Query         gi|254780434|ref|YP_003064847.1| dihydroorotate dehydrogenase 2 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 362
No_of_seqs    154 out of 2362
Neff          6.7 
Searched_HMMs 39220
Date          Sun May 29 18:31:00 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780434.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR01036 pyrD_sub2 dihydrooro 100.0       0       0  773.3  23.7  349    6-354     1-369 (370)
  2 PRK05286 dihydroorotate dehydr 100.0       0       0  711.2  28.0  330    4-338     1-336 (336)
  3 cd04738 DHOD_2_like Dihydrooro 100.0       0       0  695.0  26.4  321   10-334     1-327 (327)
  4 KOG1436 consensus              100.0       0       0  637.3  22.1  347    5-353    42-397 (398)
  5 COG0167 PyrD Dihydroorotate de 100.0       0       0  606.8  25.3  300   44-355     1-309 (310)
  6 TIGR01037 pyrD_sub1_fam dihydr 100.0       0       0  579.8  18.8  292   45-354     1-308 (308)
  7 PRK07259 dihydroorotate dehydr 100.0       0       0  564.7  25.7  291   44-355     1-301 (301)
  8 PRK02506 dihydroorotate dehydr 100.0       0       0  560.7  25.2  295   44-352     1-304 (308)
  9 cd04740 DHOD_1B_like Dihydroor 100.0       0       0  552.6  24.2  287   46-353     1-296 (296)
 10 cd04741 DHOD_1A_like Dihydroor 100.0       0       0  515.9  23.2  278   47-337     1-293 (294)
 11 PRK08318 dihydropyrimidine deh 100.0       0       0  509.2  27.2  298   43-357     2-323 (413)
 12 pfam01180 DHO_dh Dihydroorotat 100.0       0       0  503.6  21.8  277   45-338     2-290 (290)
 13 cd02810 DHOD_DHPD_FMN Dihydroo 100.0       0       0  501.6  22.9  273   47-333     1-289 (289)
 14 cd02940 DHPD_FMN Dihydropyrimi 100.0       0       0  497.2  21.2  274   44-334     1-299 (299)
 15 cd04739 DHOD_like Dihydroorota 100.0       0       0  482.4  25.2  295   44-356     1-306 (325)
 16 PRK07565 dihydroorotate dehydr 100.0       0       0  471.7  26.3  292   44-354     2-306 (333)
 17 KOG1799 consensus              100.0 1.4E-45       0  327.3  10.2  315   33-358    91-427 (471)
 18 PRK10415 tRNA-dihydrouridine s  99.8 2.1E-16 5.4E-21  130.4  20.1  228   48-334     2-241 (321)
 19 cd02811 IDI-2_FMN Isopentenyl-  99.8 3.5E-16   9E-21  128.8  19.4  263   39-350    36-325 (326)
 20 pfam01070 FMN_dh FMN-dependent  99.8 5.9E-15 1.5E-19  120.6  25.1  259   18-352    18-297 (301)
 21 cd02809 alpha_hydroxyacid_oxid  99.8 5.2E-15 1.3E-19  121.0  24.3  256   17-350    24-298 (299)
 22 TIGR00737 nifR3_yhdG putative   99.7   2E-16 5.2E-21  130.5  15.0  234   49-334     1-255 (336)
 23 cd02922 FCB2_FMN Flavocytochro  99.7 4.5E-14 1.2E-18  114.6  26.4  289   19-350    26-342 (344)
 24 PRK05437 isopentenyl pyrophosp  99.7 2.4E-15 6.2E-20  123.2  18.7  259   39-354    44-336 (351)
 25 cd04737 LOX_like_FMN L-Lactate  99.7 2.8E-13 7.2E-18  109.3  25.4  287   19-351    34-348 (351)
 26 cd03332 LMO_FMN L-Lactate 2-mo  99.7 5.9E-13 1.5E-17  107.1  26.0  290   19-350    47-379 (383)
 27 PRK11197 lldD L-lactate dehydr  99.7 2.5E-13 6.2E-18  109.7  23.7  294   19-350    32-371 (381)
 28 COG0042 tRNA-dihydrouridine sy  99.7 4.4E-14 1.1E-18  114.8  18.9  226   48-330     3-241 (323)
 29 cd02801 DUS_like_FMN Dihydrour  99.7 1.5E-14 3.8E-19  117.9  16.1  176  124-334    45-230 (231)
 30 TIGR02151 IPP_isom_2 isopenten  99.7 4.7E-15 1.2E-19  121.3  13.5  262   39-354    40-345 (349)
 31 pfam01207 Dus Dihydrouridine s  99.6 3.6E-14 9.1E-19  115.3  17.1  176  123-332    43-228 (309)
 32 PRK11815 tRNA-dihydrouridine s  99.6 7.4E-14 1.9E-18  113.2  15.9  179  127-334    58-250 (333)
 33 PRK10550 tRNA-dihydrouridine s  99.6 1.3E-13 3.3E-18  111.5  17.1  170  131-331    60-238 (312)
 34 cd04736 MDH_FMN Mandelate dehy  99.6   3E-11 7.5E-16   95.7  25.8  291   19-350    26-360 (361)
 35 cd02803 OYE_like_FMN_family Ol  99.5 1.2E-11   3E-16   98.4  19.6  258   46-333     3-327 (327)
 36 cd02932 OYE_YqiM_FMN Old yello  99.5 6.9E-12 1.8E-16   99.9  18.1  257   46-332     4-335 (336)
 37 PRK13523 NADPH dehydrogenase N  99.5 8.9E-12 2.3E-16   99.2  17.8  258   46-338     6-326 (337)
 38 COG1304 idi Isopentenyl diphos  99.5 7.9E-12   2E-16   99.5  16.8  270   35-354    44-348 (360)
 39 cd04733 OYE_like_2_FMN Old yel  99.5 2.1E-11 5.3E-16   96.7  18.3  263   46-333     4-338 (338)
 40 cd02911 arch_FMN Archeal FMN-b  99.5 3.1E-12 7.9E-17  102.3  14.0  215   57-323     1-227 (233)
 41 cd04734 OYE_like_3_FMN Old yel  99.5   3E-11 7.7E-16   95.6  18.6  261   46-333     4-331 (343)
 42 cd02930 DCR_FMN 2,4-dienoyl-Co  99.5 2.2E-11 5.7E-16   96.5  17.9  263   46-333     4-322 (353)
 43 cd04735 OYE_like_4_FMN Old yel  99.4 5.8E-11 1.5E-15   93.7  17.7  259   46-334     4-330 (353)
 44 pfam00724 Oxidored_FMN NADH:fl  99.4 1.1E-10 2.8E-15   91.8  18.7  266   46-333     5-332 (336)
 45 KOG2335 consensus               99.4 3.2E-11 8.3E-16   95.4  15.1  190  131-351    71-277 (358)
 46 cd02931 ER_like_FMN Enoate red  99.4 2.2E-10 5.5E-15   89.9  18.8  262   46-334     4-352 (382)
 47 KOG0538 consensus               99.4 5.8E-10 1.5E-14   86.9  21.0  296   18-352    29-351 (363)
 48 COG1902 NemA NADH:flavin oxido  99.3 8.4E-10 2.1E-14   85.9  19.9  260   46-336     9-337 (363)
 49 cd04722 TIM_phosphate_binding   99.3 1.8E-10 4.6E-15   90.4  15.3  189   65-317    12-200 (200)
 50 cd02929 TMADH_HD_FMN Trimethyl  99.3 5.7E-10 1.4E-14   87.0  17.1  259   46-333    11-335 (370)
 51 TIGR03315 Se_ygfK putative sel  99.3 3.9E-10 9.9E-15   88.1  15.8  291   34-339    30-397 (1012)
 52 cd02933 OYE_like_FMN Old yello  99.3 1.6E-09 4.1E-14   84.0  18.2  250   46-334     5-331 (338)
 53 TIGR02708 L_lactate_ox L-lacta  99.3 9.7E-10 2.5E-14   85.5  16.8  284   23-356    46-361 (368)
 54 pfam03060 NPD 2-nitropropane d  99.2 2.5E-10 6.5E-15   89.4  12.3   90  210-322   138-227 (330)
 55 PRK09853 putative selenate red  99.2 5.3E-09 1.4E-13   80.5  18.4  290   35-339    32-410 (1032)
 56 cd00381 IMPDH IMPDH: The catal  99.2 3.4E-08 8.6E-13   75.1  20.9  243   39-353    17-320 (325)
 57 cd04730 NPD_like 2-Nitropropan  99.2 4.2E-09 1.1E-13   81.2  15.9  185   55-322     2-191 (236)
 58 TIGR03151 enACPred_II putative  99.1 3.8E-09 9.7E-14   81.4  14.4  186   48-322     6-196 (307)
 59 cd04747 OYE_like_5_FMN Old yel  99.1 1.1E-08 2.8E-13   78.3  16.2  254   46-333     4-344 (361)
 60 PRK08255 salicylyl-CoA 5-hydro  99.1 1.2E-06 3.2E-11   64.5  25.3  254   46-331   407-736 (770)
 61 PRK10605 N-ethylmaleimide redu  99.1 7.8E-08   2E-12   72.6  18.5  160  148-334   156-338 (362)
 62 pfam00478 IMPDH IMP dehydrogen  99.1 1.6E-07 4.2E-12   70.4  20.0  128  159-320   231-359 (467)
 63 KOG2333 consensus               99.0 2.9E-08 7.3E-13   75.5  13.4  202  127-358   313-527 (614)
 64 COG0069 GltB Glutamate synthas  98.9 6.5E-08 1.6E-12   73.2  12.6  180  149-355   258-479 (485)
 65 cd02808 GltS_FMN Glutamate syn  98.8   2E-07 5.1E-12   69.9  13.5  169  154-349   174-384 (392)
 66 COG2070 Dioxygenases related t  98.8 6.3E-08 1.6E-12   73.2  10.4   90  210-321   128-218 (336)
 67 pfam01645 Glu_synthase Conserv  98.8 1.9E-07 4.9E-12   70.0  12.8  147  149-322   157-308 (367)
 68 PRK13597 imidazole glycerol ph  98.8 3.8E-07 9.7E-12   68.0  13.8  226   50-344    20-248 (252)
 69 PRK05458 guanosine 5'-monophos  98.8 4.4E-06 1.1E-10   60.8  18.7  242   38-350    20-309 (326)
 70 PRK06843 inositol-5-monophosph  98.7 1.5E-06 3.8E-11   64.0  15.7  235   40-319    26-288 (404)
 71 PRK05567 inositol-5'-monophosp  98.7   5E-06 1.3E-10   60.4  18.2  128  159-319   236-363 (486)
 72 PTZ00314 inosine-5'-monophosph  98.7 8.7E-06 2.2E-10   58.8  19.2  160  160-352   247-465 (499)
 73 TIGR00736 nifR3_rel_arch TIM-b  98.7 1.5E-07 3.9E-12   70.6   9.8  218   62-321     2-228 (234)
 74 PRK05096 guanosine 5'-monophos  98.7 2.3E-05 5.9E-10   56.0  20.6  243   39-352    25-330 (347)
 75 PRK03220 consensus              98.7 1.2E-06 2.9E-11   64.7  13.4  226   50-344    20-255 (257)
 76 cd04743 NPD_PKS 2-Nitropropane  98.7 1.4E-06 3.7E-11   64.1  13.4  155  119-322    38-208 (320)
 77 PRK08649 inositol-5-monophosph  98.7 1.7E-06 4.4E-11   63.5  13.7  269   40-350    31-360 (368)
 78 PRK02083 imidazole glycerol ph  98.6 1.9E-06 4.7E-11   63.3  13.7  225   50-344    19-250 (253)
 79 PRK13129 consensus              98.6 1.7E-05 4.4E-10   56.8  18.0  228   60-339    25-266 (267)
 80 PRK13115 consensus              98.6 1.4E-05 3.5E-10   57.5  17.0  220   66-340    39-266 (269)
 81 PRK02145 consensus              98.6 2.9E-06 7.5E-11   62.0  13.0  226   50-344    20-254 (257)
 82 PRK13125 trpA tryptophan synth  98.6 5.2E-06 1.3E-10   60.3  14.2  229   60-342    11-247 (247)
 83 PRK13117 consensus              98.6 1.6E-05 4.2E-10   57.0  16.7  210   60-321    23-239 (268)
 84 PRK02621 consensus              98.6 5.5E-06 1.4E-10   60.1  14.3  225   51-344    20-251 (254)
 85 PRK01659 consensus              98.6 3.9E-06   1E-10   61.1  13.1  225   51-344    20-250 (252)
 86 PRK00830 consensus              98.5 3.4E-06 8.6E-11   61.6  12.7  227   49-344    22-270 (273)
 87 PRK01033 imidazole glycerol ph  98.5 1.5E-06 3.8E-11   64.0  10.7  198   68-325    33-235 (253)
 88 PRK04281 consensus              98.5 8.8E-06 2.2E-10   58.8  14.1  226   50-344    19-251 (254)
 89 cd04731 HisF The cyclase subun  98.5 6.3E-06 1.6E-10   59.8  13.3  176  123-340    62-242 (243)
 90 PRK02747 consensus              98.5 6.4E-06 1.6E-10   59.7  13.3  226   50-344    19-253 (257)
 91 CHL00200 trpA tryptophan synth  98.5 4.8E-05 1.2E-09   53.8  17.4  210   60-321    21-236 (263)
 92 PRK05211 consensus              98.5 6.2E-06 1.6E-10   59.8  12.8  227   49-344     9-245 (248)
 93 PRK13137 consensus              98.5 4.5E-05 1.1E-09   54.0  17.0   62  274-339   201-265 (266)
 94 cd04728 ThiG Thiazole synthase  98.5 6.2E-05 1.6E-09   53.1  17.6  210   48-325     2-214 (248)
 95 PRK13127 consensus              98.5 2.5E-05 6.3E-10   55.7  15.5  210   60-321    17-232 (262)
 96 PRK13126 consensus              98.5 1.7E-05 4.3E-10   56.9  14.5  108  211-342   126-237 (237)
 97 PRK13118 consensus              98.5 3.4E-05 8.8E-10   54.8  16.0  227   60-339    23-265 (269)
 98 PRK13585 1-(5-phosphoribosyl)-  98.5 6.9E-06 1.8E-10   59.5  12.3  166  134-335    74-239 (240)
 99 PRK13139 consensus              98.5 4.1E-05 1.1E-09   54.2  16.3  208   61-321    23-236 (254)
100 PRK13119 consensus              98.4 5.5E-05 1.4E-09   53.4  16.4  225   60-337    21-259 (261)
101 PRK13135 consensus              98.4 9.8E-05 2.5E-09   51.7  17.2  205   60-321    23-237 (267)
102 PRK13116 consensus              98.4 4.2E-05 1.1E-09   54.2  15.2  207   61-321    24-240 (278)
103 PRK13113 consensus              98.4 0.00013 3.4E-09   50.8  17.7  223   60-336    23-258 (263)
104 pfam00977 His_biosynth Histidi  98.4 1.3E-05 3.4E-10   57.5  12.4  164  122-323    63-226 (229)
105 pfam05690 ThiG Thiazole biosyn  98.4 0.00011 2.8E-09   51.4  17.1  210   48-325     1-213 (246)
106 PRK13122 consensus              98.4 4.1E-05 1.1E-09   54.2  14.5  225   57-338     7-240 (242)
107 PRK13123 consensus              98.4 9.9E-05 2.5E-09   51.7  16.3  208   61-321    22-233 (256)
108 pfam00290 Trp_syntA Tryptophan  98.4 7.3E-05 1.9E-09   52.6  15.6  210   60-321    15-230 (258)
109 PRK00208 thiG thiazole synthas  98.3 0.00021 5.4E-09   49.5  17.2  212   47-325     2-215 (256)
110 PRK00507 deoxyribose-phosphate  98.3 2.2E-05 5.5E-10   56.1  12.0   86  217-328   130-215 (221)
111 PRK13121 consensus              98.3 0.00023 5.9E-09   49.2  17.0  208   61-321    24-238 (265)
112 TIGR00742 yjbN TIM-barrel prot  98.3 8.3E-06 2.1E-10   58.9   9.3  201  127-358    48-270 (326)
113 PRK13120 consensus              98.3 0.00028 7.1E-09   48.7  16.9  209   60-321    27-242 (285)
114 PRK13111 trpA tryptophan synth  98.2 0.00022 5.5E-09   49.4  15.9  209   60-321    15-229 (256)
115 PRK13134 consensus              98.2 0.00024   6E-09   49.1  15.9  204   61-321    26-239 (257)
116 PRK13138 consensus              98.2 0.00017 4.4E-09   50.1  15.1  207   60-321    19-236 (264)
117 PRK00748 1-(5-phosphoribosyl)-  98.2 6.7E-05 1.7E-09   52.8  13.0  173  122-334    63-238 (241)
118 CHL00162 thiG thiamin biosynth  98.2 0.00058 1.5E-08   46.5  17.7  215   46-325     7-228 (267)
119 cd04732 HisA HisA.  Phosphorib  98.2 2.9E-05 7.3E-10   55.3  11.0  138  160-327    92-229 (234)
120 PRK11840 bifunctional sulfur c  98.2 0.00049 1.2E-08   47.0  17.2  215   44-325    73-289 (327)
121 PRK13132 consensus              98.2 0.00019 4.9E-09   49.8  14.9  210   57-321    15-228 (246)
122 cd04724 Tryptophan_synthase_al  98.2 0.00026 6.7E-09   48.8  15.5  209   60-321     6-220 (242)
123 PRK13587 1-(5-phosphoribosyl)-  98.2 7.9E-05   2E-09   52.3  12.5  162  123-324    67-228 (234)
124 TIGR00007 TIGR00007 phosphorib  98.2 3.2E-05 8.1E-10   55.0  10.4  138  158-324    90-235 (241)
125 TIGR03572 WbuZ glycosyl amidat  98.2 5.5E-05 1.4E-09   53.4  11.4  208   50-321    19-232 (232)
126 cd00959 DeoC 2-deoxyribose-5-p  98.2 7.5E-05 1.9E-09   52.5  12.1   82  212-314   117-201 (203)
127 PRK07807 inositol-5-monophosph  98.1 7.6E-05   2E-09   52.4  11.9  128  159-319   235-362 (479)
128 PRK13114 consensus              98.1 0.00013 3.3E-09   50.9  12.8  210   60-321    19-234 (266)
129 PRK13133 consensus              98.1  0.0005 1.3E-08   46.9  15.5  213   60-321    21-244 (267)
130 COG0274 DeoC Deoxyribose-phosp  98.1 5.8E-05 1.5E-09   53.3  10.5   86  212-318   126-214 (228)
131 PRK11750 gltB glutamate syntha  98.1 5.9E-05 1.5E-09   53.2  10.6  182  149-353   950-1168(1483)
132 COG0107 HisF Imidazoleglycerol  98.1 6.4E-05 1.6E-09   53.0  10.6  228   46-344    15-252 (256)
133 PRK13140 consensus              98.1 0.00081 2.1E-08   45.5  15.8  211   60-321    20-236 (257)
134 PRK13124 consensus              98.1   0.001 2.5E-08   44.9  16.1  208   60-321    15-228 (257)
135 cd04729 NanE N-acetylmannosami  98.1   9E-05 2.3E-09   52.0  10.7  128  160-328    89-216 (219)
136 COG0159 TrpA Tryptophan syntha  98.1 0.00037 9.4E-09   47.8  13.8  204   65-321    31-238 (265)
137 PRK13136 consensus              98.0  0.0013 3.4E-08   44.1  16.1  208   60-321    18-231 (253)
138 COG0134 TrpC Indole-3-glycerol  98.0 0.00067 1.7E-08   46.1  14.6  101  220-322   140-242 (254)
139 cd02812 PcrB_like PcrB_like pr  98.0   8E-05   2E-09   52.3   9.8   89  218-331   130-218 (219)
140 PRK01130 N-acetylmannosamine-6  98.0 0.00032 8.1E-09   48.3  12.2  135  160-334    85-220 (222)
141 TIGR01768 GGGP-family geranylg  98.0 7.7E-05   2E-09   52.4   9.0   78  254-332   160-239 (242)
142 pfam04481 DUF561 Protein of un  97.9  0.0013 3.3E-08   44.1  14.8  176  132-339    60-238 (243)
143 TIGR01304 IMP_DH_rel_2 IMP deh  97.9 0.00062 1.6E-08   46.3  13.1   51  271-321   239-294 (376)
144 pfam01791 DeoC DeoC/LacD famil  97.9 0.00038 9.6E-09   47.8  11.8   91  207-318   121-225 (231)
145 PRK13131 consensus              97.9 0.00052 1.3E-08   46.8  12.2  226   60-339    17-253 (257)
146 COG0106 HisA Phosphoribosylfor  97.9  0.0013 3.4E-08   44.0  14.2   84  223-327   147-231 (241)
147 PRK13586 1-(5-phosphoribosyl)-  97.9 0.00074 1.9E-08   45.8  12.9  193   68-324    32-224 (231)
148 cd00945 Aldolase_Class_I Class  97.9  0.0016 4.1E-08   43.5  14.4   85  210-315   114-200 (201)
149 PRK13112 consensus              97.8  0.0003 7.6E-09   48.4  10.1  208   61-321    25-239 (279)
150 PRK07107 inositol-5-monophosph  97.8  0.0038 9.7E-08   41.0  15.6   35  285-319   350-384 (497)
151 PRK02747 consensus              97.8 0.00042 1.1E-08   47.5  10.0   88  226-334    33-120 (257)
152 TIGR00735 hisF imidazoleglycer  97.8 0.00013 3.3E-09   50.9   7.4  256   34-344     8-310 (312)
153 PRK09140 2-dehydro-3-deoxy-6-p  97.7 0.00022 5.6E-09   49.3   8.3   62  275-338   139-200 (206)
154 KOG1799 consensus               97.7 3.2E-06 8.3E-11   61.7  -1.1   29  146-174   184-214 (471)
155 PRK07107 inositol-5-monophosph  97.7 0.00048 1.2E-08   47.1   9.9   82  209-316   231-312 (497)
156 TIGR01302 IMP_dehydrog inosine  97.7  0.0052 1.3E-07   40.1  16.1   44  273-318   330-373 (476)
157 cd04723 HisA_HisF Phosphoribos  97.7 0.00082 2.1E-08   45.5  11.0   83  225-329   148-230 (233)
158 COG0107 HisF Imidazoleglycerol  97.7 0.00075 1.9E-08   45.8  10.4   91  224-335    31-121 (256)
159 PRK04169 geranylgeranylglycery  97.7 0.00012 3.1E-09   51.0   6.4   67  257-328   159-225 (229)
160 PRK02145 consensus              97.7 0.00054 1.4E-08   46.7   9.5   88  226-334    34-121 (257)
161 COG1646 Predicted phosphate-bi  97.7  0.0003 7.6E-09   48.5   8.0   92  220-335   147-238 (240)
162 pfam00218 IGPS Indole-3-glycer  97.7 0.00083 2.1E-08   45.4  10.1  196   48-325    50-248 (254)
163 KOG2334 consensus               97.7 0.00026 6.5E-09   48.9   7.5  160  135-327    83-252 (477)
164 TIGR01302 IMP_dehydrog inosine  97.6  0.0014 3.5E-08   44.0  11.0   81  210-316   228-308 (476)
165 PRK05211 consensus              97.6 0.00096 2.4E-08   45.0  10.1   55  275-332    55-109 (248)
166 PRK02621 consensus              97.6 0.00074 1.9E-08   45.8   9.2   30   57-87     76-105 (254)
167 PRK01659 consensus              97.6 0.00087 2.2E-08   45.3   9.5   89  225-334    32-120 (252)
168 PRK07455 keto-hydroxyglutarate  97.6  0.0036 9.1E-08   41.2  12.6   45  275-321   142-186 (210)
169 pfam03437 BtpA BtpA family. Th  97.6  0.0037 9.5E-08   41.1  12.5  197   69-323    33-234 (254)
170 PRK13597 imidazole glycerol ph  97.5  0.0016   4E-08   43.6  10.3   56  274-332    64-119 (252)
171 PRK06552 keto-hydroxyglutarate  97.5  0.0018 4.7E-08   43.1  10.6   45  274-320   143-187 (209)
172 COG3010 NanE Putative N-acetyl  97.5  0.0047 1.2E-07   40.4  12.6  163  114-325    49-216 (229)
173 PRK04281 consensus              97.5  0.0014 3.5E-08   44.0   9.8   87  226-333    33-119 (254)
174 pfam01081 Aldolase KDPG and KH  97.5  0.0021 5.3E-08   42.8  10.4   59  275-348   137-195 (196)
175 PRK01033 imidazole glycerol ph  97.5  0.0017 4.3E-08   43.4   9.6   30   57-87     76-105 (253)
176 TIGR03572 WbuZ glycosyl amidat  97.5  0.0019 4.9E-08   43.0   9.9   89  225-334    32-120 (232)
177 PRK02083 imidazole glycerol ph  97.5  0.0015 3.8E-08   43.8   9.2   34   55-89     74-107 (253)
178 PRK13586 1-(5-phosphoribosyl)-  97.5  0.0032 8.1E-08   41.5  10.8   87  226-334    32-118 (231)
179 PRK04128 1-(5-phosphoribosyl)-  97.4  0.0048 1.2E-07   40.3  11.3   81  225-331   145-225 (228)
180 PRK00830 consensus              97.4  0.0014 3.6E-08   43.9   8.5   88  226-334    37-124 (273)
181 PRK00748 1-(5-phosphoribosyl)-  97.4  0.0027 6.8E-08   42.0   9.9   87  226-333    32-118 (241)
182 TIGR01304 IMP_DH_rel_2 IMP deh  97.4  0.0026 6.7E-08   42.1   9.8  213   39-342    28-257 (376)
183 cd04731 HisF The cyclase subun  97.4  0.0016   4E-08   43.6   8.5   34   55-89     71-104 (243)
184 pfam01884 PcrB PcrB family. Th  97.4 0.00044 1.1E-08   47.3   5.6   54  271-327   168-221 (231)
185 PRK03220 consensus              97.4  0.0038 9.8E-08   41.0  10.3   33   56-89     76-108 (257)
186 COG2022 ThiG Uncharacterized e  97.3   0.016 4.2E-07   36.7  15.9  213   45-325     6-221 (262)
187 PRK13802 bifunctional indole-3  97.3  0.0023 5.9E-08   42.5   8.9  194   48-323    52-247 (695)
188 PRK13813 orotidine 5'-phosphat  97.2   0.021 5.3E-07   36.0  17.1  201   55-334     3-212 (215)
189 PRK09140 2-dehydro-3-deoxy-6-p  97.2   0.006 1.5E-07   39.7  10.1  137  133-334     9-148 (206)
190 PRK05283 deoxyribose-phosphate  97.2   0.024 6.2E-07   35.6  12.8   80  211-308   132-217 (258)
191 pfam04131 NanE Putative N-acet  97.2  0.0066 1.7E-07   39.4   9.8  129  160-334    61-190 (192)
192 TIGR00007 TIGR00007 phosphorib  97.2  0.0047 1.2E-07   40.4   9.0   90  224-334    29-119 (241)
193 PRK13585 1-(5-phosphoribosyl)-  97.2  0.0069 1.8E-07   39.3   9.8   36   54-90     74-109 (240)
194 PRK08745 ribulose-phosphate 3-  97.1   0.026 6.6E-07   35.4  17.2  206   60-338    11-219 (223)
195 cd00331 IGPS Indole-3-glycerol  97.1  0.0095 2.4E-07   38.3  10.2  192   49-322    14-207 (217)
196 TIGR01306 GMP_reduct_2 guanosi  97.1   0.023 5.8E-07   35.8  12.1  215   39-325    18-238 (321)
197 pfam00977 His_biosynth Histidi  97.1  0.0083 2.1E-07   38.7   9.8   56  274-332    62-117 (229)
198 PRK07695 transcriptional regul  97.1  0.0052 1.3E-07   40.1   8.7   93  225-338   105-201 (202)
199 PRK07114 keto-hydroxyglutarate  97.1    0.03 7.6E-07   35.0  12.9   46  275-321   148-194 (223)
200 PRK06857 consensus              97.1  0.0072 1.8E-07   39.1   9.2   45  275-321   141-185 (209)
201 COG0800 Eda 2-keto-3-deoxy-6-p  97.1  0.0091 2.3E-07   38.4   9.8   63  276-340   143-208 (211)
202 KOG2550 consensus               97.1  0.0077   2E-07   38.9   9.4  127  159-319   259-386 (503)
203 PRK02615 thiamine-phosphate py  97.0   0.021 5.3E-07   36.0  11.3   65  270-340   277-342 (345)
204 TIGR00735 hisF imidazoleglycer  97.0  0.0039 9.9E-08   40.9   7.5   92  224-333    43-145 (312)
205 PRK00230 orotidine 5'-phosphat  97.0   0.034 8.6E-07   34.6  15.1  200   54-336     1-230 (231)
206 COG0329 DapA Dihydrodipicolina  97.0  0.0099 2.5E-07   38.2   9.5  192   64-332    22-223 (299)
207 PRK06512 thiamine-phosphate py  97.0   0.012   3E-07   37.7   9.9   95  226-341   121-215 (221)
208 PRK00278 trpC indole-3-glycero  97.0    0.01 2.6E-07   38.1   9.5  193   48-322    52-246 (261)
209 cd04732 HisA HisA.  Phosphorib  97.0   0.012   3E-07   37.7   9.6   34   55-89     73-106 (234)
210 PRK06843 inositol-5-monophosph  97.0   0.012   3E-07   37.7   9.6   32  320-351   347-380 (404)
211 TIGR00674 dapA dihydrodipicoli  96.9   0.009 2.3E-07   38.5   8.7   51  273-331   164-217 (288)
212 PTZ00314 inosine-5'-monophosph  96.9    0.01 2.6E-07   38.1   9.0   83  208-316   225-307 (499)
213 pfam00478 IMPDH IMP dehydrogen  96.9   0.012   3E-07   37.7   9.1   79  212-316   214-292 (467)
214 PRK08883 ribulose-phosphate 3-  96.9   0.043 1.1E-06   33.9  16.9  210   57-339     4-216 (220)
215 cd00952 CHBPH_aldolase Trans-o  96.9   0.016 4.1E-07   36.7   9.8  113   67-218    31-144 (309)
216 TIGR01163 rpe ribulose-phospha  96.9   0.044 1.1E-06   33.8  12.7  200   57-330     4-212 (216)
217 COG0036 Rpe Pentose-5-phosphat  96.9   0.045 1.1E-06   33.8  16.8  207   56-336     7-215 (220)
218 pfam00701 DHDPS Dihydrodipicol  96.8   0.018 4.6E-07   36.4   9.5  187   68-331    25-218 (289)
219 TIGR01769 GGGP geranylgeranylg  96.8  0.0027 6.8E-08   42.1   5.1   47  265-313   163-209 (212)
220 PRK03620 5-dehydro-4-deoxygluc  96.8    0.02   5E-07   36.2   9.5  176   68-317    25-206 (296)
221 cd00951 KDGDH 5-dehydro-4-deox  96.8   0.019 4.7E-07   36.4   9.3  179   68-318    24-206 (289)
222 PRK09427 bifunctional indole-3  96.8   0.053 1.4E-06   33.3  13.6   48  274-322   198-245 (459)
223 PRK06015 keto-hydroxyglutarate  96.8   0.025 6.3E-07   35.5   9.8   44  275-320   144-187 (212)
224 TIGR03249 KdgD 5-dehydro-4-deo  96.7   0.018 4.5E-07   36.5   8.8  190   68-332    29-223 (296)
225 PRK05567 inositol-5'-monophosp  96.7  0.0087 2.2E-07   38.6   7.3   70  224-316   228-297 (486)
226 PRK00043 thiE thiamine-phospha  96.7   0.045 1.1E-06   33.8  10.8  102  212-339   104-207 (210)
227 PRK08104 consensus              96.7   0.029 7.3E-07   35.1   9.8   44  275-320   144-187 (212)
228 cd00452 KDPG_aldolase KDPG and  96.7   0.053 1.4E-06   33.3  11.1  156   68-319    19-174 (190)
229 PRK06552 keto-hydroxyglutarate  96.7   0.036 9.1E-07   34.5  10.2  132  152-340    26-175 (209)
230 PRK13587 1-(5-phosphoribosyl)-  96.7   0.034 8.5E-07   34.6  10.0   34   56-90     77-110 (234)
231 PRK07028 bifunctional hexulose  96.7   0.065 1.6E-06   32.7  15.3  186   71-334    22-210 (429)
232 PRK08904 consensus              96.6   0.049 1.3E-06   33.5  10.7   44  275-320   139-182 (207)
233 PRK08782 consensus              96.6    0.02 5.2E-07   36.1   8.7   44  275-320   146-189 (219)
234 cd00381 IMPDH IMPDH: The catal  96.6   0.039   1E-06   34.2  10.1   40  274-315   123-162 (325)
235 PRK03170 dihydrodipicolinate s  96.6   0.035   9E-07   34.5   9.8  188   68-332    25-219 (292)
236 PRK05718 keto-hydroxyglutarate  96.6   0.037 9.5E-07   34.3   9.7   43  275-320   144-187 (212)
237 cd04723 HisA_HisF Phosphoribos  96.6    0.03 7.5E-07   35.0   9.2   31   56-87     79-109 (233)
238 cd00950 DHDPS Dihydrodipicolin  96.6   0.037 9.4E-07   34.3   9.7  189   68-332    24-218 (284)
239 PRK07455 keto-hydroxyglutarate  96.6    0.04   1E-06   34.1   9.8  124  151-332    25-149 (210)
240 cd00452 KDPG_aldolase KDPG and  96.6   0.052 1.3E-06   33.3  10.4  133  151-343    16-165 (190)
241 pfam01070 FMN_dh FMN-dependent  96.6   0.049 1.2E-06   33.5  10.2   87  211-316   110-197 (301)
242 pfam01081 Aldolase KDPG and KH  96.5   0.039 9.9E-07   34.2   9.5  123  152-332    21-144 (196)
243 PRK08904 consensus              96.5   0.028 7.3E-07   35.1   8.8  135  151-343    22-173 (207)
244 PRK04147 N-acetylneuraminate l  96.5   0.046 1.2E-06   33.7   9.7  198   55-330    12-219 (294)
245 PRK13306 ulaD 3-keto-L-gulonat  96.5   0.083 2.1E-06   32.0  13.0  167  123-337    46-214 (216)
246 PRK08104 consensus              96.4   0.094 2.4E-06   31.6  12.2  136  150-343    26-178 (212)
247 pfam00834 Ribul_P_3_epim Ribul  96.4   0.095 2.4E-06   31.6  13.3  195   57-324     4-201 (201)
248 cd00429 RPE Ribulose-5-phospha  96.4   0.097 2.5E-06   31.5  15.6  199   59-330     6-207 (211)
