HHsearch alignment for GI: 254780434 and conserved domain: PRK02615

>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional.
Probab=97.03  E-value=0.021  Score=36.05  Aligned_cols=65  Identities=22%  Similarity=0.270  Sum_probs=48.8

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC-CCHHHHHHHHHHHHHHHHH
Q ss_conf             4246899999997408974899967889999999999839997545278770-6978999999999999998
Q gi|254780434|r  270 FLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY-EGISLPKRIIQGLSDFLNK  340 (362)
Q Consensus       270 ~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~-~Gp~~~~~I~~~L~~~l~~  340 (362)
T Consensus       277 ~p~Gl~~l~~~~~~~--~iPvvAIGGI~~-~N~~~v~~aGa~gvAVisAI~~A~DP~~a---a~~ll~~l~~  342 (345)
T PRK02615        277 APAGLEYLKYARKEA--NIPWFAIGGIDK-SNISEVLQAGADRVAVVRAIMNAEDPKQA---TQELLEQLSR  342 (345)
T ss_pred             CCCCHHHHHHHHHHC--CCCEEEECCCCH-HHHHHHHHCCCCEEEEEHHHHCCCCHHHH---HHHHHHHHHC
T ss_conf             878999999999837--999999999699-99999998599999982285579999999---9999999730