurase involved in iron-sulfur (FeS)
           cluster biosynthesis. NifS is part of the NIF system,
           usually associated with other nif genes involved in
           nitrogenase expression and nitrogen fixation. The
           protein family is given a fairly broad interpretation
           here. It includes a clade nearly always found in
           extended nitrogen fixation genomic regions, plus a
           second clade more closely related to the first than to
           IscS and also part of NifS-like/NifU-like systems. This
           model does not extend to a more distantly clade found in
           the epsilon proteobacteria such as Helicobacter pylori,
           also named NifS in the literature, built instead in
           TIGR03403.
          Length = 379

 Score = 32.2 bits (74), Expect = 0.23
 Identities = 39/135 (28%), Positives = 56/135 (41%), Gaps = 22/135 (16%)

Query: 90  DRVFFTNSGAESVECAIKTARRYHYMAGKTNKFRIVT--FEGAFHGRTLATISAGGKLQY 147
           D + FT+ G ES   AIK+A           K  I+T   E   H   L+        Q+
Sbjct: 60  DEIIFTSGGTESDNTAIKSALAAQ-----PEKRHIITTAVE---HPAVLSL------CQH 105

Query: 148 LEGFGPKIE--GFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKVPEEFLQQLRKI 205
           LE  G K+     D+    DL+ L+  I++DTA + +     E G     EE    + +I
Sbjct: 106 LEKQGYKVTYLPVDEEGRLDLEELRAAITDDTALVSVMWANNETGTIFPIEE----IGEI 161

Query: 206 CDDIDALLIFDEVQT 220
             +  AL   D VQ 
Sbjct: 162 AKERGALFHTDAVQA 176


>gnl|CDD|180734 PRK06855, PRK06855, aminotransferase; Validated.
          Length = 433

 Score = 31.5 bits (72), Expect = 0.44
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 5/57 (8%)

Query: 165 DLQSLKNQI-SNDT-AAIL-IEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEV 218
           DL  L+N++  N + A IL I P    G V   P+E L+++  I  + D  +I DE+
Sbjct: 158 DLDDLENKVKYNPSIAGILLINPDNPTGAV--YPKEILREIVDIAREYDLFIICDEI 212


>gnl|CDD|131361 TIGR02308, RNA_lig_T4_1, RNA ligase, T4 RnlA family.  Members of
           this family are phage proteins with ATP-dependent RNA
           ligase activity. Host defense to phage may include
           cleavage and inactivation of specific tRNA molecules;
           members of this family act to reverse this RNA damage.
           The enzyme is adenylated, transiently, on a Lys residue
           in a motif KXDGSL.
          Length = 374

 Score = 30.6 bits (69), Expect = 0.67
 Identities = 14/64 (21%), Positives = 26/64 (40%), Gaps = 7/64 (10%)

Query: 197 EFLQQLRKICDDIDALLIFDEVQTGYGRTGKLFAYEWAN----VKPDIMT---IAKGMGG 249
           E    L  +C D      + +  T  G   ++F+Y +A+    + PD +    I   + G
Sbjct: 2   ELFNNLMNLCKDSQRKFFYKDDVTAMGTKYRIFSYNYASYSDWLLPDALECRGIMFEIDG 61

Query: 250 GFPI 253
             P+
Sbjct: 62  EKPV 65


>gnl|CDD|180537 PRK06348, PRK06348, aspartate aminotransferase; Provisional.
          Length = 384

 Score = 30.5 bits (69), Expect = 0.74
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 9/83 (10%)

Query: 141 AGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIE-PIQGEGGVRKVPEEFL 199
            GGK   LE +  + +GF      +++ L+  I++ T AI++  P    G V    +E L
Sbjct: 133 VGGKPIILETY--EEDGFQ----INVKKLEALITSKTKAIILNSPNNPTGAVFS--KETL 184

Query: 200 QQLRKICDDIDALLIFDEVQTGY 222
           +++ KI  + D  +I DEV  G+
Sbjct: 185 EEIAKIAIEYDLFIISDEVYDGF 207


>gnl|CDD|180929 PRK07324, PRK07324, transaminase; Validated.
          Length = 373

 Score = 29.9 bits (68), Expect = 1.1
 Identities = 15/65 (23%), Positives = 28/65 (43%), Gaps = 3/65 (4%)