249 PRK07114 keto-hydroxyglutarate  96.3   0.047 1.2E-06   33.7   9.1  127  151-332    28-155 (223)
250 PRK06857 consensus              96.3   0.099 2.5E-06   31.5  12.6  145  121-332     3-148 (209)
251 cd02809 alpha_hydroxyacid_oxid  96.3   0.092 2.4E-06   31.7  10.6   84  211-316   117-200 (299)
252 cd00408 DHDPS-like Dihydrodipi  96.3   0.071 1.8E-06   32.4   9.8  189   68-332    21-215 (281)
253 PRK08091 ribulose-phosphate 3-  96.3    0.11 2.8E-06   31.2  14.5  213   57-338    17-234 (235)
254 TIGR01919 hisA-trpF bifunction  96.2   0.033 8.5E-07   34.6   7.6   85  218-322   147-234 (246)
255 PRK04128 1-(5-phosphoribosyl)-  96.2   0.022 5.5E-07   35.9   6.6   35   54-89     72-106 (228)
256 PRK08673 3-deoxy-7-phosphohept  96.1   0.047 1.2E-06   33.6   8.1  229   43-340    78-331 (335)
257 PRK08005 ribulose-phosphate 3-  96.1    0.13 3.4E-06   30.6  15.0  205   56-335     4-208 (210)
258 TIGR01182 eda 2-dehydro-3-deox  96.0   0.054 1.4E-06   33.2   8.1  176   64-334    19-201 (205)
259 COG2876 AroA 3-deoxy-D-arabino  96.0    0.14 3.6E-06   30.4  17.0  227   45-340    31-283 (286)
260 PRK03512 thiamine-phosphate py  96.0    0.12 3.1E-06   30.8   9.7   91  212-325   103-196 (211)
261 cd04742 NPD_FabD 2-Nitropropan  96.0    0.15 3.8E-06   30.3  11.6   51  268-318   198-250 (418)
262 PRK04180 pyridoxine biosynthes  96.0   0.013 3.4E-07   37.3   4.7   73  274-346   192-282 (293)
263 PRK06015 keto-hydroxyglutarate  95.9    0.11 2.8E-06   31.1   9.3  135  151-343    27-178 (212)
264 PRK12330 oxaloacetate decarbox  95.9    0.16 4.1E-06   30.0  13.9  181  126-344    69-258 (499)
265 PTZ00170 D-ribulose-5-phosphat  95.9    0.16 4.2E-06   30.0  17.8  184  103-340    37-220 (224)
266 TIGR03217 4OH_2_O_val_ald 4-hy  95.8    0.17 4.3E-06   29.9  16.2  216   68-345    27-247 (333)
267 COG0106 HisA Phosphoribosylfor  95.8    0.05 1.3E-06   33.4   7.2   34   54-88     74-107 (241)
268 KOG0399 consensus               95.8   0.066 1.7E-06   32.6   7.8   80  282-361  1164-1278(2142)
269 PRK08195 4-hydroxy-2-ketovaler  95.7    0.19 4.9E-06   29.5  16.5  216   68-345    28-248 (337)
270 PRK09722 allulose-6-phosphate   95.6     0.2 5.1E-06   29.4  10.0  186  100-338    29-221 (227)
271 COG0800 Eda 2-keto-3-deoxy-6-p  95.6    0.19   5E-06   29.5   9.5   42  287-330   106-147 (211)
272 PRK05581 ribulose-phosphate 3-  95.6    0.22 5.5E-06   29.2  17.0  207   57-337     8-217 (220)
273 cd00954 NAL N-Acetylneuraminic  95.5    0.11 2.8E-06   31.2   8.0  195   61-330    14-218 (288)
274 TIGR00693 thiE thiamine-phosph  95.5   0.076 1.9E-06   32.2   7.2  140  120-321    51-199 (210)
275 cd04727 pdxS PdxS is a subunit  95.5   0.022 5.7E-07   35.8   4.4   71  274-346   183-273 (283)
276 cd04737 LOX_like_FMN L-Lactate  95.5    0.23   6E-06   28.9  10.1  104  210-316   125-249 (351)
277 PRK08782 consensus              95.4    0.24 6.1E-06   28.9  13.9  134  152-343    30-180 (219)
278 cd00564 TMP_TenI Thiamine mono  95.4    0.22 5.5E-06   29.2   9.1   91  212-325    96-188 (196)
279 cd00953 KDG_aldolase KDG (2-ke  95.3    0.25 6.4E-06   28.7   9.2  197   56-332    10-213 (279)
280 PRK13957 indole-3-glycerol-pho  95.3    0.26 6.7E-06   28.6  10.7  192   48-322    43-236 (247)
281 COG0214 SNZ1 Pyridoxine biosyn  95.2   0.042 1.1E-06   34.0   5.0   70  275-346   196-285 (296)
282 PRK12595 bifunctional 3-deoxy-  95.2    0.13 3.3E-06   30.7   7.5  232   42-342   102-358 (360)
283 TIGR01108 oadA oxaloacetate de  95.2    0.18 4.7E-06   29.7   8.3  213   71-345    27-253 (616)
284 PRK13396 3-deoxy-7-phosphohept  95.2    0.14 3.5E-06   30.5   7.6  233   45-354    85-345 (352)
285 TIGR00674 dapA dihydrodipicoli  95.2    0.29 7.3E-06   28.3  11.7   19  321-339   222-240 (288)
286 pfam02219 MTHFR Methylenetetra  95.2    0.29 7.3E-06   28.3  11.9  132  145-334   153-285 (286)
287 PRK07807 inositol-5-monophosph  95.2     0.1 2.7E-06   31.3   6.9   86  212-323   218-310 (479)
288 PRK06267 hypothetical protein;  95.0    0.31   8E-06   28.1  13.5  132  211-354   172-305 (324)
289 KOG1606 consensus               94.9    0.15 3.9E-06   30.2   7.2   77  274-352   196-292 (296)
290 PRK06512 thiamine-phosphate py  94.8    0.17 4.4E-06   29.8   7.2   70  208-317    70-139 (221)
291 COG0352 ThiE Thiamine monophos  94.7    0.37 9.5E-06   27.6  10.6  101  212-335   105-207 (211)
292 KOG2550 consensus               94.7    0.17 4.4E-06   29.8   7.0   68  226-316   253-320 (503)
293 TIGR03128 RuMP_HxlA 3-hexulose  94.7    0.38 9.8E-06   27.5  11.4  161  123-333    42-205 (206)
294 pfam02581 TMP-TENI Thiamine mo  94.7    0.23 5.9E-06   29.0   7.6   85  212-319    96-180 (180)
295 COG0434 SgcQ Predicted TIM-bar  94.6    0.39   1E-05   27.4  10.8  211   70-338    39-261 (263)
296 PRK01130 N-acetylmannosamine-6  94.6    0.28 7.2E-06   28.4   7.8   65  229-315    81-145 (222)
297 pfam04309 G3P_antiterm Glycero  94.5   0.079   2E-06   32.1   5.0   41  274-316   128-168 (174)
298 pfam09370 TIM-br_sig_trns TIM-  94.5    0.41 1.1E-05   27.3   9.8  219   56-322    15-250 (268)
299 KOG0564 consensus               94.4    0.44 1.1E-05   27.1  11.8   37  148-184   166-221 (590)
300 PRK08649 inositol-5-monophosph  94.4    0.22 5.6E-06   29.1   7.0   75  223-316   140-214 (368)
301 TIGR00259 TIGR00259 conserved   94.3    0.46 1.2E-05   26.9  13.3  224   57-337    22-259 (261)
302 cd02922 FCB2_FMN Flavocytochro  94.3    0.47 1.2E-05   26.9  10.1  103  211-316   119-241 (344)
303 KOG4201 consensus               94.2    0.24   6E-06   28.9   6.8   52  274-325   224-276 (289)
304 cd04729 NanE N-acetylmannosami  93.7    0.54 1.4E-05   26.5   7.9  120  206-349    57-192 (219)
305 TIGR01361 DAHP_synth_Bsub phos  93.7     0.6 1.5E-05   26.2  13.7  229   44-341    11-259 (262)
306 cd04725 OMP_decarboxylase_like  93.5    0.65 1.7E-05   25.9  14.1  146  122-321    40-205 (216)
307 PRK11572 copper homeostasis pr  93.4    0.67 1.7E-05   25.9   8.9   44  271-316   155-198 (248)
308 KOG4175 consensus               93.4    0.68 1.7E-05   25.8  11.4  209   60-321    24-240 (268)
309 PRK09517 multifunctional thiam  93.2    0.45 1.1E-05   27.0   6.8   24   71-94    252-276 (738)
310 PRK13398 3-deoxy-7-phosphohept  93.2    0.32   8E-06   28.1   5.9  204   44-317    13-232 (266)
311 COG0646 MetH Methionine syntha  92.8    0.81 2.1E-05   25.3  13.3  155  160-338    63-246 (311)
312 TIGR01464 hemE uroporphyrinoge  92.8    0.82 2.1E-05   25.3   7.7   19  149-169   182-200 (351)
313 COG0134 TrpC Indole-3-glycerol  92.6    0.59 1.5E-05   26.2   6.7  175  123-349    35-222 (254)
314 TIGR00343 TIGR00343 pyridoxine  92.2    0.89 2.3E-05   25.0   7.2   76  273-350   191-286 (298)
315 PRK04302 triosephosphate isome  92.1    0.99 2.5E-05   24.7   8.1  109  224-337   102-221 (223)
316 PRK13397 3-deoxy-7-phosphohept  92.0       1 2.6E-05   24.6  10.4  153  114-317    59-220 (250)
317 cd02929 TMADH_HD_FMN Trimethyl  91.9    0.75 1.9E-05   25.5   6.5   98  219-318   139-260 (370)
318 COG1954 GlpP Glycerol-3-phosph  91.9    0.26 6.5E-06   28.7   4.1   66  222-315   107-172 (181)
319 PRK08999 hypothetical protein;  91.7     1.1 2.8E-05   24.4  11.4   77  224-319   235-311 (312)
320 PRK08227 aldolase; Validated    91.6     1.1 2.9E-05   24.4  12.5  142  160-350   131-283 (291)
321 TIGR01303 IMP_DH_rel_1 IMP deh  91.3     0.4   1E-05   27.4   4.6   75  266-346   311-389 (476)
322 PRK08508 biotin synthase; Prov  91.3     1.2 3.1E-05   24.1   8.8  193  118-344    72-273 (279)
323 TIGR01361 DAHP_synth_Bsub phos  91.2    0.55 1.4E-05   26.4   5.2   93  132-242   131-229 (262)
324 PRK09282 pyruvate carboxylase   91.1     1.3 3.2E-05   24.0  13.1   87  216-323   148-237 (580)
325 TIGR00734 hisAF_rel hisA/hisF   90.7    0.92 2.3E-05   24.9   6.0   81  222-323   148-228 (230)
326 PRK07226 fructose-bisphosphate  90.5     1.4 3.7E-05   23.6  12.4  141  163-350   106-261 (266)
327 cd02071 MM_CoA_mut_B12_BD meth  90.4     1.5 3.7E-05   23.6   8.3   76  214-313    31-106 (122)
328 TIGR01212 TIGR01212 radical SA  90.1     1.5 3.9E-05   23.4   6.9  192  120-342    95-298 (307)
329 TIGR02090 LEU1_arch isopropylm  89.8     1.4 3.5E-05   23.8   6.3  102  211-338   127-244 (371)
330 TIGR00262 trpA tryptophan synt  89.7     1.7 4.2E-05   23.2   7.8  215   57-321    14-232 (262)
331 PRK08645 bifunctional homocyst  89.3     1.8 4.5E-05   23.0  14.6  125  208-335   323-516 (608)
332 PRK12457 2-dehydro-3-deoxyphos  89.1     1.8 4.7E-05   22.9   7.8  139   55-244    14-165 (281)
333 PRK02261 methylaspartate mutas  88.8     1.9 4.9E-05   22.8  10.8   95  215-340    36-136 (137)
334 PRK09432 metF 5,10-methylenete  88.5       2 5.1E-05   22.6  14.4   32  300-334   259-290 (296)
335 PRK13305 sgbH 3-keto-L-gulonat  88.1     2.1 5.4E-05   22.5  12.8  167  123-337    46-214 (220)
336 TIGR03326 rubisco_III ribulose  88.1     2.1 5.4E-05   22.5  12.5  122  108-244   120-244 (412)
337 pfam03932 CutC CutC family. Co  88.0     2.2 5.5E-05   22.5  10.5  143  133-315    50-198 (202)
338 cd00537 MTHFR Methylenetetrahy  87.8     2.2 5.6E-05   22.4  12.7   69  144-230   141-209 (274)
339 COG5564 Predicted TIM-barrel e  87.5     2.3 5.8E-05   22.3   7.7   73  226-307   166-241 (276)
340 cd04726 KGPDC_HPS 3-Keto-L-gul  87.4     2.3 5.9E-05   22.2  10.6  156  118-325    39-196 (202)
341 cd00717 URO-D Uroporphyrinogen  87.2     2.4   6E-05   22.2   6.0   17   14-30     39-55  (335)
342 PRK12999 pyruvate carboxylase;  86.8     2.5 6.4E-05   22.0  12.2   85  218-323   687-774 (1147)
343 TIGR00973 leuA_bact 2-isopropy  85.9     2.8   7E-05   21.7   7.8  171  150-345   150-362 (514)
344 TIGR00126 deoC deoxyribose-pho  85.7     1.7 4.4E-05   23.1   4.7   87  212-319   129-221 (225)
345 cd00516 PRTase_typeII Phosphor  85.7     2.9 7.3E-05   21.6   6.7   35  284-319   236-270 (281)
346 PRK09426 methylmalonyl-CoA mut  85.3       3 7.6E-05   21.5  11.1   98  212-313   586-689 (715)
347 COG0269 SgbH 3-hexulose-6-phos  85.0     3.1 7.8E-05   21.4  13.6  169  118-334    42-212 (217)
348 TIGR01949 AroFGH_arch predicte  84.1     2.6 6.6E-05   21.9   5.0  134  160-338   100-248 (259)
349 PRK05692 hydroxymethylglutaryl  84.0     3.4 8.6E-05   21.1  11.6  103  221-345   153-264 (287)
350 PRK10610 chemotaxis regulatory  83.8     3.4 8.8E-05   21.1   6.6   62  274-342    66-128 (129)
351 cd01573 modD_like ModD; Quinol  83.7     3.5 8.8E-05   21.1   8.2   81  209-324   183-264 (272)
352 KOG0134 consensus               83.3     3.6 9.2E-05   20.9  11.5  177  147-336   169-367 (400)
353 PRK12581 oxaloacetate decarbox  82.8     3.8 9.6E-05   20.8  12.5   91  214-325   154-247 (468)
354 pfam04898 Glu_syn_central Glut  82.6     3.8 9.7E-05   20.8   9.2  117  223-353   140-279 (288)
355 TIGR01305 GMP_reduct_1 guanosi  82.6     2.7   7E-05   21.8   4.6   38  285-324   210-247 (343)
356 PRK13307 bifunctional formalde  82.5     3.8 9.8E-05   20.8  13.3   45  275-322   319-363 (392)
357 COG1242 Predicted Fe-S oxidore  82.4     3.9 9.9E-05   20.7   6.4  118  119-242    98-217 (312)
358 PRK05198 2-dehydro-3-deoxyphos  82.3     3.9  0.0001   20.7   7.3  171  114-337    60-260 (264)
359 PRK13505 formate--tetrahydrofo  81.5     4.2 0.00011   20.5   6.5   33  209-241   371-405 (556)
360 PRK09490 metH B12-dependent me  80.9     4.4 0.00011   20.4  15.3   79  159-243   394-488 (1229)
361 TIGR00419 tim triosephosphate   79.7     1.8 4.5E-05   23.0   2.9   45  276-320   196-241 (244)
362 TIGR02814 pfaD_fam PfaD family  79.3     4.9 0.00013   20.0  11.2   50  268-317   203-256 (449)
363 COG0284 PyrF Orotidine-5'-phos  79.0       5 0.00013   20.0  14.9  158  123-337    54-237 (240)
364 KOG0623 consensus               78.7     5.1 0.00013   19.9   6.1   35  288-322   317-362 (541)
365 PRK13370 mhpB 3-(2,3-dihydroxy  78.7     4.3 0.00011   20.5   4.5   35  277-311   158-202 (313)
366 COG0685 MetF 5,10-methylenetet  78.1     5.3 0.00014   19.8  10.4   23  220-242    89-111 (291)
367 COG0812 MurB UDP-N-acetylmuram  77.9     2.3   6E-05   22.2   3.0   21  212-233   176-196 (291)
368 cd07365 MhpB_like Subunit B of  77.8     4.9 0.00013   20.0   4.7   35  277-311   158-202 (310)
369 PRK07094 biotin synthase; Prov  76.8     5.8 0.00015   19.6   8.8  122  212-344   185-320 (323)
370 cd00956 Transaldolase_FSA Tran  76.3       6 0.00015   19.5   6.0   42  276-318   146-187 (211)
371 cd02067 B12-binding B12 bindin  76.2       6 0.00015   19.4   9.1   76  214-313    31-106 (119)
372 cd00377 ICL_PEPM Members of th  75.8     6.1 0.00016   19.4  11.7  209   56-322     9-232 (243)
373 PRK09549 mtnW 2,3-diketo-5-met  75.6     6.2 0.00016   19.4  12.1  121  108-242   116-239 (411)
374 PRK01362 putative translaldola  75.5     6.2 0.00016   19.3   6.9   41  277-318   147-187 (214)
375 TIGR03332 salvage_mtnW 2,3-dik  75.5     6.2 0.00016   19.3  11.4  245   70-341    87-387 (407)
376 COG2877 KdsA 3-deoxy-D-manno-o  74.9     6.5 0.00016   19.2   7.4  156   45-244     3-166 (279)
377 cd02072 Glm_B12_BD B12 binding  74.1     6.7 0.00017   19.1   8.4   77  214-313    31-112 (128)
378 pfam04476 DUF556 Protein of un  73.8     6.9 0.00018   19.0  15.3  203   66-323     8-215 (235)
379 TIGR00073 hypB hydrogenase acc  73.4     6.6 0.00017   19.2   4.4   22  156-177   109-136 (225)
380 PRK02227 hypothetical protein;  72.9     7.2 0.00018   18.9  18.7  216   66-335     8-234 (239)
381 KOG3304 consensus               72.9    0.99 2.5E-05   24.7   0.0   48  299-354    61-108 (148)
382 cd00958 DhnA Class I fructose-  72.4     7.4 0.00019   18.8   9.0  129  163-336    89-232 (235)
383 COG2185 Sbm Methylmalonyl-CoA   71.9     7.6 0.00019   18.8   7.2  119  212-340    16-139 (143)
384 TIGR01064 pyruv_kin pyruvate k  71.8     7.6 0.00019   18.7   7.7  234   46-339    88-365 (513)
385 pfam01474 DAHP_synth_2 Class-I  71.6     5.4 0.00014   19.8   3.5   36  208-243   279-315 (437)
386 cd00617 Tnase_like Tryptophana  71.4     7.8  0.0002   18.7   7.8  157  153-322   141-366 (431)
387 PRK06256 biotin synthase; Vali  71.2     7.9  0.0002   18.7  14.4  116  212-344   206-322 (325)
388 pfam02007 MtrH Tetrahydrometha  70.7     5.3 0.00013   19.8   3.4   52  120-175    49-102 (296)
389 pfam01729 QRPTase_C Quinolinat  70.6     8.1 0.00021   18.6  11.2   77  210-318    81-157 (169)
390 TIGR01358 DAHP_synth_II 3-deox  70.3     3.4 8.7E-05   21.1   2.3   35  208-242   284-319 (450)
391 PRK06096 molybdenum transport   70.2     8.2 0.00021   18.5   8.0   82  209-325   189-271 (284)
392 PRK10693 response regulator of  70.0     8.3 0.00021   18.5   5.2   33   55-88     79-111 (337)
393 cd01571 NAPRTase_B Nicotinate   69.8     8.4 0.00021   18.5   6.1   88  209-320   184-277 (302)
394 COG0157 NadC Nicotinate-nucleo  69.6     8.5 0.00022   18.4   5.2   33  284-317   231-263 (280)
395 PRK00115 hemE uroporphyrinogen  69.2     8.6 0.00022   18.4   7.2   74  226-316   190-268 (347)
396 PRK04183 glutamyl-tRNA(Gln) am  68.5     8.1 0.00021   18.6   3.9   56  212-293   291-346 (421)
397 pfam01136 Peptidase_U32 Peptid  68.0     9.1 0.00023   18.2   8.2   38  300-339   160-197 (232)
398 PRK07428 nicotinate-nucleotide  67.7     9.3 0.00024   18.2   8.2   67  225-317   203-269 (285)
399 COG1411 Uncharacterized protei  67.6     9.3 0.00024   18.2   5.3   87  216-325   132-218 (229)
400 PRK05848 nicotinate-nucleotide  67.5     9.3 0.00024   18.2  11.1   67  225-318   191-258 (272)
401 TIGR01697 PNPH-PUNA-XAPA inosi  67.2     9.5 0.00024   18.1   6.6   92  223-318    76-204 (266)
402 COG2355 Zn-dependent dipeptida  67.2     9.5 0.00024   18.1   8.9   51  308-359   251-305 (313)
403 pfam06135 DUF965 Bacterial pro  67.0     6.6 0.00017   19.2   3.2   29  324-352    14-42  (79)
404 pfam02662 FlpD Methyl-viologen  66.9     9.6 0.00024   18.1   7.3   13  231-243    47-59  (124)
405 PRK08385 nicotinate-nucleotide  66.7     9.7 0.00025   18.1   7.5   78  210-318   184-262 (279)
406 PRK04208 rbcL ribulose bisopho  66.7     9.7 0.00025   18.0  10.8  123  108-244   135-260 (467)
407 TIGR00705 SppA_67K signal pept  66.7     5.5 0.00014   19.7   2.7  165  151-336   345-571 (614)
408 pfam01208 URO-D Uroporphyrinog  66.6     9.7 0.00025   18.0   6.4   11  132-142   134-144 (337)
409 PRK05473 hypothetical protein;  66.5     6.8 0.00017   19.1   3.2   29  324-352    17-45  (86)
410 PRK06559 nicotinate-nucleotide  66.0      10 0.00025   18.0   8.6   65  224-317   206-270 (290)
411 PRK11829 biofilm formation reg  65.0      10 0.00027   17.8   7.7   49  273-327   665-713 (728)
412 PRK12656 fructose-6-phosphate   64.8      10 0.00027   17.8   6.3   65  277-342   151-218 (222)
413 TIGR03555 F420_mer 5,10-methyl  64.3      11 0.00027   17.7   6.3   25   40-64     51-75  (325)
414 PRK12548 shikimate 5-dehydroge  64.1      11 0.00028   17.7   6.4   17  113-130   104-120 (289)
415 pfam00072 Response_reg Respons  64.0      11 0.00028   17.7   4.7   37  275-312    59-95  (111)
416 PRK08349 hypothetical protein;  63.4      11 0.00028   17.6   4.5   11  273-283   181-191 (198)
417 TIGR02538 type_IV_pilB type IV  62.7     9.6 0.00024   18.1   3.4   47  300-350   526-572 (577)
418 TIGR02477 PFKA_PPi diphosphate  62.5      12 0.00029   17.5   5.9   22  120-143   157-178 (566)
419 COG3514 Uncharacterized protei  61.6      12 0.00031   17.4   4.0   31  299-342    63-93  (93)
420 PRK07188 nicotinate phosphorib  60.9      12 0.00031   17.3   9.2  104  210-320   209-320 (355)
421 PRK13238 tnaA tryptophanase; P  60.8      12 0.00031   17.3   7.8  159  154-325   167-395 (461)
422 TIGR01320 mal_quin_oxido malat  60.7     7.4 0.00019   18.8   2.5   69   92-173   102-170 (487)
423 PRK08384 thiamine biosynthesis  59.7      13 0.00033   17.2   7.1   56  285-345   179-234 (310)
424 TIGR02617 tnaA_trp_ase tryptop  59.7      13 0.00033   17.2   3.8  163  150-325   169-403 (468)
425 TIGR00284 TIGR00284 dihydropte  58.9      13 0.00034   17.1   4.3  116  223-354   288-414 (529)
426 PRK12290 thiE thiamine-phospha  58.4      14 0.00035   17.1   7.5   69  270-342   342-418 (439)
427 COG0469 PykF Pyruvate kinase [  58.2      14 0.00035   17.0  10.8  170  146-356   174-369 (477)
428 TIGR02313 HpaI-NOT-DapA 2,4-di  58.2      14 0.00035   17.0   5.8  209   56-311    10-242 (294)
429 TIGR00507 aroE shikimate 5-deh  57.8      14 0.00035   17.0   3.9   94   70-194    69-167 (286)
430 cd01966 Nitrogenase_NifN_1 Nit  57.8      14 0.00035   17.0  12.2   80  162-244   113-192 (417)
431 TIGR00078 nadC nicotinate-nucl  57.7      14 0.00035   17.0   4.8   40  275-316   222-261 (276)
432 PRK12376 putative translaldola  57.7      14 0.00035   17.0  16.1  191   67-322    16-207 (238)
433 TIGR02317 prpB methylisocitrat  57.6      14 0.00036   17.0   8.1   38  103-140    38-81  (287)
434 pfam07364 DUF1485 Protein of u  57.5      14 0.00036   17.0   5.3   50  286-342   224-273 (292)
435 PRK10463 hydrogenase nickel in  57.2      14 0.00036   16.9   4.8   16  110-125   107-122 (290)
436 COG5598 Trimethylamine:corrino  56.9      14 0.00037   16.9   5.3  178  120-323   194-400 (526)
437 PRK05742 nicotinate-nucleotide  56.6      14 0.00037   16.9   7.6   75  208-317   188-262 (277)
438 TIGR00519 asnASE_I L-asparagin  56.5      15 0.00037   16.9   4.0   27  212-242   223-249 (347)
439 CHL00040 rbcL ribulose-1,5-bis  56.5      15 0.00037   16.9  11.5  110  119-241   154-266 (477)
440 PRK08072 nicotinate-nucleotide  56.1      15 0.00038   16.8  11.3   75  208-317   187-261 (277)
441 PRK09355 hydroxyethylthiazole   55.3      15 0.00039   16.7   4.0   20  157-176    48-67  (262)
442 cd01572 QPRTase Quinolinate ph  55.2      15 0.00039   16.7  10.8   75  209-318   182-256 (268)
443 COG0502 BioB Biotin synthase a  55.0      15 0.00039   16.7   6.4  180  120-324   117-303 (335)
444 PRK13780 phosphocarrier protei  54.8      15 0.00039   16.7   5.1   67  276-344    21-87  (88)
445 TIGR00677 fadh2_euk methylenet  53.4      16 0.00041   16.5   6.2   64  220-289    77-140 (312)
446 PRK13655 phosphoenolpyruvate c  53.3      14 0.00037   16.9   3.0   26  270-296   366-391 (487)
447 PRK10949 protease 4; Provision  53.1      13 0.00034   17.1   2.8   14  290-303   505-518 (618)
448 pfam02873 MurB_C UDP-N-acetyle  52.3     7.9  0.0002   18.6   1.5   39   46-92     22-60  (103)
449 PRK00258 aroE shikimate 5-dehy  52.1      17 0.00043   16.4   5.7   28  307-338   246-273 (275)
450 PRK12331 oxaloacetate decarbox  52.1      17 0.00043   16.4  13.7   92  212-324   143-237 (463)
451 COG4472 Uncharacterized protei  52.1      16 0.00042   16.5   3.1   25  327-351    20-44  (88)
452 cd01974 Nitrogenase_MoFe_beta   52.1      17 0.00043   16.4  14.1   21  223-243   174-194 (435)
453 pfam02110 HK Hydroxyethylthiaz  51.9      16 0.00041   16.6   3.1   19  158-176    44-62  (246)
454 PRK08662 nicotinate phosphorib  51.2      18 0.00045   16.3  10.4   89  208-321   199-293 (343)
455 cd00156 REC Signal receiver do  50.3      18 0.00046   16.2   5.2   37  275-312    58-94  (113)
456 cd00740 MeTr MeTr subgroup of   50.1      18 0.00047   16.2   6.8   37  208-244    91-127 (252)
457 pfam00224 PK Pyruvate kinase,   50.0      18 0.00047   16.2  11.0  108  207-336   215-340 (348)
458 TIGR02713 allophanate_hyd allo  49.7      19 0.00047   16.1   4.5   54  264-318   271-346 (582)
459 COG1892 Phosphoenolpyruvate ca  49.5      19 0.00048   16.1   4.5   63  260-322   217-287 (488)
460 pfam06253 MTTB Trimethylamine   49.5      14 0.00036   17.0   2.4  165  132-323   187-383 (505)
461 cd01568 QPRTase_NadC Quinolina  49.2      19 0.00048   16.1  10.9   80  209-323   181-260 (269)
462 PRK07535 methyltetrahydrofolat  49.2      19 0.00048   16.1   6.5   36  207-244    89-124 (268)
463 PRK06978 nicotinate-nucleotide  49.1      19 0.00048   16.1   7.7   75  208-317   198-272 (288)
464 pfam02900 LigB Catalytic LigB   49.0      19 0.00048   16.1   3.2   26  275-300   157-182 (265)
465 cd03318 MLE Muconate Lactonizi  48.8      19 0.00049   16.1   4.5   69  268-343   222-291 (365)
466 PRK05301 pyrroloquinoline quin  48.7      19 0.00049   16.0  12.1   20  223-242   170-189 (375)
467 TIGR01954 nusA_Cterm_rpt trans  48.3      10 0.00025   18.0   1.5   20  330-349     1-20  (52)
468 COG0796 MurI Glutamate racemas  47.9      20  0.0005   16.0   5.3   34  209-249    91-124 (269)
469 TIGR02320 PEP_mutase phosphoen  47.2      20 0.00052   15.9   5.8  100  210-318    72-184 (272)
470 COG1038 PycA Pyruvate carboxyl  46.7      21 0.00052   15.8   9.1   65  269-336   720-791 (1149)
471 pfam07476 MAAL_C Methylasparta  46.5      21 0.00053   15.8   6.8  118  108-245    35-170 (249)
472 PRK00915 2-isopropylmalate syn  46.5      21 0.00053   15.8  11.3   39  209-249   196-235 (511)
473 PRK09016 quinolinate phosphori  46.5      21 0.00053   15.8   7.7   75  208-317   207-281 (296)
474 PRK04460 nickel responsive reg  46.3      18 0.00047   16.2   2.6   11  223-233   109-119 (139)
475 TIGR00373 TIGR00373 conserved   46.2     5.7 0.00014   19.6  -0.0   15  164-178   124-138 (168)
476 PTZ00066 pyruvate kinase; Prov  46.0      21 0.00054   15.8   5.3  109  207-336   249-374 (513)
477 PRK06252 methylcobalamin:coenz  45.8      21 0.00054   15.8   7.9   11  132-142   136-146 (339)
478 cd03321 mandelate_racemase Man  45.8      21 0.00054   15.8   4.3   69  268-343   220-289 (355)
479 TIGR01127 ilvA_1Cterm threonin  45.8      21 0.00054   15.8   5.0   50   69-131   141-197 (381)
480 TIGR02729 Obg_CgtA GTP-binding  45.6      17 0.00044   16.3   2.4   35   95-132   134-183 (296)
481 pfam03841 SelA L-seryl-tRNA se  45.1      19 0.00047   16.1   2.5  110   55-175    85-219 (367)
482 PRK01002 nickel responsive reg  45.1      21 0.00053   15.8   2.7   11  223-233   110-120 (141)
483 PRK00630 nickel responsive reg  45.1      18 0.00046   16.2   2.4   11  223-233   115-125 (143)
484 pfam01964 ThiC ThiC family. Th  45.0      22 0.00056   15.7   5.1   24  295-318   303-326 (421)
485 TIGR01278 DPOR_BchB light-inde  44.9      22 0.00056   15.7   3.4   33  205-241   240-273 (562)
486 TIGR00381 cdhD CO dehydrogenas  44.9      22 0.00056   15.7   4.3   31  270-302   289-324 (401)
487 PRK13384 delta-aminolevulinic   44.5      22 0.00057   15.6  11.7   60   65-140    62-122 (323)
488 cd01320 ADA Adenosine deaminas  43.6      23 0.00058   15.5  12.9  145  160-332    83-232 (325)
489 PRK02271 methylenetetrahydrome  43.6      23 0.00058   15.5   3.9   22   42-63     55-76  (324)
490 pfam00311 PEPcase Phosphoenolp  43.5      23 0.00058   15.5   4.9   25  270-295   369-393 (500)
491 PRK13958 N-(5'-phosphoribosyl)  43.3      23 0.00059   15.5   3.1   37  287-324   152-190 (207)
492 TIGR00067 glut_race glutamate   43.2      23 0.00059   15.5   4.7  120  206-342    84-227 (262)
493 cd01712 ThiI ThiI is required   43.0      23  0.0006   15.5   4.0   12  230-241    97-108 (177)
494 TIGR02751 PEPCase_arch phospho  43.0      23  0.0006   15.5   5.0  100  260-359   227-342 (549)
495 TIGR02903 spore_lon_C ATP-depe  43.0      15 0.00037   16.9   1.7   30   69-98    311-342 (616)
496 pfam03740 PdxJ Pyridoxal phosp  42.9      19 0.00048   16.1   2.2   14  229-242   138-151 (239)
497 TIGR02109 PQQ_syn_pqqE coenzym  42.8      24  0.0006   15.4   7.1  142  132-284   144-289 (363)
498 pfam03662 Glyco_hydro_79n Glyc  42.4      24 0.00061   15.4   3.7   75  275-350   199-280 (320)
499 COG0176 MipB Transaldolase [Ca  42.3      24 0.00061   15.4   8.9  118  212-340    94-229 (239)
500 PRK07896 nicotinate-nucleotide  41.6      24 0.00062   15.3   7.9   64  229-317   211-274 (288)

No 1  
>TIGR01036 pyrD_sub2 dihydroorotate oxidase; InterPro: IPR005719   Dihydroorotate dehydrogenase (1.3.3.1 from EC) (DHOdehase) catalyzes the fourth step in the de novo biosynthesis of pyrimidine, the conversion of dihydroorotate into orotate. DHOdehase is a ubiquitous FAD flavoprotein. In bacteria (gene pyrD), DHOdease is located on the inner side of the cytosolic membrane. In some yeasts, such as in Saccharomyces cerevisiae (gene URA1, subfamily 2), it is a cytosolic protein while in other eukaryotes it is found in the mitochondria .    This model describes dihydroorotate dehydrogenase subfamily 2 and includes members from bacteria and eukaryotes. The subfamilies 1 and 2 share extensive homology, particularly toward the C-terminus, however subfamily 2 has a longer N-terminal region.; GO: 0004158 dihydroorotate oxidase activity, 0006207 'de novo' pyrimidine base biosynthetic process, 0016020 membrane.
Probab=100.00  E-value=0  Score=773.27  Aligned_cols=349  Identities=44%  Similarity=0.697  Sum_probs=335.4

Q ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHHHH--------HHHCCCCCCCCCCEEEECCEECCCCEEECCCCCCCHHHHHHHHHC
Q ss_conf             999999975089678899999999620--------111046788963116888733599748534688867798887403
Q gi|254780434|r    6 HKLALRGLTHLDPEIAHHLSIVALKSG--------LLSFFPVHSDPRLNTKVAGISLSNPLGMAAGYDKNAEVPIELLKL   77 (362)
Q Consensus         6 ~~~~~~~l~~~~pe~ah~~~~~~~~~~--------~~~~~~~~~~~~L~~~~~Gl~~~nPiglAaG~dk~~~~~~~l~~~   77 (362)
                      |.+++++||.||||.||.++...+|..        |+.....+.+|.|+++++|++|+||+||||||||||++++.|-.+
T Consensus         1 Y~Lvr~~lF~lDpE~AH~~~~~~Lr~~~~~~F~~~L~r~~~~~~~P~L~~~vlG~~FpNPlGLAAGfDK~G~a~d~l~Am   80 (370)
T TIGR01036         1 YPLVRKLLFLLDPEKAHELVFQVLRLVAASPFLARLLRSLLGAKDPVLEVTVLGLKFPNPLGLAAGFDKDGEALDALGAM   80 (370)
T ss_pred             CCCHHHHCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCEECCCCCCCCHHHHCCCCCCHHHHHHHHHH
T ss_conf             95210141589977889999999864125640345578646888788643123410686133423799876699875641