Query: 165 DLQSLKNQISNDTAAILIE-PIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDEVQTGYG 223
           DL  L+  +  +T  I I       G +  +   +L+++ +I   +DA ++ DEV     
Sbjct: 142 DLDELRRLVRPNTKLICINNANNPTGAL--MDRAYLEEIVEIARSVDAYVLSDEVYRPLD 199

Query: 224 RTGKL 228
             G  
Sbjct: 200 EDGST 204


>gnl|CDD|178402 PLN02805, PLN02805, D-lactate dehydrogenase [cytochrome].
          Length = 555

 Score = 29.6 bits (66), Expect = 1.5
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 13/83 (15%)

Query: 135 TLATISAGGKLQYLEGFGPKIEGFDQAKFCDLQSLKNQISNDTAAILIEPIQGEGGVRKV 194
            LA  ++ G L YL    P +        CD   L +++    +   +  ++GE   + V
Sbjct: 47  PLAIAASAGSLAYLNQSNPSL--------CDSSDLDSRVGGKGSTEFV--VKGEH--KLV 94

Query: 195 PEEFLQQLRKICDDIDALLIFDE 217
           P+E + +L+ I  D +  L +DE
Sbjct: 95  PQELIDELKAILQD-NMTLDYDE 116


>gnl|CDD|180385 PRK06075, PRK06075, NADH dehydrogenase subunit D; Validated.
          Length = 392

 Score = 28.6 bits (65), Expect = 2.8
 Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 8/34 (23%)

Query: 189 GGVRK-VPEEFLQQLRKIC-------DDIDALLI 214
           GGVR+ +P+  L+ +R          DD + LL 
Sbjct: 157 GGVRRDLPDGLLEDIRDFLDYFPKRLDDYETLLT 190


>gnl|CDD|179178 PRK00950, PRK00950, histidinol-phosphate aminotransferase;
           Validated.
          Length = 361

 Score = 28.7 bits (65), Expect = 2.8
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 6/54 (11%)

Query: 165 DLQSLKNQISNDTAAI-LIEPIQGEGGVRKVPEEFLQQLRKICDDIDALLIFDE 217
           D+ S+ N I+  T  I L  P    G +  +PEE    +RKI +  DAL+  DE
Sbjct: 147 DVDSVLNAITEKTKVIFLCTPNNPTGNL--IPEE---DIRKILESTDALVFVDE 195


>gnl|CDD|184897 PRK14904, PRK14904, 16S rRNA methyltransferase B; Provisional.
          Length = 445

 Score = 28.5 bits (64), Expect = 3.4
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 344 LAAKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIKLSH 392
           LA K++ E +  A   + V+R + P TI+ +E  +G+   ER ++  SH
Sbjct: 105 LARKYKGEHM--AKLVNGVLRNISPETISLDEWLKGMPEAERLSLLYSH 151


>gnl|CDD|119086 pfam10566, Glyco_hydro_97, Glycoside hydrolase 97.  This is the
           97th family of glycosidases, in this case bacterial. The
           central part of the GH97 family protein sequences
           represents a typical and complete (beta/alpha)8-barrel
           or catalytic TIM-barrel type domain. The N- and
           C-terminal parts of the sequences, mainly consisting of
           beta-strands, most probably form two additional
           non-catalytic domains with as yet unknown functions. The
           non-catalytic domains of glycosidases from the
           alpha-galactosidase and alpha-glucosidase superfamilies
           are also predominantly composed of beta-strands, and at
           least some of these domains are involved in
           oligomerisation and carbohydrate binding. In all known
           glycosidases with the (beta-alpha)8-barrel fold, the
           amino acid residues at the active site are located on
           the C-termini of the beta-strands.
          Length = 643

 Score = 28.2 bits (63), Expect = 3.7
 Identities = 23/133 (17%), Positives = 41/133 (30%), Gaps = 31/133 (23%)

Query: 28  SENGIPFLDFASGIAVNSLGHSH-----------PELVAILKSQSEK--LWHVSNLYQST 74
           + NG+ ++    G      G +             EL+A  KS+     LW       + 
Sbjct: 320 ARNGLEYISLDEGWYTPDGGKNSDMTKVISELDLQELIAYGKSKGVGIILWTNQKALYAQ 379

Query: 75  QQEIFANHL------IHSTFADRVFFTNSGAESVECAIKTARRYHYMAGKTNKFR----- 123
             E F  +           F DR          V  A++ A +Y  +     +++     
Sbjct: 380 LDEAFKLYEKWGVVGFKVDFLDRD--DQEMVRWVYEALEKAAKYKLLVDFHGEYKPTGLS 437