Q ss_pred             CCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHH--------HHHCCCCCCEEECCCC--CH
Q ss_conf             6752410200136878998862688425554100002477777889998764--------1000121000110454--24
Q gi|254780434|r   78 GFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSK--------IQPTSPIGINLGANKD--SK  147 (362)
Q Consensus        78 G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~--------~~~~~pi~vsI~~~~~--s~  147 (362)
                      ||||+|+||||++||+|||+||+||+++++|++|+|||||.|++...+++++        ++++.|||||||+||.  .+
T Consensus        81 GFG~~EiGTVTp~pQ~GN~~PRlFRL~e~~~liNRmGFNN~G~~~l~~~~k~~qqkqakla~y~~piGiNiGKNK~t~~~  160 (370)
T TIGR01036        81 GFGYLEIGTVTPKPQPGNPRPRLFRLIEDEALINRMGFNNHGADLLVERLKRFQQKQAKLARYKGPIGINIGKNKKTPAE  160 (370)
T ss_pred             CCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCHH
T ss_conf             84247541205888667777864254557887632052056799999999986545420278985264324888666544


Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHH
Q ss_conf             67887765554206755269830333653221100002343211112244455655312688517865057777488899
Q gi|254780434|r  148 DFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDD  227 (362)
Q Consensus       148 ~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~  227 (362)
                      |+.+||..|++.++++|||+++|||||||||+|+||..+.++++|.++++.+........+.+||+||++||++++++.+
T Consensus       161 ~a~~DY~~~~~~~~~~A~Y~~vN~SSPNTPgLR~LQ~~~~~~~LL~~~k~~~~~L~~~~~KY~P~~VKIAPDL~~~dl~~  240 (370)
T TIGR01036       161 DAKEDYKACLRKVGPLADYLVVNVSSPNTPGLRDLQYKESLRDLLTAVKEETDGLRRVHRKYVPVLVKIAPDLSESDLLD  240 (370)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHH
T ss_conf             22668999999873210707886358897351324014358999999999999999861278857897268988213899


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCC-CCCCCCC-CCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHH
Q ss_conf             999876449829998066555323-4577544-63221135645424689999999740897489996788999999999
Q gi|254780434|r  228 IAVEVLSHKVEGIIVSNTTLSRKG-VQCSDNH-EQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDK  305 (362)
Q Consensus       228 ia~~a~~~g~dGiv~~NT~~~~~~-~~~~~~~-~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~  305 (362)
                      ||+.++++++||||+||||++|+. +..+... .+.|||||+||...|++.++++++++.+++||||||||+++++|+|+
T Consensus       241 IAd~~v~~~~dG~IATNTT~sR~~Gv~g~k~~r~~~GGLSGkPL~~kS~eiirrL~~~~~gr~piIgVGGI~~~~~A~Ek  320 (370)
T TIGR01036       241 IADSAVELGIDGIIATNTTVSRDLGVTGPKNSREETGGLSGKPLQKKSTEIIRRLYKELKGRLPIIGVGGISSAQNALEK  320 (370)
T ss_pred             HHHHHHHCCCCEEEEECCEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHH
T ss_conf             99999871898489844510252002563214356789887514477899999999996495789962785747889999


Q ss_pred             HHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHCCCC
Q ss_conf             9839997545278770697899999999999999838997789616975
Q gi|254780434|r  306 IMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIRGSYT  354 (362)
Q Consensus       306 l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~si~e~iG~~~  354 (362)
                      |.||||+||+||||+|+||.++++|.++|.+.|++.||.|+.|+||++.
T Consensus       321 I~AGASLlQ~YsgfIy~GP~l~k~i~~~i~~lL~~~GFgsv~eAiGad~  369 (370)
T TIGR01036       321 IKAGASLLQIYSGFIYKGPPLVKEIVKEIEKLLKEDGFGSVKEAIGADR  369 (370)
T ss_pred             HHHCCHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHCCCCC
T ss_conf             9847124456423466771679999999999975179612244102356


No 2  
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed
Probab=100.00  E-value=0  Score=711.19  Aligned_cols=330  Identities=51%  Similarity=0.850  Sum_probs=308.8

Q ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH---HCCCCCCCCCCEEEECCEECCCCEEECCCCCCCHHHHHHHHHCCCC
Q ss_conf             8999999997508967889999999962011---1046788963116888733599748534688867798887403675
Q gi|254780434|r    4 ILHKLALRGLTHLDPEIAHHLSIVALKSGLL---SFFPVHSDPRLNTKVAGISLSNPLGMAAGYDKNAEVPIELLKLGFG   80 (362)
Q Consensus         4 ~~~~~~~~~l~~~~pe~ah~~~~~~~~~~~~---~~~~~~~~~~L~~~~~Gl~~~nPiglAaG~dk~~~~~~~l~~~G~G   80 (362)
                      +||++++|+||++|||+||++++.+|+....   ..+..+++|+|+++++|++|+||||||||||||+++++.+.++|||
T Consensus         1 ~y~~~~~pll~~ldpE~aH~~~~~~l~~~~~~~~~~~~~~~~~~L~~~i~Gl~f~nPiGLAAGfDKn~e~~~~l~~lGFG   80 (336)
T PRK05286          1 MYYPLLRPLLFKLDPERAHELTIRALKRAGRTLLARLLRYKDPRLPVTVMGLTFPNPVGLAAGFDKNGEAIDALGALGFG   80 (336)
T ss_pred             CHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCHHHCCCCCCCCEEECCEECCCCCEECCCCCCCCCCCCCHHHCCCC
T ss_conf             91899999997699899999999999986135772431589866676888854699675556789997103726656866


Q ss_pred             EEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHH-CCCCCCEEECCCCC--HHHHHHHHHHH
Q ss_conf             2410200136878998862688425554100002477777889998764100-01210001104542--46788776555
Q gi|254780434|r   81 FVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQP-TSPIGINLGANKDS--KDFILDYVSGI  157 (362)
Q Consensus        81 ~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~-~~pi~vsI~~~~~s--~~~~~dy~~~~  157 (362)
                      |+|+||||++||+|||+||+||++++++++|+|||||+|++.+.++|++.+. ..|+|||||+|+++  +++++||.+++
T Consensus        81 fvEvGTVT~~pq~GNpkPR~fRl~~~~aliNr~GfnN~G~~~~~~~L~~~~~~~~~lGvnIg~nk~t~~e~~~~Dy~~~~  160 (336)
T PRK05286         81 FVEVGTVTPRPQPGNPKPRLFRLPEDEALINRMGFNNEGADALAERLKKAKPYKGPLGINIGKNKDTPLEDAVDDYLICL  160 (336)
T ss_pred             EEEECCCCCCCCCCCCCCEEEEECCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             69970516998799999717981377637850577986899999999850567886589976237884166899999999


Q ss_pred             HHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             42067552698303336532211000023432111122444556553126885178650577774888999998764498
Q gi|254780434|r  158 RLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKV  237 (362)
Q Consensus       158 ~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~  237 (362)
                      ++++++|||+|||+|||||+|+|.+|+++.+++++.++...+..    ...++|||+|||||++++++.++++++.++++
T Consensus       161 ~~l~~~aDy~~INiSsPNT~glr~lq~~~~L~~ll~~v~~~~~~----~~~~~PI~vKisPDl~~~~l~~i~~~~~~~~i  236 (336)
T PRK05286        161 RKLYPYADYFTVNISSPNTPGLRDLQAGEALDELLAALKEAQAE----LGKYVPLLLKIAPDLSDEELDDIADLALEHGI  236 (336)
T ss_pred             HHHHCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH----CCCCCCEEEECCCCCCHHHHHHHHHHHHHHCC
T ss_conf             99826377899975689986520004669999999999999984----37888648832888887899999999998198


Q ss_pred             CEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECH
Q ss_conf             29998066555323457754463221135645424689999999740897489996788999999999983999754527
Q gi|254780434|r  238 EGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYS  317 (362)
Q Consensus       238 dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~T  317 (362)
                      ||++++|||++|+.+. .....+.|||||+||++.|+++|+++|+.+++++||||||||+|++||++++.||||+||+||
T Consensus       237 dGii~tNTt~~r~~l~-~~~~~~~GGLSG~pl~~~s~~~v~~~~~~~~~~~pIIgvGGI~s~~da~~~i~aGAslVQlyT  315 (336)
T PRK05286        237 DGIIATNTTLDRSGLE-GPNAEEAGGLSGRPLFERSTEVIRRLYKELGGRLPIIGVGGIDSAEDAYEKIRAGASLVQIYS  315 (336)
T ss_pred             CEEEEECCCCCCCCCC-CCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCCHHHHHH
T ss_conf             6899958867664456-655566687464067899999999999973999709998998999999999986996887416


Q ss_pred             HHHCCCHHHHHHHHHHHHHHH
Q ss_conf             877069789999999999999
Q gi|254780434|r  318 AMIYEGISLPKRIIQGLSDFL  338 (362)
Q Consensus       318 ali~~Gp~~~~~I~~~L~~~l  338 (362)
                      +++|+||.++++|++||.++|
T Consensus       316 gliy~GP~lv~~I~~~L~~lL  336 (336)
T PRK05286        316 GLIYEGPGLVKEIVRGLARLL  336 (336)
T ss_pred             HHHHCCHHHHHHHHHHHHHHC
T ss_conf             787219079999999999759


No 3  
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2. DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences, their cellular location and their natural electron acceptor used to reoxidize the flavin group. Members of class 1 are cytosolic enzymes and multimers, while class 2 enzymes are membrane associated, monomeric and use respiratory quinones as their physiological electron acceptors.
Probab=100.00  E-value=0  Score=695.02  Aligned_cols=321  Identities=54%  Similarity=0.836  Sum_probs=301.5

Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHC---CCCCCCCCCEEEECCEECCCCEEECCCCCCCHHHHHHHHHCCCCEEECCC
Q ss_conf             999750896788999999996201110---46788963116888733599748534688867798887403675241020
Q gi|254780434|r   10 LRGLTHLDPEIAHHLSIVALKSGLLSF---FPVHSDPRLNTKVAGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGT   86 (362)
Q Consensus        10 ~~~l~~~~pe~ah~~~~~~~~~~~~~~---~~~~~~~~L~~~~~Gl~~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~kt   86 (362)
                      +|+||++|||+||++++.+|+......   +..+++++|+++++|++|+||||||||||||+++++.+.++||||+|+||
T Consensus         1 rp~l~~l~pE~aH~~~~~~l~~~~~~~~~~~~~~~~~~l~~~i~Gl~f~nPiGlAAGfDKn~~~~~~~~~lGfGfvevGT   80 (327)
T cd04738           1 RPLLFLLDPETAHRLAIRALKLGLGPPLLLLLVYDDPRLEVEVFGLTFPNPVGLAAGFDKNAEAIDALLALGFGFVEVGT   80 (327)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHCCCCCCCCCEEECCEECCCCCEECCCCCCCHHHHHHHHHCCCCEEEECC
T ss_conf             98011499799999999999850647640103689966556888755699586545889885899999966986799714


Q ss_pred             CCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHH-CCCCCCEEECCCCC--HHHHHHHHHHHHHHCCC
Q ss_conf             0136878998862688425554100002477777889998764100-01210001104542--46788776555420675
Q gi|254780434|r   87 VTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQP-TSPIGINLGANKDS--KDFILDYVSGIRLFFTI  163 (362)
Q Consensus        87 it~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~-~~pi~vsI~~~~~s--~~~~~dy~~~~~~~~~~  163 (362)
                      ||++||+|||+||+||++++++++|+|||||+|++++.++|++.+. +.|+|||||+|+++  +++++||.+++++++++
T Consensus        81 VT~~pq~GNpkPRifRl~~~~aiiN~~GfnN~G~~~~~~~L~~~~~~~~~lgvnIg~nk~t~~e~~~~Dy~~~~~~l~~~  160 (327)
T cd04738          81 VTPRPQPGNPKPRLFRLPEDEALINRMGFNNDGADAVAKRLKKRRPRGGPLGVNIGKNKDTPLEDAVEDYVIGVRKLGPY  160 (327)
T ss_pred             CCCCCCCCCCCCCEEECCCCCEEEHHCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             36888889999857974675401100458717699999999840456871799985047882676899999999985355


Q ss_pred             CCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             52698303336532211000023432111122444556553126885178650577774888999998764498299980
Q gi|254780434|r  164 ASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVS  243 (362)
Q Consensus       164 aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~  243 (362)
                      |||+|||+|||||+|+|.+|+++.+.+++.++++.+...    ..++|||+|||||++++++.++++++.++|+||++++
T Consensus       161 aDy~~iNiSsPNt~glr~lq~~~~l~~ll~~v~~~~~~~----~~~~Pi~vKlsPD~~~~~i~~i~~~~~~~g~dGvi~t  236 (327)
T cd04738         161 ADYLVVNVSSPNTPGLRDLQGKEALRELLTAVKEERNKL----GKKVPLLVKIAPDLSDEELEDIADVALEHGVDGIIAT  236 (327)
T ss_pred             CCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC----CCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             778999546889845100268899999999999999853----7788669981799766789999999997399789995


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCC
Q ss_conf             66555323457754463221135645424689999999740897489996788999999999983999754527877069
Q gi|254780434|r  244 NTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEG  323 (362)
Q Consensus       244 NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~G  323 (362)
                      |||.+|+.+.......+.|||||+||+++|+++|+++|+.+++++||||||||+|++||+|++.||||+||+||+++|+|
T Consensus       237 NTt~~r~~~~~~~~~~~~GGlSG~pl~~~s~~~v~~v~~~~~~~~pIIgvGGI~s~~Da~e~i~aGAslVQiyT~liy~G  316 (327)
T cd04738         237 NTTISRPGLLRSPLANETGGLSGAPLKERSTEVLRELYKLTGGKIPIIGVGGISSGEDAYEKIRAGASLVQLYTGLVYEG  316 (327)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHCC
T ss_conf             88555421245655566686364067899999999999974999819998897999999999986996998768989319


Q ss_pred             HHHHHHHHHHH
Q ss_conf             78999999999
Q gi|254780434|r  324 ISLPKRIIQGL  334 (362)
Q Consensus       324 p~~~~~I~~~L  334 (362)
                      |.++++|++||
T Consensus       317 P~li~~I~~~L  327 (327)
T cd04738         317 PGLVKRIKREL  327 (327)
T ss_pred             CHHHHHHHHHC
T ss_conf             06999998219


No 4  
>KOG1436 consensus
Probab=100.00  E-value=0  Score=637.30  Aligned_cols=347  Identities=49%  Similarity=0.768  Sum_probs=326.3

Q ss_pred             HHH-HHHHHHHCC-CHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEECCEECCCCEEECCCCCCCHHHHHHHHHCCCCEE
Q ss_conf             999-999997508-967889999999962011104678896311688873359974853468886779888740367524
Q gi|254780434|r    5 LHK-LALRGLTHL-DPEIAHHLSIVALKSGLLSFFPVHSDPRLNTKVAGISLSNPLGMAAGYDKNAEVPIELLKLGFGFV   82 (362)
Q Consensus         5 ~~~-~~~~~l~~~-~pe~ah~~~~~~~~~~~~~~~~~~~~~~L~~~~~Gl~~~nPiglAaG~dk~~~~~~~l~~~G~G~v   82 (362)
                      +|. .+.|.++.+ |||++|+++..++..+|+|+....++.+|.++++|.+|.||||+||||||+++.+..|.+.||||+
T Consensus        42 f~~~~~mp~~~~lld~E~sHrlAv~aas~gl~Pr~~~~d~~~L~~k~~g~~f~NPiglAAGfdk~~eaidgL~~~gfG~i  121 (398)
T KOG1436          42 FYARIVMPPFHALLDPEFSHRLAVLAASWGLLPRDRVADDASLETKVLGRKFSNPIGLAAGFDKNAEAIDGLANSGFGFI  121 (398)
T ss_pred             EEEEEECCHHHHHCCHHHHHHHHHHHHHHCCCCHHCCCCCCCHHHHHHHHHCCCCHHHHHCCCCCHHHHHHHHHCCCCEE
T ss_conf             55333124166407977777999999771777510057865224677401026830132135754688888874787649


Q ss_pred             ECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH----H--CCCCCCEEECCCCCHHHHHHHHHH
Q ss_conf             1020013687899886268842555410000247777788999876410----0--012100011045424678877655
Q gi|254780434|r   83 EIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ----P--TSPIGINLGANKDSKDFILDYVSG  156 (362)
Q Consensus        83 ~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~----~--~~pi~vsI~~~~~s~~~~~dy~~~  156 (362)
                      ++||||+.||+|||+||+||+++|.++||+|||||+|++++++++.+.+    +  ..++|||+++|+.|+|+..||++.
T Consensus       122 eigSvTp~pqeGNPkPRvfrl~ed~~vINryGfns~Gi~~vl~rl~~~r~~~~~e~~~~lGVnlgknk~s~d~~~dy~~g  201 (398)
T KOG1436         122 EIGSVTPKPQEGNPKPRVFRLPEDLAVINRYGFNSEGIDAVLQRLRAKRQAKYPEAPAKLGVNLGKNKTSEDAILDYVEG  201 (398)
T ss_pred             EECCCCCCCCCCCCCCCEEECCCCCCHHHCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCCHHHHHHHH
T ss_conf             95465457878999985686265423001057884249999999998887317886532105623465774567889987


Q ss_pred             HHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCC
Q ss_conf             54206755269830333653221100002343211112244455655312688517865057777488899999876449
Q gi|254780434|r  157 IRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHK  236 (362)
Q Consensus       157 ~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g  236 (362)
                      ++.+.++|||++||+|||||+|+|.+|....|.+++..+..++....  ...+.|+++|++||+...++.+++.++.+.+
T Consensus       202 V~~~g~~adylviNvSsPNtpGlr~lq~k~~L~~ll~~v~~a~~~~~--~~~~~pvl~kiapDL~~~el~dia~v~kk~~  279 (398)
T KOG1436         202 VRVFGPFADYLVINVSSPNTPGLRSLQKKSDLRKLLTKVVQARDKLP--LGKKPPVLVKIAPDLSEKELKDIALVVKKLN  279 (398)
T ss_pred             HHHCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCC--CCCCCCEEEEECCCHHHHHHHHHHHHHHHHC
T ss_conf             65124546658995569998662655327789999999999886045--6889865888565242778989999999837


Q ss_pred             CCEEEEECCCCCC-CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEE
Q ss_conf             8299980665553-234577544632211356454246899999997408974899967889999999999839997545
Q gi|254780434|r  237 VEGIIVSNTTLSR-KGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQL  315 (362)
Q Consensus       237 ~dGiv~~NT~~~~-~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi  315 (362)
                      +||++..||+++| +.........++|||||+|++|+|+.+|+++|+++.+++||||||||+|++||+|+++||||+||+
T Consensus       280 idg~IvsnttVsrp~~~~~~~~~~etGGLsG~plk~~st~~vR~mY~lt~g~IpiIG~GGV~SG~DA~EkiraGASlvQl  359 (398)
T KOG1436         280 IDGLIVSNTTVSRPKASLVNKLKEETGGLSGPPLKPISTNTVRAMYTLTRGKIPIIGCGGVSSGKDAYEKIRAGASLVQL  359 (398)
T ss_pred             CCCEEECCCEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHCCCHHHHH
T ss_conf             56366138566247101016664356887898663668999999998636887468416856547699998627139988


Q ss_pred             CHHHHCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHCCC
Q ss_conf             27877069789999999999999983899778961697
Q gi|254780434|r  316 YSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIRGSY  353 (362)
Q Consensus       316 ~Tali~~Gp~~~~~I~~~L~~~l~~~G~~si~e~iG~~  353 (362)
                      ||+|.|+||.++.+|++||.+.|+++||.++.|+||+.
T Consensus       360 yTal~yeGp~i~~kIk~El~~ll~~kG~t~v~d~iG~~  397 (398)
T KOG1436         360 YTALVYEGPAIIEKIKRELSALLKAKGFTSVDDAIGKD  397 (398)
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHHHHCCCCCHHHHCCCC
T ss_conf             88776267435889998899999750777398860577


No 5  
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism]
Probab=100.00  E-value=0  Score=606.80  Aligned_cols=300  Identities=40%  Similarity=0.643  Sum_probs=280.1

Q ss_pred             CCEEEECCEECCCCEEECCCCC-CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHH
Q ss_conf             3116888733599748534688-867798887403675241020013687899886268842555410000247777788
Q gi|254780434|r   44 RLNTKVAGISLSNPLGMAAGYD-KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHT  122 (362)
Q Consensus        44 ~L~~~~~Gl~~~nPiglAaG~d-k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~  122 (362)
                      +|+++++|++|+||+|+|||+| |+++.+..+.+.||||+|+||+|++||+|||+||+||++++.+++|+|||||+|+++
T Consensus         1 ~l~~~~~Gl~f~NPl~lAaG~~~~~~~~~~~~~~~g~G~i~~ktvt~~pq~Gnp~PR~~~l~~~~~~iN~mG~~N~G~~~   80 (310)
T COG0167           1 DLSTEILGLKFPNPLGLAAGFDGKNGEELDALAALGFGAIVTKTVTPEPQEGNPKPRLFRLPEDEGLINRMGFNNPGADA   80 (310)
T ss_pred             CCCEEECCEECCCCCEECCCCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCEEEEECCCCCHHHHCCCCCHHHHH
T ss_conf             97403564664997767455786577899999855785699667777777899998178715753088754898652899


Q ss_pred             HHHHHHHHHHCC-CCCCEEECCCCC--HHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCC-CHHHHHHHHHHHHHH
Q ss_conf             999876410001-210001104542--4678877655542067552698303336532211000-023432111122444
Q gi|254780434|r  123 VFSRLSKIQPTS-PIGINLGANKDS--KDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQ-KKKNLERLLIHVMQT  198 (362)
Q Consensus       123 ~~~~l~~~~~~~-pi~vsI~~~~~s--~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~-~~~~l~~~l~~v~~~  198 (362)
                      +++++++.+... |++++|++|+.+  +++++||..+++++++ +||+|+|+|||||++++.+| +++.+.+++.++++.
T Consensus        81 ~~~~l~~~~~~~~~~~~~i~~~~~~~~~~~~~d~~~~~~~~~~-ad~ielNiScPnt~g~~~l~~~~e~l~~l~~~vk~~  159 (310)
T COG0167          81 FLEELKLAKYEGKPIGVNIGKNKGGPSEEAWADYARLLEEAGD-ADAIELNISCPNTPGGRALGQDPELLEKLLEAVKAA  159 (310)
T ss_pred             HHHHHHHHHHCCCCCCCCEEEECCCCCHHHHHHHHHHHHHCCC-CCEEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHC
T ss_conf             9999886400147767634887578857889999999975077-887999853899977466543999999999999863


Q ss_pred             HHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCC----CCCCCCCCCCCCCCCCHHHH
Q ss_conf             55655312688517865057777488899999876449829998066555323457----75446322113564542468
Q gi|254780434|r  199 REEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQC----SDNHEQDGGLSGSPLFLKST  274 (362)
Q Consensus       199 ~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~----~~~~~~~GGlSG~~i~~~al  274 (362)
                      .         ++||+|||+|  +.+++.++|+++.++|+||++++||+.+++..+.    +....+.|||||++|+|+|+
T Consensus       160 ~---------~~Pv~vKl~P--~~~di~~iA~~~~~~g~Dgl~~~NT~~~~~~i~~~~~~~~~~~~~GGLSG~~ikp~al  228 (310)
T COG0167         160 T---------KVPVFVKLAP--NITDIDEIAKAAEEAGADGLIAINTTKSGMKIDLETKKPVLANETGGLSGPPLKPIAL  228 (310)
T ss_pred             C---------CCCEEEEECC--CHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             5---------6865999388--8899999999999749858999700366553012345556676777757510027899


Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHCCCC
Q ss_conf             99999997408974899967889999999999839997545278770697899999999999999838997789616975
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIRGSYT  354 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~si~e~iG~~~  354 (362)
                      ++|+++|+++++++||||+|||+|++||+|||+|||++||||||++|+||.++++|.++|.+||+++||+||+|++|...
T Consensus       229 ~~v~~l~~~~~~~ipIIGvGGI~s~~DA~E~i~aGA~~vQv~Tal~~~Gp~i~~~I~~~l~~~l~~~g~~si~d~~G~~~  308 (310)
T COG0167         229 RVVAELYKRLGGDIPIIGVGGIETGEDALEFILAGASAVQVGTALIYKGPGIVKEIIKGLARWLEEKGFESIQDIIGSAL  308 (310)
T ss_pred             HHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCCHHEEEEEEEEECCHHHHHHHHHHHHHHHHCCCCCHHHHHCHHC
T ss_conf             99999998428997489846869699999999829756404112102085099999999999999819987999845330


Q ss_pred             H
Q ss_conf             2
Q gi|254780434|r  355 E  355 (362)
Q Consensus       355 ~  355 (362)
                      +
T Consensus       309 ~  309 (310)
T COG0167         309 R  309 (310)
T ss_pred             C
T ss_conf             5


No 6  
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase family protein; InterPro: IPR005720   Dihydroorotate dehydrogenase (1.3.3.1 from EC) (DHOdehase) catalyzes the fourth step in the de novo biosynthesis of pyrimidine, the conversion of dihydroorotate into orotate. DHOdehase is a ubiquitous FAD flavoprotein. In bacteria (gene pyrD), DHOdease is located on the inner side of the cytosolic membrane. In some yeasts, such as in Saccharomyces cerevisiae (gene URA1, subfamily 2), it is a cytosolic protein while in other eukaryotes it is found in the mitochondria .    This describes dihydroorotate dehydrogenases subfamily 1 that includes a number of uncharacterised proteins and a domain of dihydropyrimidine dehydrogenase.; GO: 0004158 dihydroorotate oxidase activity, 0006207 'de novo' pyrimidine base biosynthetic process, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=579.83  Aligned_cols=292  Identities=25%  Similarity=0.408  Sum_probs=263.4

Q ss_pred             CEEEECCEECCCCEEECCC-CCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHH
Q ss_conf             1168887335997485346-888677988874036752410200136878998862688425554100002477777889
Q gi|254780434|r   45 LNTKVAGISLSNPLGMAAG-YDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTV  123 (362)
Q Consensus        45 L~~~~~Gl~~~nPiglAaG-~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~  123 (362)
                      |+|++||++|+||++|||| ++-..+..++...-|+|+|+|||+|.+||+||+.||+.+.+  .+++|+|||+|||+|.+
T Consensus         1 Lev~l~Gi~~kNP~~lASG~~G~~~~~l~~~~~~gaGAVvTKs~g~~pr~Gy~nPtiVE~~--~G~lNAiGL~NPG~e~f   78 (308)
T TIGR01037         1 LEVELFGIRFKNPVILASGVMGSGVEALRRIDRSGAGAVVTKSIGLEPRPGYRNPTIVEVP--CGLLNAIGLQNPGVEAF   78 (308)
T ss_pred             CCEECCCCCCCCCCEEECCCCCCCHHHHHHHHCCCCCEEEECCEECCCCCCCCCCEEEECC--CCEEEECCCCCHHHHHH
T ss_conf             9111067021066102211036628899987505886378621331588854438079817--85575235898217999


Q ss_pred             HHHHHHHHHCCC-----CCCEEECCCCCHHHHHHHHHHHHHHC---CCCCEEEEECCCCCCCC---CCCCCCHHHHHHHH
Q ss_conf             998764100012-----10001104542467887765554206---75526983033365322---11000023432111
Q gi|254780434|r  124 FSRLSKIQPTSP-----IGINLGANKDSKDFILDYVSGIRLFF---TIASYFTINISSPNTPG---LRSLQKKKNLERLL  192 (362)
Q Consensus       124 ~~~l~~~~~~~p-----i~vsI~~~~~s~~~~~dy~~~~~~~~---~~aD~iEiNiSCPNt~g---~~~~~~~~~l~~~l  192 (362)
                      +++++....+.|     +++||-+.     ..+||++++++++   +|+|++|||+||||+++   ....|||+...+++
T Consensus        79 l~E~~~~~~e~~t~dvr~I~svyG~-----~~EEfa~va~~~e~A~~y~~~~ELN~SCPhvK~G~G~~iG~dP~l~~~vv  153 (308)
T TIGR01037        79 LEELKDVREEVPTHDVRLIASVYGE-----SEEEFAEVAEKLEDADPYVDAYELNVSCPHVKGGGGIEIGQDPELSADVV  153 (308)
T ss_pred             HHHHHHHHHCCCCCCEEEEEEECCC-----CCHHHHHHHHHHHHHHHHHEEEECCCCCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             9863256643898752899983188-----82258999998721134400001047774434234655477877999999


Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCC-CCC---CCCCCCCCCCCCCCCCCC
Q ss_conf             1224445565531268851786505777748889999987644982999806655-532---345775446322113564
Q gi|254780434|r  193 IHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTL-SRK---GVQCSDNHEQDGGLSGSP  268 (362)
Q Consensus       193 ~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~-~~~---~~~~~~~~~~~GGlSG~~  268 (362)
                      +++++.         +++||++|||||++  ++.++|++++++|+||+|++||+. .+.   ....|...+..||||||+
T Consensus       154 ~avK~~---------~d~Pv~aKLsPNV~--Di~eiA~a~eeaGaDGlt~INTl~PGMkIDI~~~kPiLaNk~GGlSGPA  222 (308)
T TIGR01037       154 KAVKDK---------VDVPVFAKLSPNVT--DITEIAKAAEEAGADGLTLINTLRPGMKIDIKAKKPILANKTGGLSGPA  222 (308)
T ss_pred             HHHHCC---------CCCCEEEECCCCHH--HHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHCCCCCCEECCCCCCCCC
T ss_conf             998300---------07865786486566--8999988875327761640012034677734207870000458850750


Q ss_pred             CCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCCCHHH
Q ss_conf             54246899999997408974899967889999999999839997545278770697899999999999999838997789
Q gi|254780434|r  269 LFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFEN  348 (362)
Q Consensus       269 i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~si~e  348 (362)
                      |+|+|+|+||++|+.+++++||||||||+||+||+|||+||||||||+||.+|+||.++.+|+++|.+||++.||+||+|
T Consensus       223 IKPiA~r~VYdly~~~ddriPIiGvGGi~~~eDA~Efl~AGAsAVQvGtAvyy~g~~~f~~i~~~l~~fl~~~~~~si~e  302 (308)
T TIGR01037       223 IKPIAVRMVYDLYKEVDDRIPIIGVGGITSFEDALEFLMAGASAVQVGTAVYYRGYKVFKKIIEGLIAFLKEEGFSSIEE  302 (308)
T ss_pred             CCCEEEEEHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCEEEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCCHHH
T ss_conf             14221210000477737823468632745589999999852202200022211775244888767889998728964477


Q ss_pred             HHCCCC
Q ss_conf             616975
Q gi|254780434|r  349 IRGSYT  354 (362)
Q Consensus       349 ~iG~~~  354 (362)
                      +||.+.
T Consensus       303 ~iG~Ah  308 (308)
T TIGR01037       303 LIGLAH  308 (308)
T ss_pred             HHCCCC
T ss_conf             401369


No 7  
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed
Probab=100.00  E-value=0  Score=564.71  Aligned_cols=291  Identities=25%  Similarity=0.351  Sum_probs=257.3

Q ss_pred             CCEEEECCEECCCCEEECCC-CCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHH
Q ss_conf             31168887335997485346-88867798887403675241020013687899886268842555410000247777788
Q gi|254780434|r   44 RLNTKVAGISLSNPLGMAAG-YDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHT  122 (362)
Q Consensus        44 ~L~~~~~Gl~~~nPiglAaG-~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~  122 (362)
                      +|+|+++|++|+|||++||| ||+|++.++.+.++||||+|+||||++||+|||+||+||++  .+++|+|||||+|+++
T Consensus         1 rL~~~~~Gl~f~nPi~lAAG~~~~~~~~~~~~~~~G~G~v~~kTit~~p~~Gnp~Pr~~~~~--~~~iN~~G~~n~G~~~   78 (301)
T PRK07259          1 RLSVNLPGLKLKNPVMPASGTFGFGGEYAKFYDLNGLGAIVTKSTTLEPREGNPTPRIAETP--GGMLNAVGLQNPGVDA   78 (301)
T ss_pred             CCEEEECCEECCCCCEECCCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEECC--CCCCCCCCCCCCCHHH
T ss_conf             96289799876997487766899999999999986975899172160402699998589666--2100346678835999


Q ss_pred             HHHHHHHHH--HCCCCCCEEECCCCCHHHHHHHHHHHHHHC--CCCCEEEEECCCCCCCC--CCCCCCHHHHHHHHHHHH
Q ss_conf             999876410--001210001104542467887765554206--75526983033365322--110000234321111224
Q gi|254780434|r  123 VFSRLSKIQ--PTSPIGINLGANKDSKDFILDYVSGIRLFF--TIASYFTINISSPNTPG--LRSLQKKKNLERLLIHVM  196 (362)
Q Consensus       123 ~~~~l~~~~--~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~--~~aD~iEiNiSCPNt~g--~~~~~~~~~l~~~l~~v~  196 (362)
                      +++++.+.+  .+.|+|+||+++     ..+||.++++.+.  ++|||+|||+|||||++  .+..++++.+.+++.+++
T Consensus        79 ~~~~~~~~~~~~~~pvi~si~~~-----~~~d~~~~~~~l~~~~~ad~ielNiScPn~~~~g~~~~~~~~~l~~i~~~v~  153 (301)
T PRK07259         79 FIEEELPWLEEFDTPIIANIAGS-----TPEEYVEVAEKLSKAPNVDAIELNISCPNVKHGGMAFGTDPELAYEVVKAVK  153 (301)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCC-----CHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHCCCCHHHHHHHHHHHH
T ss_conf             99999976420699879973767-----7689999999864556888899965478888526660879999999999998


Q ss_pred             HHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCC---CCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             4455655312688517865057777488899999876449829998066555323---4577544632211356454246
Q gi|254780434|r  197 QTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKG---VQCSDNHEQDGGLSGSPLFLKS  273 (362)
Q Consensus       197 ~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~---~~~~~~~~~~GGlSG~~i~~~a  273 (362)
                      .         ..++||+||||||++  ++.+++++++++|+||++++||+.+++.   ...+....+.|||||++++|++
T Consensus       154 ~---------~~~~Pv~vKlsP~~~--~i~~ia~~~~~~gadgvv~~Nt~~~~~id~~~~~p~~~~~~GGlSG~~l~~~a  222 (301)
T PRK07259        154 S---------VSKVPVIVKLTPNVT--DIVEIAKAAEEAGADGLSLINTLKGMAIDIKTRKPILANVTGGLSGPAIKPIA  222 (301)
T ss_pred             H---------HCCCCEEEEECCCHH--HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             7---------348977998078712--19999999997599889995677676532356774335788863473351899


Q ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHCCC
Q ss_conf             89999999740897489996788999999999983999754527877069789999999999999983899778961697
Q gi|254780434|r  274 TIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIRGSY  353 (362)
Q Consensus       274 l~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~si~e~iG~~  353 (362)
                      +++|+++++.+  ++||||+|||+|++||+|+|+||||+||+||+ +|+||.++++|++||.+||+++||+||+|+||.+
T Consensus       223 l~~v~~~~~~~--~ipIig~GGI~s~~da~e~i~aGAs~VQv~Ta-v~~Gp~~~~~i~~~L~~~l~~~G~~si~e~~G~a  299 (301)
T PRK07259        223 LRMVYQVAKAV--DIPIIGMGGISTAEDAIEFMMAGASAVQVGTA-NFIDPYAFPEIIEGLEAYLDEEGIKSIEEIIGIA  299 (301)
T ss_pred             HHHHHHHHHHC--CCCEEEECCCCCHHHHHHHHHCCCCHHHHHHH-HHCCCHHHHHHHHHHHHHHHHCCCCCHHHHHCHH
T ss_conf             99999998516--98889767979999999999839879872123-3149069999999999999984999899971813


Q ss_pred             CH
Q ss_conf             52
Q gi|254780434|r  354 TE  355 (362)
Q Consensus       354 ~~  355 (362)
                      .+
T Consensus       300 hr  301 (301)
T PRK07259        300 HK  301 (301)
T ss_pred             CC
T ss_conf             29


No 8  
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed
Probab=100.00  E-value=0  Score=560.68  Aligned_cols=295  Identities=24%  Similarity=0.341  Sum_probs=254.7