Query: 124 -----IVTFEGAF 131
                ++T EG  
Sbjct: 438 RTYPNLLTQEGVR 450


>gnl|CDD|180171 PRK05627, PRK05627, bifunctional riboflavin kinase/FMN
           adenylyltransferase; Reviewed.
          Length = 305

 Score = 27.4 bits (62), Expect = 5.8
 Identities = 9/21 (42%), Positives = 11/21 (52%)

Query: 159 DQAKFCDLQSLKNQISNDTAA 179
           D+ KF  L  LK QI+ D   
Sbjct: 278 DEQKFDSLDELKAQIAKDIET 298


>gnl|CDD|178555 PLN02972, PLN02972, Histidyl-tRNA synthetase.
          Length = 763

 Score = 27.5 bits (61), Expect = 5.8
 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 125 VTFEGAFHGRTLATISAGGKLQYLEG-FGPK 154
           V +E  F G  + +I+AGG+   L G F  K
Sbjct: 605 VIYEAVFKGAQVGSIAAGGRYDNLVGMFSGK 635


>gnl|CDD|132354 TIGR03311, Se_dep_Molyb_1, selenium-dependent molybdenum
           hydroxylase 1.  Members of this protein family show full
           length homology to the molybdenum-containing aldehyde
           oxido-reductase of Desulfovibrio gigas. Members,
           however, are found only within species that have, and
           near those genes that encode, a set of predicted
           accessory proteins for selenium-dependent molybdenum
           hydroxylases. The best known examples of such enzymes
           are forms of xanthine dehydrogenase and purine
           hydroxylase; this family appears to be another such
           enzyme.
          Length = 848

 Score = 27.5 bits (61), Expect = 6.7
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 8/55 (14%)

Query: 342 ALLAAKFRDECLLTAPSSDNVVRI----LPPLTITAEEIHEGLERIERTAIKLSH 392
           AL+AAK ++        + N++++    LPPLT   E + EG   I      LS 
Sbjct: 259 ALVAAKSKEA----LREALNLIKVDYEELPPLTSPEEALAEGAPAIHPKGNILSE 309


>gnl|CDD|181231 PRK08114, PRK08114, cystathionine beta-lyase; Provisional.
          Length = 395

 Score = 27.4 bits (61), Expect = 6.7
 Identities = 24/85 (28%), Positives = 34/85 (40%), Gaps = 29/85 (34%)

Query: 213 LIFDEVQTG-------------YGRTGKL--FAYEWANVKPDIMTIAKGMGGG---FPIG 254
           L+FD V+               YGR G L  F+ +      + M   +G G G   +P G
Sbjct: 34  LVFDSVEAKKHATRNRANGELFYGRRGTLTHFSLQ------EAMCELEG-GAGCALYPCG 86

Query: 255 ACLATNEVAACMNQGSH----GSTY 275
           A    N + A + QG H    G+ Y
Sbjct: 87  AAAVANAILAFVEQGDHVLMTGTAY 111


>gnl|CDD|130881 TIGR01822, 2am3keto_CoA, 2-amino-3-ketobutyrate coenzyme A ligase. 
           This model represents a narrowly defined clade of animal
           and bacterial (almost exclusively Proteobacterial)
           2-amino-3-ketobutyrate--CoA ligase. This enzyme can act
           in threonine catabolism. The closest homolog from
           Bacillus subtilis, and sequences like it, may be
           functionally equivalent but were not included in the
           model because of difficulty in finding reports of
           function.
          Length = 393

 Score = 27.1 bits (60), Expect = 7.5
 Identities = 32/108 (29%), Positives = 52/108 (48%), Gaps = 10/108 (9%)

Query: 199 LQQLRKICDDIDALLIFDEVQ-TGY-GRTGKLFAYEWANV--KPDIM--TIAKGMGGGFP 252
           L ++  + D  DAL++ DE   TG+ G TG+    E   V  + DI+  T+ K +GG   
Sbjct: 189 LDEICDLADKYDALVMVDECHATGFLGPTGRGSH-ELCGVMGRVDIITGTLGKALGGASG 247