Q ss_pred             CCEEEECCEECCCCEEECCC-CCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHH
Q ss_conf             31168887335997485346-88867798887403675241020013687899886268842555410000247777788
Q gi|254780434|r   44 RLNTKVAGISLSNPLGMAAG-YDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHT  122 (362)
Q Consensus        44 ~L~~~~~Gl~~~nPiglAaG-~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~  122 (362)
                      +++|+++|++|+||||+||| +|+|++.++.+.++||||||+||||++||+|||+||+||++  .+++|+|||||+|+++
T Consensus         1 ~~st~~~Gl~f~NPi~lAaG~~~~~~e~~~~~~~~G~G~v~~kTit~~pq~GNp~PR~~r~~--~~~iN~~G~~n~G~~~   78 (308)
T PRK02506          1 STATQIAGFSFDNCLMNAAGVYCMTKEELEEVEASQAGSFVTKTATLEVRPGNPEPRYADTP--LGSINSMGLPNNGFDY   78 (308)
T ss_pred             CCCEEECCEECCCCCEECCCCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCEEEECC--CCHHHCCCCCCHHHHH
T ss_conf             98879899955998887867899899999999976973899542354576699998699767--5301215478563899


Q ss_pred             HHHHHHHHH---HCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCC-CHHHHHHHHHHHHHH
Q ss_conf             999876410---0012100011045424678877655542067552698303336532211000-023432111122444
Q gi|254780434|r  123 VFSRLSKIQ---PTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQ-KKKNLERLLIHVMQT  198 (362)
Q Consensus       123 ~~~~l~~~~---~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~-~~~~l~~~l~~v~~~  198 (362)
                      +++++.+.+   .+.|+++||.+.  +.+++.++.+.++. .+++|++|||+|||||+|++.++ +.+.+.+++.++...
T Consensus        79 ~~~~l~~~~~~~~~~~vi~si~g~--~~~e~~~~~~~~~~-~~~~~~ielNiScPNt~g~~~~~~d~~~~~~il~~v~~~  155 (308)
T PRK02506         79 YLDYVLDLQKTGPHKPHFLSVVGL--SPEETHTILKKIQA-SDFEGLVELNLSCPNVPGKPQIAYDFETTDQILTEVFTY  155 (308)
T ss_pred             HHHHHHHHHHHCCCCCEEEEEEEC--CHHHHHHHHHHHHH-CCCCCEEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHH
T ss_conf             999889999627999758888507--75377888999875-475425546333788510555522899999999999987


Q ss_pred             HHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCC----CCCCCCCCCCCCCCCCCHHHH
Q ss_conf             5565531268851786505777748889999987644982999806655532345----775446322113564542468
Q gi|254780434|r  199 REEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQ----CSDNHEQDGGLSGSPLFLKST  274 (362)
Q Consensus       199 ~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~----~~~~~~~~GGlSG~~i~~~al  274 (362)
                               .++||++|||||++..++.++++.+.+.++++++++||+.+...+.    ......+.|||||++|+|+|+
T Consensus       156 ---------~~~Pi~vKlsP~~~~~~~~~~a~~~~~~~~~~i~~~nt~~~~~~i~~~~~~~~~~~~~GGlSG~~l~~~al  226 (308)
T PRK02506        156 ---------FTKPLGVKLPPYFDIVHFDQAAAIFNKYPLAFVNCVNSIGNGLVIEDESVVIKPKNGFGGIGGDYIKPTAL  226 (308)
T ss_pred             ---------HHCCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCCEECCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             ---------50333455898777676999999856156537988702356620137751015678878877611337999


Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHCC
Q ss_conf             999999974089748999678899999999998399975452787706978999999999999998389977896169
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIRGS  352 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~si~e~iG~  352 (362)
                      ++|+++++++.+++||||||||+|++||+|||+||||+||+||+++|+||.++++|++||.+||+++||+||+|++|+
T Consensus       227 ~~v~~~~~~~~~~i~IIg~GGI~s~~Da~e~i~aGAs~VQv~Tal~~~Gp~~~~~I~~~L~~~l~~~G~~si~d~~G~  304 (308)
T PRK02506        227 ANVHAFYQRLKPSIQIIGTGGVKTGRDAFEHILCGASMVQVGTALHKEGPAIFERITKELKAIMVEKGYQSLEDFRGK  304 (308)
T ss_pred             HHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCCCEEEEEEEEEECCHHHHHHHHHHHHHHHHCCCCCHHHHCCE
T ss_conf             999999998389963898667078999999998198720684222045947999999999999998499988996544


No 9  
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain. DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively.
Probab=100.00  E-value=0  Score=552.56  Aligned_cols=287  Identities=25%  Similarity=0.387  Sum_probs=250.1

Q ss_pred             EEEECCEECCCCEEECCC-CCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHH
Q ss_conf             168887335997485346-8886779888740367524102001368789988626884255541000024777778899
Q gi|254780434|r   46 NTKVAGISLSNPLGMAAG-YDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVF  124 (362)
Q Consensus        46 ~~~~~Gl~~~nPiglAaG-~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~  124 (362)
                      +|+++|++|+||||+||| ++++.+..+.+...||||+|+||||++||+|||+||+||++  .+++|+|||||+|+++++
T Consensus         1 sv~~~Gl~~~nPi~lAAG~~~~~~~~~~~~~~~g~G~v~~~Tvt~~p~~Gn~~PR~~~~~--~~~iN~~G~~n~G~~~~~   78 (296)
T cd04740           1 SVELAGLRLKNPVILASGTFGFGEELSRVADLGKLGAIVTKSITLEPREGNPPPRVVETP--GGMLNAIGLQNPGVEAFL   78 (296)
T ss_pred             CEEECCEECCCCCEECCCCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCEEECC--HHHHHHCCCCCCCHHHHH
T ss_conf             968898857998787867899839999998858963899380470314589998178154--116765237888648999


Q ss_pred             HHHHHHH--HCCCCCCEEECCCCCHHHHHHHHHHHHHHCCC-CCEEEEECCCCCCCCC--CCCCCHHHHHHHHHHHHHHH
Q ss_conf             9876410--00121000110454246788776555420675-5269830333653221--10000234321111224445
Q gi|254780434|r  125 SRLSKIQ--PTSPIGINLGANKDSKDFILDYVSGIRLFFTI-ASYFTINISSPNTPGL--RSLQKKKNLERLLIHVMQTR  199 (362)
Q Consensus       125 ~~l~~~~--~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~-aD~iEiNiSCPNt~g~--~~~~~~~~l~~~l~~v~~~~  199 (362)
                      +++++.+  .+.|+++||++.     ..+||.++++.+.++ |||+|||+|||||+++  ...++++.+.+++.+++.  
T Consensus        79 ~~l~~~~~~~~~pvi~si~~~-----~~~d~~~~~~~~~~~gad~ielNiScPNt~~~g~~~~~~~~~~~~i~~~vk~--  151 (296)
T cd04740          79 EELLPWLREFGTPVIASIAGS-----TVEEFVEVAEKLADAGADAIELNISCPNVKGGGMAFGTDPEAVAEIVKAVKK--  151 (296)
T ss_pred             HHHHHHHCCCCCEEEEEECCC-----CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHCCCHHHHHHHHHHHHH--
T ss_conf             878986356897189981689-----8789999999988648988999788998676367757499999999999986--


Q ss_pred             HHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCC---CCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             5655312688517865057777488899999876449829998066555323---4577544632211356454246899
Q gi|254780434|r  200 EEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKG---VQCSDNHEQDGGLSGSPLFLKSTIA  276 (362)
Q Consensus       200 ~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~---~~~~~~~~~~GGlSG~~i~~~al~~  276 (362)
                             ..++||+||||||.+  ++.++++++.++|+|||+++||+..+..   ...+....+.|||||++++|+++++
T Consensus       152 -------~~~~Pi~vKlsP~~~--~i~~ia~~~~~~g~dgiv~~NT~~~~~id~~~~~p~l~~~~GGlSG~~l~~~al~~  222 (296)
T cd04740         152 -------ATDVPVIVKLTPNVT--DIVEIARAAEEAGADGLTLINTLKGMAIDIETRKPILGNVTGGLSGPAIKPIALRM  222 (296)
T ss_pred             -------CCCCCEEEECCCCCC--HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             -------048966997189800--09999999997699889997467876636444675524557876867788999999


Q ss_pred             HHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHCCC
Q ss_conf             99999740897489996788999999999983999754527877069789999999999999983899778961697
Q gi|254780434|r  277 LAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIRGSY  353 (362)
Q Consensus       277 i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~si~e~iG~~  353 (362)
                      |+++++.+  ++||||||||+|++||+|+|+||||+||+||+ +|+||.++++|++||.+||++|||+||+|+||.+
T Consensus       223 v~~~~~~~--~ipIig~GGI~s~~da~e~i~aGAs~VQi~Ta-i~~Gp~~i~~i~~~L~~~l~~~G~~si~e~~G~a  296 (296)
T cd04740         223 VYQVYKAV--EIPIIGVGGIASGEDALEFLMAGASAVQVGTA-NFVDPEAFKEIIEGLEAYLDEEGIKSIEELVGLA  296 (296)
T ss_pred             HHHHHHHC--CCCEEEECCCCCHHHHHHHHHCCCCHHHHHHH-HHCCHHHHHHHHHHHHHHHHHCCCCCHHHHCCCC
T ss_conf             99998545--88879757979999999999839988872366-7429279999999999999983999899950359


No 10 
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain. DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively.
Probab=100.00  E-value=0  Score=515.89  Aligned_cols=278  Identities=25%  Similarity=0.310  Sum_probs=242.0

Q ss_pred             EEECCEECCCCEEECCC-CCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHH
Q ss_conf             68887335997485346-88867798887403675241020013687899886268842555410000247777788999
Q gi|254780434|r   47 TKVAGISLSNPLGMAAG-YDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFS  125 (362)
Q Consensus        47 ~~~~Gl~~~nPiglAaG-~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~  125 (362)
                      |++.|++|+|||++||| +|+|+|+++.++++||||||+||||++||+|||+||+||++  .+++|+|||+|+|+|++++
T Consensus         1 vt~~Gl~~~NPi~~AaG~~~~~~e~~~~l~~~G~G~v~~kTit~~p~~GNp~PR~~r~~--~~~iN~~G~~n~G~~~~~~   78 (294)
T cd04741           1 VTPPGLTISPPLMNAAGPWCTTLEDLLELAASSTGAVTTRSSTLAGRPGNPEPRYYAFP--LGSINSLGLPNLGLDYYLE   78 (294)
T ss_pred             CCCCCCCCCCCCEECCCCCCCCHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCEEEECC--CHHHHHCCCCCCCHHHHHH
T ss_conf             90689828997887458999999999999976960999284387677799998488555--1466644478848899999


Q ss_pred             HHHHHH-----HCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCC-CHHHHHHHHHHHHHHH
Q ss_conf             876410-----0012100011045424678877655542067552698303336532211000-0234321111224445
Q gi|254780434|r  126 RLSKIQ-----PTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQ-KKKNLERLLIHVMQTR  199 (362)
Q Consensus       126 ~l~~~~-----~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~-~~~~l~~~l~~v~~~~  199 (362)
                      ++++.+     .+.|+++||+++  ++|.+++|..+++....++||+|||+|||||++.+.++ +.+.+.+++.+++.  
T Consensus        79 ~l~~~~~~~~~~~~pvi~si~g~--~~d~~~~~~~~~~~~~~~aD~ielNiScPn~~g~~~~~~~~~~~~~~~~~v~~--  154 (294)
T cd04741          79 YIRTISDGLPGSAKPFFISVTGS--AEDIAAMYKKIAAHQKQFPLAMELNLSCPNVPGKPPPAYDFDATLEYLTAVKA--  154 (294)
T ss_pred             HHHHHHHHCCCCCCCEEEECCCC--CHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCHHHCCCHHHHHHHHHHHHH--
T ss_conf             99998654655587089989998--36799999999865225564799970378988731001399999999999984--


Q ss_pred             HHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHC--CCCEEEEECCCCCCCCC------CCCCCCCCCCCCCCCCCCH
Q ss_conf             565531268851786505777748889999987644--98299980665553234------5775446322113564542
Q gi|254780434|r  200 EEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSH--KVEGIIVSNTTLSRKGV------QCSDNHEQDGGLSGSPLFL  271 (362)
Q Consensus       200 ~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~--g~dGiv~~NT~~~~~~~------~~~~~~~~~GGlSG~~i~~  271 (362)
                             ..++||++|||||.+.+++..+++++.++  ++++++++||+.....+      .......+.|||||++|+|
T Consensus       155 -------~~~~Pv~vKlsP~~~~~~~~~~~~~~~~~~~g~~~i~~~nt~~~~l~id~~~~~~~~~~~~~~GGlSG~~l~p  227 (294)
T cd04741         155 -------AYSIPVGVKTPPYTDPAQFDTLAEALNAFACPISFITATNTLGNGLVLDPERETVVLKPKTGFGGLAGAYLHP  227 (294)
T ss_pred             -------CCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
T ss_conf             -------1578559972898887899999999865788747999880367763335776564334556666667852158


Q ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             468999999974089748999678899999999998399975452787706978999999999999
Q gi|254780434|r  272 KSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDF  337 (362)
Q Consensus       272 ~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~  337 (362)
                      +++++|+++|+.++++++|||||||+|++||+|||+||||+||+|||++|+||.++++|++||++.
T Consensus       228 ~al~~v~~~~~~~~~~i~Iig~GGI~s~~da~e~i~aGAs~VQv~Tal~~~Gp~~~~~I~~~L~el  293 (294)
T cd04741         228 LALGNVRTFRRLLPSEIQIIGVGGVLDGRGAFRMRLAGASAVQVGTALGKEGPKVFARIEKELEDI  293 (294)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             999999999997499987999899799999999998399799997999970929999999879965


No 11 
>PRK08318 dihydropyrimidine dehydrogenase; Validated
Probab=100.00  E-value=0  Score=509.16  Aligned_cols=298  Identities=20%  Similarity=0.277  Sum_probs=249.6

Q ss_pred             CCCEEEECCEECCCCEEECCC-CCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCC---
Q ss_conf             631168887335997485346-8886779888740367524102001368789988626884255541000024777---
Q gi|254780434|r   43 PRLNTKVAGISLSNPLGMAAG-YDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNA---  118 (362)
Q Consensus        43 ~~L~~~~~Gl~~~nPiglAaG-~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~---  118 (362)
                      .||+|+|+|++|+|||++||| +..+++.++++++.||||||+||++ .|+.+|++||++++..  ...|.+||+|.   
T Consensus         2 ~DLst~~~Gl~lkNP~~lASgp~t~~~~~i~~~~~aG~GaVV~KTl~-~~~~~~~~pr~~~~~~--~~~~~~G~~N~eli   78 (413)
T PRK08318          2 ADLSITFCGIKSPNPFWLASAPPTNKYYNVARAFEAGWGGVVWKTLG-PFIVNVSSPRFDALVK--EDRRFIGFNNIELI   78 (413)
T ss_pred             CCCEEEECCEECCCCCEECCCCCCCCHHHHHHHHHCCCEEEEECCCC-CCCCCCCCCCEEEECC--CCCCCCCCCCCCCC
T ss_conf             86228889998189767898678899999999987695399905078-7677889998257357--76242362374213


Q ss_pred             ---CHHHHHHHHHHHHH---CCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCC-----CCHHH
Q ss_conf             ---77889998764100---01210001104542467887765554206755269830333653221100-----00234
Q gi|254780434|r  119 ---GYHTVFSRLSKIQP---TSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSL-----QKKKN  187 (362)
Q Consensus       119 ---G~~~~~~~l~~~~~---~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~-----~~~~~  187 (362)
                         +++++++++++.+.   +.|+++||+++. ++++|.++++.++..+  ||+||||+||||+++.+.+     |+++.
T Consensus        79 sd~~le~~L~~i~~~k~~~P~~~vIaSI~g~~-~~e~w~~la~~~e~~G--aDalELNiSCPn~~~~~~~G~~~gq~pe~  155 (413)
T PRK08318         79 TDRPLEVNLREIRRVKRDYPDRALIASIMVEC-NEEEWKEIAPLVEETG--ADGIELNFGCPHGMSERGMGSAVGQVPEL  155 (413)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCEEEEEEECCC-CHHHHHHHHHHHHHCC--CCEEEEECCCCCCCCCCCCCHHHCCCHHH
T ss_conf             44589999999999886078970899994587-8899999999866518--87799955567766666555110579999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCC--------CCC
Q ss_conf             321111224445565531268851786505777748889999987644982999806655532345775--------446
Q gi|254780434|r  188 LERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSD--------NHE  259 (362)
Q Consensus       188 l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~--------~~~  259 (362)
                      +.+++.+         ++..+++|+++|||||++  ++.++|++++++|+|||+++||+.+..+++.+.        ...
T Consensus       156 v~~i~~~---------Vk~~~~iPV~vKLsPnvt--di~~iA~aa~~aGADgv~liNTi~~~~~iDid~~~~~p~i~~~~  224 (413)
T PRK08318        156 VEMVTRW---------VKRGSRLPVIAKLTPNIT--DIREPARAAKRGGADAVSLINTINSITGVDLDRMIPMPIVNGKS  224 (413)
T ss_pred             HHHHHHH---------HHHHCCCCEEEEECCCCC--CHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCEEECCCCC
T ss_conf             9999999---------885068856998289975--28999999997699889998147865532022355302106777


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHCC-CCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             32211356454246899999997408-97489996788999999999983999754527877069789999999999999
Q gi|254780434|r  260 QDGGLSGSPLFLKSTIALAKIRQRVG-PKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFL  338 (362)
Q Consensus       260 ~~GGlSG~~i~~~al~~i~~i~~~~~-~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l  338 (362)
                      .+|||||++++|+++++|+++++... +++||||+|||+||+||+|||+|||++||||||++++||.++.+|++||++||
T Consensus       225 ~~GGlSG~aikPiALr~V~~i~~~~~~~~ipIiG~GGI~s~~Da~e~ilaGAsaVQv~Ta~~~~G~~ii~~i~~gL~~~m  304 (413)
T PRK08318        225 SHGGYCGPAVKPIALNMVAEIARDPETRGLPISGIGGIETWRDAAEFILLGAGTVQVCTAAMQYGFRIVEDMISGLSHYM  304 (413)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHCCCHHHHHHHHHHHHHH
T ss_conf             76766645676999999999986346788377975685989999999982789216751014338448999999999999


Q ss_pred             HHCCCCCHHHHHCCCCHHH
Q ss_conf             9838997789616975266
Q gi|254780434|r  339 NKENEVNFENIRGSYTEYW  357 (362)
Q Consensus       339 ~~~G~~si~e~iG~~~~~~  357 (362)
                      ++|||+||+|++|.++++.
T Consensus       305 ~~~G~~si~d~~G~a~~~~  323 (413)
T PRK08318        305 DEKGFASLEDMVGLAVPNV  323 (413)
T ss_pred             HHCCCCCHHHHHCCCCCCC
T ss_conf             9809974888725265776


No 12 
>pfam01180 DHO_dh Dihydroorotate dehydrogenase.
Probab=100.00  E-value=0  Score=503.61  Aligned_cols=277  Identities=38%  Similarity=0.616  Sum_probs=231.8

Q ss_pred             CEEEECCEECCCCEEECCCCCCCHHHH-HHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHH
Q ss_conf             116888733599748534688867798-8874036752410200136878998862688425554100002477777889
Q gi|254780434|r   45 LNTKVAGISLSNPLGMAAGYDKNAEVP-IELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTV  123 (362)
Q Consensus        45 L~~~~~Gl~~~nPiglAaG~dk~~~~~-~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~  123 (362)
                      |+|+|+|++|+|||++|||+|++++.+ +.+...||||+|+||||++||.|||+||++|++  ++++|++||+|+|+|++
T Consensus         2 L~t~~~Gl~~~nPi~lAsG~~~~~~~~~~~~~~~g~G~vv~ktit~~~~~gnp~Pr~~~~~--~~~~n~~G~~n~g~~~~   79 (290)
T pfam01180         2 LAVKIPGLKFKNPIGLASGFDKFGEEALKWLALGKFGAIEIKSVTPEPQPGNPTPRVFRLP--EGVLNAMGLNNPGLDAV   79 (290)
T ss_pred             EEEEECCEECCCCCEECCCCCCCCHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCEEEECC--CHHHHHCCCCCCHHHHH
T ss_conf             5699899887998788867688869999998718967799483485626699987799837--01442156577307999


Q ss_pred             HHHHHHHH----HCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99876410----00121000110454246788776555420675526983033365322110000234321111224445
Q gi|254780434|r  124 FSRLSKIQ----PTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTR  199 (362)
Q Consensus       124 ~~~l~~~~----~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~  199 (362)
                      ++++.+.+    .+.|+++|+++.     ..+||.+++++++++|||+|||+|||||++++.+++...+...+....   
T Consensus        80 ~~~~~~~~~~~~~~~~vi~si~g~-----~~~d~~~~~~~~~~~ad~iElNiScPn~~~~~~~~~~~~~~~~i~~~v---  151 (290)
T pfam01180        80 LEELLKRRKEYPRPLGIILSKAGS-----TVEDYVEVARKIGPFADYLELNVSCPNTPGLRALQTDPELAAILLKVV---  151 (290)
T ss_pred             HHHHHHHHHHCCCCCEEEEECCCC-----CHHHHHHHHHHHHHHCCEEEEEEECCCCCCCHHHCCCHHHHHHHHHHH---
T ss_conf             999998777538885378624669-----999999999999743588999985368876133404298999999998---