Query: 253 IGACLATNEVAACMNQGSHGSTYGGNVLAMVLGE--KVLNIIQSDGFL 298
            G   A  EV   + Q S    +  ++   V+G   KVL ++++   L
Sbjct: 248 -GFTTARKEVVELLRQRSRPYLFSNSLPPAVVGASIKVLEMLEASNEL 294


>gnl|CDD|132408 TIGR03365, Bsubt_queE, 7-cyano-7-deazaguanosine (preQ0)
           biosynthesis protein QueE.  This uncharacterized enzyme,
           designated QueE, participates in the biosynthesis, from
           GTP, of 7-cyano-7-deazaguanosine, also called preQ0
           because in many species it is a precursor of queuosine.
           In most Archaea, it is instead the precursor of a
           different tRNA modified base, archaeosine.
          Length = 238

 Score = 27.3 bits (61), Expect = 7.6
 Identities = 7/14 (50%), Positives = 13/14 (92%)

Query: 326 VRGQGLLIGLKTVF 339
           ++G+G++IG KT+F
Sbjct: 13  IQGEGMVIGQKTMF 26


>gnl|CDD|162238 TIGR01176, fum_red_Fp, fumarate reductase, flavoprotein subunit.
           The terms succinate dehydrogenase and fumarate reductase
           may be used interchangeably in certain systems. However,
           a number of species have distinct complexes, with the
           fumarate reductase active under anaerobic conditions.
           This model represents the fumarate reductase
           flavoprotein subunit from several such species in which
           a distinct succinate dehydrogenase is also found. Not
           all bona fide fumarate reductases will be found by this
           model.
          Length = 580

 Score = 27.2 bits (60), Expect = 8.5
 Identities = 13/44 (29%), Positives = 19/44 (43%)

Query: 346 AKFRDECLLTAPSSDNVVRILPPLTITAEEIHEGLERIERTAIK 389
           A  R E   T  S   + R  P +  T +++ E  ER +R  I 
Sbjct: 448 ADIRAEMGATMESGCGIYRDGPLMQKTIDKLAELQERFKRAGID 491


>gnl|CDD|162702 TIGR02099, TIGR02099, conserved hypothetical protein TIGR02099.
           This model describes a family of long proteins, over
           1250 amino acids in length and present in the
           Proteobacteria. The degree of sequence similarity is low
           between sequences from different genera. Apparent
           membrane-spanning regions at the N-terminus and
           C-terminus suggest the protein is inserted into (or
           exported through) the membrane.
          Length = 1260

 Score = 27.0 bits (60), Expect = 8.8
 Identities = 10/45 (22%), Positives = 17/45 (37%)

Query: 21  GKGAWLFSENGIPFLDFASGIAVNSLGHSHPELVAILKSQSEKLW 65
           G     F  +  P++D  +GIA     ++   L   L  +    W
Sbjct: 471 GAFRLRFPGDAAPWMDLRAGIADGDAPYAWRYLPRSLMGEELADW 515


>gnl|CDD|149481 pfam08434, CLCA_N, Calcium-activated chloride channel.  The CLCA
           family of calcium-activated chloride channels has been
           identified in many epithelial and endothelial cell types
           as well as in smooth muscle cells and has four or five
           putative transmembrane regions. Additionally to their
           role as chloride channels some CLCA proteins function as
           adhesion molecules and may also have roles as tumour
           suppressors. The domain described here is found at the
           N-terminus of CLCAs.
          Length = 262

 Score = 27.0 bits (60), Expect = 9.6
 Identities = 7/19 (36%), Positives = 13/19 (68%)

Query: 219 QTGYGRTGKLFAYEWANVK 237
              YG  G++F +EWA+++
Sbjct: 143 LAEYGPRGRVFVHEWAHLR 161


  Database: CddB
    Posted date:  Feb 4, 2011  9:54 PM
  Number of letters in database: 5,994,473
  Number of sequences in database:  21,608
  
Lambda     K      H
   0.321    0.138    0.405 

Gapped
Lambda     K      H
   0.267   0.0772    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21608
Number of Hits to DB: 6,404,096
Number of extensions: 419372
Number of successful extensions: 1250
Number of sequences better than 10.0: 1
Number of HSP's gapped: 964
Number of HSP's successfully gapped: 130
Length of query: 392
Length of database: 5,994,473
Length adjustment: 95
Effective length of query: 297
Effective length of database: 3,941,713
Effective search space: 1170688761
Effective search space used: 1170688761
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 58 (26.0 bits)