Q ss_pred             HHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHH---HCCCCEEEEECCCCCCCCCCC----CCCCCCCCCCCCCCCCHH
Q ss_conf             5655312688517865057777488899999876---449829998066555323457----754463221135645424
Q gi|254780434|r  200 EEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVL---SHKVEGIIVSNTTLSRKGVQC----SDNHEQDGGLSGSPLFLK  272 (362)
Q Consensus       200 ~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~---~~g~dGiv~~NT~~~~~~~~~----~~~~~~~GGlSG~~i~~~  272 (362)
                           +...++||++|||||.++.  ..++.+++   +.|++|++++||+..++..+.    +....++||+||++++|+
T Consensus       152 -----~~~~~~Pv~vKlsp~~~~~--~~~~~a~~~~~a~gv~gi~~~nt~~~~~~~d~~~~~~~~~~~~GGlSG~~i~~~  224 (290)
T pfam01180       152 -----KEVSKVPVLVKLAPDLTDI--VIIDIADVAAGEDGLTGINATNTTVRGMRIDLKTESPILANGTGGLSGPAIKPI  224 (290)
T ss_pred             -----HHCCCCCEEEEECCCCCCH--HHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             -----7504787389838987746--899999997183776899965873465555555666312567888576067899


Q ss_pred             HHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             689999999740897489996788999999999983999754527877069789999999999999
Q gi|254780434|r  273 STIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFL  338 (362)
Q Consensus       273 al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l  338 (362)
                      ++++|+++++++++++||||+|||+|++||+|||+||||+||+||+++|+||.++++|++||++||
T Consensus       225 al~~v~~~~~~~~~~ipIig~GGI~~~~da~e~i~aGA~~VQv~Tal~~~Gp~~i~~i~~~L~~~m  290 (290)
T pfam01180       225 ALKVIRELYQRVGPEIPIIGVGGIFTGEDALEKILAGASAVQIGTALIFGGPFIFPKIIDELPELL  290 (290)
T ss_pred             HHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHC
T ss_conf             999999999970899749998894999999999983997999858998419179999999999759


No 13 
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain.  DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively. DHPD catalyzes the first step in pyrimidine degradation: the NADPH-dependent reduction of uracil and thymine to the corresponding 5,6-dihydropyrimidines. DHPD contains two FAD, two FMN and eight [4Fe-4S] clusters, arranged in two electron transfer chains that pass its homodimeric interface twice. Two of
Probab=100.00  E-value=0  Score=501.55  Aligned_cols=273  Identities=33%  Similarity=0.501  Sum_probs=239.8

Q ss_pred             EEECCEECCCCEEECCCCC-CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEE-------CCCCCEEECCCCCC
Q ss_conf             6888733599748534688-867798887403675241020013687899886268842-------55541000024777
Q gi|254780434|r   47 TKVAGISLSNPLGMAAGYD-KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLT-------KDRAIINKLGFNNA  118 (362)
Q Consensus        47 ~~~~Gl~~~nPiglAaG~d-k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~-------~~~~iiN~~Gl~N~  118 (362)
                      |+|+|++|+||||+|||++ ++++.++.+.++||||+|+||||++||+|||+||+||++       ++.+++|++||+|+
T Consensus         1 V~~~Gl~l~nPi~~aAG~~~~~~~~~~~~~~~G~G~vv~ktit~~~~~gn~~Pr~~~~~~~~~~~~~~~~~~N~~g~~n~   80 (289)
T cd02810           1 VNFLGLKLKNPFGVAAGPLLKTGELIARAAAAGFGAVVYKTVTLHPRPGNPLPRVARLPPEGESYPEQLGILNSFGLPNL   80 (289)
T ss_pred             CEECCEECCCCCEECCCCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCEEEEECCCCCCCCCCCCEECCCCCCCC
T ss_conf             96699828998888977888998999999976987899273572201589875188703666567551036215546787


Q ss_pred             CHHHHHHHHHHHH---HCCCCCCEEECCCCCHHHHHHHHHHHHHHCC-CCCEEEEECCCCCCCCCCCC-CCHHHHHHHHH
Q ss_conf             7788999876410---0012100011045424678877655542067-55269830333653221100-00234321111
Q gi|254780434|r  119 GYHTVFSRLSKIQ---PTSPIGINLGANKDSKDFILDYVSGIRLFFT-IASYFTINISSPNTPGLRSL-QKKKNLERLLI  193 (362)
Q Consensus       119 G~~~~~~~l~~~~---~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~-~aD~iEiNiSCPNt~g~~~~-~~~~~l~~~l~  193 (362)
                      |.+.+++++++.+   ++.|+++||+++  +.   +||.++++.+.+ .||++|+|+|||||++++.+ ++++.+.+++.
T Consensus        81 g~~~~~~~l~~~~~~~~~~pli~Si~~~--~~---~~~~~~a~~~~~~gad~lElNiScPn~~~~~~~~~~~~~~~~i~~  155 (289)
T cd02810          81 GLDVWLQDIAKAKKEFPGQPLIASVGGS--SK---EDYVELARKIERAGAKALELNLSCPNVGGGRQLGQDPEAVANLLK  155 (289)
T ss_pred             CHHHHHHHHHHHHHCCCCCEEEEECCCC--CH---HHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHH
T ss_conf             8899999999998617995399978889--87---899999999998479848998403675655320149999999999


Q ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCC---CCCCCCCCCCCCCCCCC
Q ss_conf             224445565531268851786505777748889999987644982999806655532345---77544632211356454
Q gi|254780434|r  194 HVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQ---CSDNHEQDGGLSGSPLF  270 (362)
Q Consensus       194 ~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~---~~~~~~~~GGlSG~~i~  270 (362)
                      +++..         .++||++|||||.+..++.++++++.++|+||++++||+..+....   ........||+||++++
T Consensus       156 ~v~~~---------~~~Pv~vKLsp~~~~~~~~~ia~~~~~~ga~gv~~~Nt~~~~~~~~~~~~~~~~~~~gGlSG~~i~  226 (289)
T cd02810         156 AVKAA---------VDIPLLVKLSPYFDLEDIVELAKAAERAGADGLTAINTISGRVVDLKTVGPGPKRGTGGLSGAPIR  226 (289)
T ss_pred             HHHHC---------CCCCEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             99860---------268748842788761689999999997599689996787765554444554456776523662778


Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHH
Q ss_conf             246899999997408974899967889999999999839997545278770697899999999
Q gi|254780434|r  271 LKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQG  333 (362)
Q Consensus       271 ~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~  333 (362)
                      |+++++|+++|+.++.++||||+|||+|++||+|||+||||+||+||+++|+||.++++|++|
T Consensus       227 ~~al~~v~~~~~~~~~~i~Iig~GGI~~~~da~e~i~aGA~~Vqv~Tal~~~Gp~ii~~i~~E  289 (289)
T cd02810         227 PLALRWVARLAARLQLDIPIIGVGGIDSGEDVLEMLMAGASAVQVATALMWDGPDVIRKIKKE  289 (289)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHHCHHHHHHHHCC
T ss_conf             899999999999749996099989939999999999849979999899997586999998639


No 14 
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain.  DHPD catalyzes the first step in pyrimidine degradation: the NADPH-dependent reduction of uracil and thymine to the corresponding 5,6-dihydropyrimidines. DHPD contains two FAD, two FMN, and eight [4Fe-4S] clusters, arranged in two electron transfer chains that pass the dimer interface twice. Two of the Fe-S clusters show a hitherto unobserved coordination involving a glutamine residue.
Probab=100.00  E-value=0  Score=497.23  Aligned_cols=274  Identities=23%  Similarity=0.353  Sum_probs=228.0

Q ss_pred             CCEEEECCEECCCCEEECCC-CCCCHHHHHHHHHCCCCEEECCCCCC-CCCCCCCCCCEEEEECCCCCEEECCCCC----
Q ss_conf             31168887335997485346-88867798887403675241020013-6878998862688425554100002477----
Q gi|254780434|r   44 RLNTKVAGISLSNPLGMAAG-YDKNAEVPIELLKLGFGFVEIGTVTP-HPQAGNPRPRVFRLTKDRAIINKLGFNN----  117 (362)
Q Consensus        44 ~L~~~~~Gl~~~nPiglAaG-~dk~~~~~~~l~~~G~G~v~~ktit~-~p~~GNp~PR~~r~~~~~~iiN~~Gl~N----  117 (362)
                      ||+|+++|++|+||||+||| ++++++.++.+.++||||+|+||||+ +||.|||+||+||++.+.  .|++||+|    
T Consensus         1 dL~t~~~Gl~~~nPi~lAAG~~~~~~~~~~~~~~~G~G~vv~ktit~~~~~~gn~~PR~~r~~~~~--~~~~g~~n~~~~   78 (299)
T cd02940           1 DLSVTFCGIKFPNPFGLASAPPTTSYPMIRRAFEAGWGGAVTKTLGLDKDIVTNVSPRIARLRTSG--RGQIGFNNIELI   78 (299)
T ss_pred             CCCEEECCEECCCCCEECCCCCCCCHHHHHHHHHCCCCEEECCEECCCCCCCCCCCCCEEECCCCH--HHHCCCCCCHHH
T ss_conf             998788999889986878778998999999999879888991568988788899998789887662--552133784012


Q ss_pred             --CCHHHHHHHHHHHHH---CCCCCCEEECCCCCHHHHHHHHHHHHHHCC-CCCEEEEECCCCCCCCCCCC-----CCHH
Q ss_conf             --777889998764100---012100011045424678877655542067-55269830333653221100-----0023
Q gi|254780434|r  118 --AGYHTVFSRLSKIQP---TSPIGINLGANKDSKDFILDYVSGIRLFFT-IASYFTINISSPNTPGLRSL-----QKKK  186 (362)
Q Consensus       118 --~G~~~~~~~l~~~~~---~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~-~aD~iEiNiSCPNt~g~~~~-----~~~~  186 (362)
                        .+.+++++++++.+.   +.|+++||.+.. +   .+||.++++.+.+ +|||+|||+|||||++++.+     ++++
T Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~~~i~si~~~~-~---~~~~~~~a~~~~~~gad~lElNiScPN~~~~~~~g~~~~~~~~  154 (299)
T cd02940          79 SEKPLEYWLKEIRELKKDFPDKILIASIMCEY-N---KEDWTELAKLVEEAGADALELNFSCPHGMPERGMGAAVGQDPE  154 (299)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC-C---HHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHCCCHH
T ss_conf             12029999999999875279973798851789-8---7899999999987188889982678898761234555244999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCC--------CC
Q ss_conf             4321111224445565531268851786505777748889999987644982999806655532345775--------44
Q gi|254780434|r  187 NLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSD--------NH  258 (362)
Q Consensus       187 ~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~--------~~  258 (362)
                      .+.+++.+++         ...++|+++|||||++  ++.+++++++++|+||++++||+..+.++..+.        ..
T Consensus       155 ~l~~i~~~v~---------~~~~~Pi~vKLsP~~~--~i~~ia~~~~~~gadgiv~~Nt~~~~~~i~~d~~~~~~~~~~~  223 (299)
T cd02940         155 LVEEICRWVR---------EAVKIPVIAKLTPNIT--DIREIARAAKEGGADGVSAINTVNSLMGVDLDGTPPAPGVEGK  223 (299)
T ss_pred             HHHHHHHHHH---------HHCCCCEEEECCCCHH--HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             9999999998---------6247864896288715--4999999999859989999766677565442235666564567


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             6322113564542468999999974089748999678899999999998399975452787706978999999999
Q gi|254780434|r  259 EQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       259 ~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                      ...||+||++++|+++++|+++|+.+++++||||||||+|++||+|||+||||+||+||+++|+||+++++|++||
T Consensus       224 ~~~GGlSG~~l~~~al~~v~~i~~~~~~~i~Iig~GGI~s~~Da~e~i~aGAs~Vqv~Tal~~~Gp~~i~~I~~gL  299 (299)
T cd02940         224 TTYGGYSGPAVKPIALRAVSQIARAPEPGLPISGIGGIESWEDAAEFLLLGASVVQVCTAVMNQGFTIVDDMCTGL  299 (299)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHCCHHHHHHHHCCC
T ss_conf             7778455878899999999999996489977899899599999999998499899998999980989999997219


No 15 
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins.  DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively.  This subgroup has the conserved FMN binding site, but lacks some catalytic residues and may therefore be inactive.
Probab=100.00  E-value=0  Score=482.43  Aligned_cols=295  Identities=20%  Similarity=0.254  Sum_probs=240.7

Q ss_pred             CCEEEECCEECCCCEEECCC-CCCCHHHHHHHHHCCCCEEECCCCCCC------CCCCCCCCCEEEEECCCCCEEECCCC
Q ss_conf             31168887335997485346-888677988874036752410200136------87899886268842555410000247
Q gi|254780434|r   44 RLNTKVAGISLSNPLGMAAG-YDKNAEVPIELLKLGFGFVEIGTVTPH------PQAGNPRPRVFRLTKDRAIINKLGFN  116 (362)
Q Consensus        44 ~L~~~~~Gl~~~nPiglAaG-~dk~~~~~~~l~~~G~G~v~~ktit~~------p~~GNp~PR~~r~~~~~~iiN~~Gl~  116 (362)
                      ||+|+++|++|+|||++||| ++++++.++.+.+.|||++|+||++.+      ++.+++.++-.+.++..+++|++||+
T Consensus         1 DLst~~~Gl~l~NPi~~ASg~~~~~~e~~~~~~~~G~Gavv~KSi~~e~i~~~~~~~~~~~~~~~~~~~~~~~~n~~g~~   80 (325)
T cd04739           1 DLSTTYLGLSLKNPLVASASPLSRNLDNIRRLEDAGAGAIVLPSLFEEQIEREAQELDRFLTYGSSFAEALSYFPEYGRY   80 (325)
T ss_pred             CCCEEECCEECCCCCEECCCCCCCCHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCC
T ss_conf             98579899967998885652568999999999985967999795674234567788898888998871121403321455


Q ss_pred             CCCHHHHHHHHHHHHH--CCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCC-CCCCHHHHHHHHH
Q ss_conf             7777889998764100--012100011045424678877655542067552698303336532211-0000234321111
Q gi|254780434|r  117 NAGYHTVFSRLSKIQP--TSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLR-SLQKKKNLERLLI  193 (362)
Q Consensus       117 N~G~~~~~~~l~~~~~--~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~-~~~~~~~l~~~l~  193 (362)
                      |+|+|.+++++++.+.  +.|+++||++.  +.++|.||++.++.+.  +|++|||+||||+.... ..+..+.+.+++.
T Consensus        81 n~g~e~~l~~i~~~~~~~~~pvI~Si~g~--s~ee~~~~a~~~~~~g--ad~lElNls~~~~~~~~~~~~~~~~~~~iv~  156 (325)
T cd04739          81 NLGPEEYLELIRRAKRAVSIPVIASLNGV--SAGGWVDYARQIEEAG--ADALELNIYALPTDPDISGAEVEQRYLDILR  156 (325)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCEEEEECCC--CHHHHHHHHHHHHHCC--CCEEEEECCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             75899999999998753598759871689--9899999999997649--9879996566788855442106889999999


Q ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCC-CCCCCCCCCCCCHH
Q ss_conf             22444556553126885178650577774888999998764498299980665553234577544-63221135645424
Q gi|254780434|r  194 HVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNH-EQDGGLSGSPLFLK  272 (362)
Q Consensus       194 ~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~-~~~GGlSG~~i~~~  272 (362)
                      ++         +...++|||||||||.+  ++.+++++++++|+||++++||+..++ ++..... ....++||++++++
T Consensus       157 ~V---------k~~~~~Pv~vKLsP~~~--di~~ia~aa~~~GAdgi~liNT~~~~~-id~~~~~~~~~~~lSg~~~~~~  224 (325)
T cd04739         157 AV---------KSAVTIPVAVKLSPFFS--ALAHMAKQLDAAGADGLVLFNRFYQPD-IDLETLEVVPNLLLSSPAEIRL  224 (325)
T ss_pred             HH---------HHCCCCCEEEECCCCCC--HHHHHHHHHHHCCCCEEEEECCCCCCC-CCCCCCEEECCCCCCCCCCCHH
T ss_conf             99---------86078866995399830--099999999975998899735766564-2167641536877457530068


Q ss_pred             HHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHCC
Q ss_conf             68999999974089748999678899999999998399975452787706978999999999999998389977896169
Q gi|254780434|r  273 STIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIRGS  352 (362)
Q Consensus       273 al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~si~e~iG~  352 (362)
                      ++++|+++++.+  ++||||+|||+||+||+|||+||||+||||||++++||.++++|++||.+||++|||+||+|+||+
T Consensus       225 alr~v~~~~~~~--~ipIiG~GGI~s~~Da~e~ilAGAsaVQv~TA~~~~G~~i~~~i~~eL~~~m~~~G~~si~e~~Gk  302 (325)
T cd04739         225 PLRWIAILSGRV--KASLAASGGVHDAEDVVKYLLAGADVVMTTSALLRHGPDYIGTLLAGLEAWMEEHGYESVQQLRGS  302 (325)
T ss_pred             HHHHHHHHHCCC--CCCEEEECCCCCHHHHHHHHHCCCCHHHEEHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHCCC
T ss_conf             899999996468--989888889598999999998098876143234641837999999999999998399979996273


Q ss_pred             CCHH
Q ss_conf             7526
Q gi|254780434|r  353 YTEY  356 (362)
Q Consensus       353 ~~~~  356 (362)
                      -.++
T Consensus       303 l~~~  306 (325)
T cd04739         303 MSQK  306 (325)
T ss_pred             CCCC
T ss_conf             4545


No 16 
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed
Probab=100.00  E-value=0  Score=471.73  Aligned_cols=292  Identities=20%  Similarity=0.269  Sum_probs=237.9

Q ss_pred             CCEEEECCEECCCCEEECCC-CCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCE--------EEEECCCCCEEECC
Q ss_conf             31168887335997485346-8886779888740367524102001368789988626--------88425554100002
Q gi|254780434|r   44 RLNTKVAGISLSNPLGMAAG-YDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRV--------FRLTKDRAIINKLG  114 (362)
Q Consensus        44 ~L~~~~~Gl~~~nPiglAaG-~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~--------~r~~~~~~iiN~~G  114 (362)
                      ||+|+|+|++|+|||++||| ++++++.++.+.+.||||+|+||++.+ +..|+.++.        ++.++..+++|++|
T Consensus         2 DLst~~~Gl~lkNPii~aSg~~~~~~~~~~~~~~~G~GavV~Ksi~~e-~i~~~~~~~~~~~~~~~~~~~~~~g~~n~~g   80 (333)
T PRK07565          2 DLSTTYLGLSLRNPLVASASPLTESLDNVKRLEDAGAGAVVLKSLFEE-QIRHEAAELARHLTQGTESYAEALDYFPEPA   80 (333)
T ss_pred             CCCEEECCEECCCCCEECCCCCCCCHHHHHHHHHCCCEEEEECCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             663888999669988866605799999999999859619996877610-1457777778888889867533345314234


Q ss_pred             CCCCCHHHHHHHHHHHHH--CCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCC-CCCCCCHHHHHHH
Q ss_conf             477777889998764100--0121000110454246788776555420675526983033365322-1100002343211
Q gi|254780434|r  115 FNNAGYHTVFSRLSKIQP--TSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPG-LRSLQKKKNLERL  191 (362)
Q Consensus       115 l~N~G~~~~~~~l~~~~~--~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g-~~~~~~~~~l~~~  191 (362)
                      ++|+|+|++++.+++.+.  +.|+|+||++.  +.++|.||++.++.+  ++|++|||+||||+.. .+..+.++.+.++
T Consensus        81 ~~n~g~e~~l~~i~~~k~~~~~pvIaSi~g~--s~ee~~~~a~~~e~~--gadaiElNis~~~~~~~~~~~~~~~~~~~i  156 (333)
T PRK07565         81 YFRGGPEEYLELIRRAKEAVDIPVIASLNGS--SAGGWVDYARQIEEA--GADALELNIYYLPTDPDISGAEVEQRYLDI  156 (333)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCCEEEECCCC--CHHHHHHHHHHHHHC--CCCEEEEECCCCCCCCCCCCCCHHHHHHHH
T ss_conf             5686899999999987750598459874779--989999999999764--998899976677988654446507889999


Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCC-CCCCCCCCCC
Q ss_conf             112244455655312688517865057777488899999876449829998066555323457754463-2211356454
Q gi|254780434|r  192 LIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQ-DGGLSGSPLF  270 (362)
Q Consensus       192 l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~-~GGlSG~~i~  270 (362)
                      +.++         +..+++||+||||||.+  ++.+++++++++|+||++++||.... .++....... .+++||++++
T Consensus       157 v~~V---------~~~~~~Pv~vKLsPn~t--di~~iA~aa~~~Gadgv~~iNT~~~~-~Id~e~~~~~~~~~lSgp~~~  224 (333)
T PRK07565        157 LRAV---------KSAVSIPVAVKLSPYFS--NLANMAKRLDAAGADGLVLFNRFYQP-DIDLETLEVVPGLVLSTPAEL  224 (333)
T ss_pred             HHHH---------HHHCCCCEEEECCCCCC--HHHHHHHHHHHCCCCEEEEECCCCCC-CCCCCCCEEECCCCCCCCCCC
T ss_conf             9999---------86468856873599821--09999999997499889984366656-331554437368666774312


Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             24689999999740897489996788999999999983999754527877069789999999999999983899778961
Q gi|254780434|r  271 LKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIR  350 (362)
Q Consensus       271 ~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~si~e~i  350 (362)
                      |+++++|+++++.+  ++||||+|||+||+||+|||+||||+|||||+++++||+++++|++||++||++|||+||+|+|
T Consensus       225 ~~alr~v~~v~~~~--~ipIiG~GGI~sg~DaiE~ilAGAsaVQv~Ta~~~~G~~v~~~i~~eL~~~m~~~G~~si~e~~  302 (333)
T PRK07565        225 RLPLRWIAILSGRV--GADLAATTGVHDAEDVIKMLLAGADVVMIASALLRHGPDYIGTILAGLEDWMERHGYESLSQFR  302 (333)
T ss_pred             CHHHHHHHHHHCCC--CCCEEEECCCCCHHHHHHHHHCCCCHHEEEHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHC
T ss_conf             07889999996046--9898888895989999999980988633622366537279999999999999983999899961


Q ss_pred             CCCC
Q ss_conf             6975
Q gi|254780434|r  351 GSYT  354 (362)
Q Consensus       351 G~~~  354 (362)
                      |+-.
T Consensus       303 G~l~  306 (333)
T PRK07565        303 GSMS  306 (333)
T ss_pred             CCCC
T ss_conf             7236


No 17 
>KOG1799 consensus
Probab=100.00  E-value=1.4e-45  Score=327.27  Aligned_cols=315  Identities=18%  Similarity=0.206  Sum_probs=248.5

Q ss_pred             HHHCCCCCCCCCCEEEECCEECCCCEEECCCC-CCCHHHHHHHHHCCCCEEECCCCCCCCC-CCCCCCCEEEEECCCCC-
Q ss_conf             11104678896311688873359974853468-8867798887403675241020013687-89988626884255541-
Q gi|254780434|r   33 LLSFFPVHSDPRLNTKVAGISLSNPLGMAAGY-DKNAEVPIELLKLGFGFVEIGTVTPHPQ-AGNPRPRVFRLTKDRAI-  109 (362)
Q Consensus        33 ~~~~~~~~~~~~L~~~~~Gl~~~nPiglAaG~-dk~~~~~~~l~~~G~G~v~~ktit~~p~-~GNp~PR~~r~~~~~~i-  109 (362)
                      ++.++.+-++.+..++.+|++|+||+++++++ .++++++++.++-||||++.||..+... .-|..||+.|.+-.+.. 
T Consensus        91 ~~k~~~~l~~ie~~vd~~G~k~~npf~~~s~Pp~t~~~lm~raf~~gwg~l~~kt~~ld~~kV~nv~prvar~~t~~~~~  170 (471)
T KOG1799          91 GLKALLYLKSIEELVDWDGQKPANPFHQKSKPPPTIAELMDRAFPSGWGYLEQKTKILDENKVRNVEPRVARSPTKRSCF  170 (471)
T ss_pred             CHHHHCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCHHHEEEEECCHHHHEECCCCEEECCCCCCCC
T ss_conf             12342101014452003576579854347899996278898531035651110102213254220466336446788764


Q ss_pred             -EEECCCCCC------CHHHHHHHHHHH---HHCCCCCCEEECCCCCHHHHHHHHHHHHHH-CCCCCEEEEECCCCCCCC
Q ss_conf             -000024777------778899987641---000121000110454246788776555420-675526983033365322
Q gi|254780434|r  110 -INKLGFNNA------GYHTVFSRLSKI---QPTSPIGINLGANKDSKDFILDYVSGIRLF-FTIASYFTINISSPNTPG  178 (362)
Q Consensus       110 -iN~~Gl~N~------G~~~~~~~l~~~---~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~-~~~aD~iEiNiSCPNt~g  178 (362)
                       -|+--+.|.      -.++++..+.++   .+...+|.|+++-.+    -.+|.++.... ..++|.+|+|+||||..+
T Consensus       171 ~p~~~i~~nielIsdr~~e~~L~~f~eLk~~~p~~imIas~Mciyn----k~~w~el~d~~eqag~d~lE~nlscphgm~  246 (471)
T KOG1799         171 IPKRPIPTNIELISDRKAEQYLGTFGELKNVEPVVIMIASEMCIYN----KKCWMELNDSGEQAGQDDLETNLSCPHGMC  246 (471)
T ss_pred             CCCCCCCCHHHHHCCCHHHHHHHHHHHHCCCCCCEEEEHHHHHHHH----HHHHHHHHHHHHHHCCCCHHCCCCCCCCCC
T ss_conf             6688765024564452399999999975014883463467898852----136899865677634430320588988876


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCC----
Q ss_conf             1100002343211112244455655312688517865057777488899999876449829998066555323457----
Q gi|254780434|r  179 LRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQC----  254 (362)
Q Consensus       179 ~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~----  254 (362)
                      .|.+.-.-+....+....+.|.+    ....+|+|.|++||+++  +.++++.+...|+.||+++||+.+..++..    
T Consensus       247 ergmgla~gq~p~v~~EvC~Wi~----A~~~Ip~~~kmTPNitd--~revar~~~~~g~~GiaA~NTi~SvM~i~~~~~~  320 (471)
T KOG1799         247 ERGMGLALGQCPIVDCEVCGWIN----AKATIPMVSKMTPNITD--KREVARSVNPVGCEGIAAINTIMSVMGIDMKTLR  320 (471)
T ss_pred             CCCCCCEECCCHHHHHHHHHHHH----HCCCCCCCCCCCCCCCC--CCCCCHHCCCCCCCCHHHHHHHHHHHCCCCCCCC
T ss_conf             56641011568056677764544----21102100356898664--5432110376653203557688887544413368


Q ss_pred             ----CCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHH
Q ss_conf             ----7544632211356454246899999997408974899967889999999999839997545278770697899999
Q gi|254780434|r  255 ----SDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRI  330 (362)
Q Consensus       255 ----~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I  330 (362)
                          ....+.+||+||++++|+++..|.-+.+... .++|.|.|||.+++|+.+||++||+.|||||+++.+|++++++.
T Consensus       321 P~~~~~~~sT~GG~S~~AvRPIAl~~V~~IA~~m~-~F~l~~~GGvEt~~~~~~Fil~Gs~~vQVCt~V~~~~~~~V~~~  399 (471)
T KOG1799         321 PEPCVEGYSTPGGYSYKAVRPIALAKVMNIAKMMK-EFSLSGIGGVETGYDAAEFILLGSNTVQVCTGVMMHGYGHVKTL  399 (471)
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH-CCCCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHCCCCHHHHH
T ss_conf             77664565578874642203588999999999862-58612335743231235576507737545167775486359989


Q ss_pred             HHHHHHHHHHCCCCCHHHHHCCCCHHHH
Q ss_conf             9999999998389977896169752664
Q gi|254780434|r  331 IQGLSDFLNKENEVNFENIRGSYTEYWA  358 (362)
Q Consensus       331 ~~~L~~~l~~~G~~si~e~iG~~~~~~~  358 (362)
                      +.||+++|.++||++|+|++|.++.|..
T Consensus       400 Ca~LK~~m~~~~~~ti~~~~G~SL~~~~  427 (471)
T KOG1799         400 CAELKDFMKQHNFSTIEEFRGHSLQYFT  427 (471)
T ss_pred             HHHHHHHHHHCCCHHHHHCCCCCHHHHH
T ss_conf             9889999987170045531670023100


No 18 
>PRK10415 tRNA-dihydrouridine synthase B; Provisional
Probab=99.77  E-value=2.1e-16  Score=130.37  Aligned_cols=228  Identities=18%  Similarity=0.229  Sum_probs=150.6

Q ss_pred             EECCEECCCCEEEC--CCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHH
Q ss_conf             88873359974853--4688867798887403675241020013687899886268842555410000247777788999
Q gi|254780434|r   48 KVAGISLSNPLGMA--AGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFS  125 (362)
Q Consensus        48 ~~~Gl~~~nPiglA--aG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~  125 (362)
                      ++.+++|+||+.+|  +|.. |.-.-.-..+.|.+.+.+-=|+.+                 +++    ..|   +.-..
T Consensus         2 ~ig~~~~~~~l~lAPMagvt-d~~FR~l~~~~Ga~l~~TEmv~a~-----------------~~~----~~~---~~~~~   56 (321)
T PRK10415          2 RIGQYQLRNRLIAAPMAGIT-DRPFRTLCYEMGAGLTVSEMMSSN-----------------PQV----WES---DKSRL   56 (321)
T ss_pred             CCCCEECCCCEEECCCCCCC-CHHHHHHHHHHCCCEEEECCEEEC-----------------HHH----HCC---HHHHH
T ss_conf             37988448988973578994-899999999988399998758712-----------------777----338---48898


Q ss_pred             HHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHH-HCCCCCEEEEECCCC------CCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             8764100012100011045424678877655542-067552698303336------532211000023432111122444
Q gi|254780434|r  126 RLSKIQPTSPIGINLGANKDSKDFILDYVSGIRL-FFTIASYFTINISSP------NTPGLRSLQKKKNLERLLIHVMQT  198 (362)
Q Consensus       126 ~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~-~~~~aD~iEiNiSCP------Nt~g~~~~~~~~~l~~~l~~v~~~  198 (362)
                      .+.......|++|.|.++.     .+++.+.++. ...++|.+.||+.||      +..|-..+.+++.+.+++.+++..
T Consensus        57 ~~~~~~~~~~~~vQl~G~d-----p~~~a~Aa~~~~~~g~~~IDiN~GCP~~kV~k~g~GsaLl~~p~~~~~iv~a~~~a  131 (321)
T PRK10415         57 RMVHVDEPGIRTVQIAGSD-----PKEMADAARINVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDLVKSILTEVVNA  131 (321)
T ss_pred             HHCCCCCCCCCEEEECCCC-----HHHHHHHHHHHHHCCCCEEEEECCCCHHHHCCCCCEEEHHCCHHHHHHHHHHHHHC
T ss_conf             6304678898059972699-----99999999988764999894318999899707983650633989999999999734


Q ss_pred             HHHHHHHCCCCCEEEEEC--CCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             556553126885178650--577774888999998764498299980665553234577544632211356454246899
Q gi|254780434|r  199 REEEKIKTGKFVPIFLKI--SPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIA  276 (362)
Q Consensus       199 ~~~~~~~~~~~~Pi~vKL--sPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~  276 (362)
                               .++||-||+  ..|....+..++++.++++|++.|++--    |..         .-+++|++-    -..
T Consensus       132 ---------~~iPVTvKiRlG~~~~~~~~~~~~~~~e~aG~~~itvHg----RT~---------~q~y~g~ad----w~~  185 (321)
T PRK10415        132 ---------VDVPVTLKIRTGWAPEHRNCEEIAQLAEDCGIQALTIHG----RTR---------ACLFNGEAE----YDS  185 (321)
T ss_pred             ---------CCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEH----HHH---------HHHHCCCCC----HHH
T ss_conf             ---------487469998468885224399999999856988999972----213---------443169987----799


Q ss_pred             HHHHHHHCCCCEEEEEECCCCCHHHHHHHHH-CCCCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             9999974089748999678899999999998-399975452787706978999999999
Q gi|254780434|r  277 LAKIRQRVGPKIAIIGTGGISSTKDALDKIM-AGANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       277 i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~-aGAs~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                      |+.+++.+  ++|+||.|+|.|.+|+.+++. .|+|.|+++.+.+-+ |+++++|.+-|
T Consensus       186 i~~vk~~~--~iPvi~NGDI~~~~da~~~l~~tg~dgvMigRgal~n-PwiF~~i~~~l  241 (321)
T PRK10415        186 IRAVKQKV--SIPVIANGDITDPLKARAVLDYTGADALMIGRAAQGR-PWIFREIQHYL  241 (321)
T ss_pred             HHHHHHCC--CCCEEECCCCCCHHHHHHHHHHHCCCEEEECHHHHCC-CHHHHHHHHHH
T ss_conf             99998547--9978965891999999999986299999975665369-87799999998


No 19 
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain. Two types of IDIs have been characterized at present. The long known IDI-1 is only dependent on divalent metals for activity, whereas IDI-2 requires a metal, FMN and NADPH. IDI-2 catalyzes the interconversion of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP) in the mevalonate pathway.
Probab=99.76  E-value=3.5e-16  Score=128.84  Aligned_cols=263  Identities=21%  Similarity=0.306  Sum_probs=155.7

Q ss_pred             CCCCCCCEEEECCEECCCCEEECC---CCCCC----HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEE
Q ss_conf             788963116888733599748534---68886----77988874036752410200136878998862688425554100
Q gi|254780434|r   39 VHSDPRLNTKVAGISLSNPLGMAA---GYDKN----AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIIN  111 (362)
Q Consensus        39 ~~~~~~L~~~~~Gl~~~nPiglAa---G~dk~----~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN  111 (362)
                      ..++.|++|+++|.++..||+++|   |-...    ....+...+.|..+ .+||.+.                      
T Consensus        36 d~~~iDlst~~lG~~l~~P~~I~AMTGG~~~~~~iN~~LA~aA~~~gi~m-~vGSq~~----------------------   92 (326)
T cd02811          36 DLDDIDLSTEFLGKRLSAPLLISAMTGGSEKAKEINRNLAEAAEELGIAM-GVGSQRA----------------------   92 (326)
T ss_pred             CHHHCCCCEEECCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHCCCCE-EECCHHH----------------------
T ss_conf             86446265358973247875887555797556588999999999819977-8342288----------------------


Q ss_pred             ECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCC----CCCCCCCCHHH
Q ss_conf             00247777788999876410001210001104542467887765554206755269830333653----22110000234
Q gi|254780434|r  112 KLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNT----PGLRSLQKKKN  187 (362)
Q Consensus       112 ~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt----~g~~~~~~~~~  187 (362)
                        .+.++....-.+-.++..++.+++.||+.........++....++.+.  ||++++.+.-+.-    +|.+.+.    
T Consensus        93 --al~~~~~~~sf~vvR~~~p~~~l~aNiga~~l~~~~~~~~~~ai~~l~--AdaL~iHlN~~QE~~~peGDr~f~----  164 (326)
T cd02811          93 --ALEDPELAESFTVVREAPPNGPLIANLGAVQLNGYGVEEARRAVEMIE--ADALAIHLNPLQEAVQPEGDRDFR----  164 (326)
T ss_pred             --HHCCCCHHHHHHHHHHHCCCCEEEEECCCHHHCCCCHHHHHHHHHHCC--CCEEEEECCHHHHCCCCCCCCCHH----
T ss_conf             --753921665678998758876278635803304568999999998557--885786446065400789898777----


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEEEEE-----CCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             3211112244455655312688517865-----05777748889999987644982999806655532345775446322
Q gi|254780434|r  188 LERLLIHVMQTREEEKIKTGKFVPIFLK-----ISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDG  262 (362)
Q Consensus       188 l~~~l~~v~~~~~~~~~~~~~~~Pi~vK-----LsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~G  262 (362)
                        ..++.+      ...+....+||+||     |++        +-+..+.+.|+++|.++|.=+- .-...+..+...+
T Consensus       165 --~~~~~I------~~l~~~~~vPVIvKeVG~Gis~--------eda~~l~~~Gv~~IdVSghGGT-nf~~IE~~R~~d~  227 (326)
T cd02811         165 --GWLERI------EELVKALSVPVIVKEVGFGISR--------ETAKRLADAGVKAIDVAGAGGT-SWARVENYRAKDS  227 (326)
T ss_pred             --HHHHHH------HHHHHHCCCCEEEEECCCCCCH--------HHHHHHHHCCCCEEEECCCCCC-CHHHHHHHCCCCC
T ss_conf             --899999------9999847998588524789999--------9999999679999997899997-5366531015673


Q ss_pred             CC-CCCCCCH---HHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC---CCH----HHHHHHH
Q ss_conf             11-3564542---46899999997408974899967889999999999839997545278770---697----8999999
Q gi|254780434|r  263 GL-SGSPLFL---KSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY---EGI----SLPKRII  331 (362)
Q Consensus       263 Gl-SG~~i~~---~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~---~Gp----~~~~~I~  331 (362)
                      .. +...+..   .+...+.+++.. .++++||+.|||.++.|+++-+..||++|.++..+++   +|.    ..+..+.
T Consensus       228 ~~~~~~~l~dwGi~T~~sL~e~~~~-~~~~~iiasGGir~g~Dv~KalaLGA~~vgiar~~L~~~~~G~~~v~~~l~~~~  306 (326)
T cd02811         228 DQRLAEYFADWGIPTAASLLEVRSA-LPDLPLIASGGIRNGLDIAKALALGADLVGMAGPFLKAALEGEEAVIETIEQII  306 (326)
T ss_pred             CHHHHHHHHHCCCCHHHHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHCCHHHHHHHHHHHH
T ss_conf             1337889886285569999999973-899819986887877999999995553365279999998548999999999999


Q ss_pred             HHHHHHHHHCCCCCHHHHH
Q ss_conf             9999999983899778961
Q gi|254780434|r  332 QGLSDFLNKENEVNFENIR  350 (362)
Q Consensus       332 ~~L~~~l~~~G~~si~e~i  350 (362)
                      +||+..|---|.+|++|++
T Consensus       307 ~el~~~M~l~G~~~i~eLr  325 (326)
T cd02811         307 EELRTAMFLTGAKNLAELK  325 (326)
T ss_pred             HHHHHHHHHHCCCCHHHHC
T ss_conf             9999999986899889974


No 20 
>pfam01070 FMN_dh FMN-dependent dehydrogenase.
Probab=99.75  E-value=5.9e-15  Score=120.63  Aligned_cols=259  Identities=24%  Similarity=0.288  Sum_probs=160.0

Q ss_pred             HHHHHHHHHHHHH-HHHHHCC-CCCCCCCCEEEECCEECCCCEEECC----C-CCCCHH--HHHHHHHCCCCEEECCCCC
Q ss_conf             6788999999996-2011104-6788963116888733599748534----6-888677--9888740367524102001
Q gi|254780434|r   18 PEIAHHLSIVALK-SGLLSFF-PVHSDPRLNTKVAGISLSNPLGMAA----G-YDKNAE--VPIELLKLGFGFVEIGTVT   88 (362)
Q Consensus        18 pe~ah~~~~~~~~-~~~~~~~-~~~~~~~L~~~~~Gl~~~nPiglAa----G-~dk~~~--~~~~l~~~G~G~v~~ktit   88 (362)
                      -|.+++-...++. ..+.|+. ...+++|++|+++|.+++.||++|+    + ...++|  ..+...+.|..+.+- |.+
T Consensus        18 ~e~t~~~N~~af~~~~l~pr~L~dv~~~d~st~~lG~~~~~Pi~iap~g~~~l~~~~ge~~lAraA~~~gi~~~ls-s~~   96 (301)
T pfam01070        18 DEITLRRNRAAFDRIRLRPRVLRDVSDRDTSTTLLGQRLSLPFGIAPTGMQGLAHPDGELALARAAAAAGIPFVLS-TVA   96 (301)
T ss_pred             CCHHHHHHHHHHHHCCEECCCCCCCCCCCCCEEECCCCCCCCEEECCCCHHHHCCCCHHHHHHHHHHHHCCCEECC-CCC
T ss_conf             5299999999998370676445788778884357883167876787401022137645899999999835870046-876


Q ss_pred             CCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             36878998862688425554100002477777889998764100012100011045424678877655542067552698
Q gi|254780434|r   89 PHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFT  168 (362)
Q Consensus        89 ~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iE  168 (362)
                                                  +..+|.+.    +.. ..+.+..+-..+ ..+...+..+-++..  +++++.
T Consensus        97 ----------------------------~~~~e~i~----~~~-~~~~~fQly~~~-d~~~~~~~i~ra~~a--g~~al~  140 (301)
T pfam01070        97 ----------------------------STSLEEVA----AAA-GGPLWFQLYVPK-DRELTEDLLERAEAA--GYKALV  140 (301)
T ss_pred             ----------------------------CCCHHHHH----HHC-CCCEEEEEEECC-CHHHHHHHHHHHHHC--CCCEEE
T ss_conf             ----------------------------55527889----857-997689987458-889999999999974--999799


Q ss_pred             EECCCCCCCCCC--CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE--CCCCCCHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             303336532211--00002343211112244455655312688517865--05777748889999987644982999806
Q gi|254780434|r  169 INISSPNTPGLR--SLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLK--ISPDLSEEELDDIAVEVLSHKVEGIIVSN  244 (362)
Q Consensus       169 iNiSCPNt~g~~--~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vK--LsPd~~~~~i~~ia~~a~~~g~dGiv~~N  244 (362)
                      +.+-.|-. +.|  +....+    .+         ...+...+.|+++|  ++        .+=+..+.++|+|||+++|
T Consensus       141 ltvD~~~~-g~r~~d~r~~~----~i---------~~l~~~~~~PvivKGI~s--------~eDA~~a~~~Gv~~I~VSn  198 (301)
T pfam01070       141 LTVDTPVL-GNRERDLRNGD----DL---------AWLRDQWKGPLVLKGILS--------PEDAKRAVEAGVDGIVVSN  198 (301)
T ss_pred             EECCCCCC-CCCCCCCCCHH----HH---------HHHHHHCCCCEEEECCCC--------HHHHHHHHHCCCCEEEECC
T ss_conf             97268765-77853204399----99---------999986699889982899--------9999999985999999649


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCC--
Q ss_conf             655532345775446322113564542468999999974089748999678899999999998399975452787706--
Q gi|254780434|r  245 TTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYE--  322 (362)
Q Consensus       245 T~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~--  322 (362)
                      -= .         +..-+       -+.+.+.+.++++.++++++||..|||.+|.|+++.+..||++|.++..++|-  
T Consensus       199 HG-G---------RqlD~-------~~~t~~~L~eI~~~v~~~~~i~~DGGIR~G~DV~KAlALGA~~V~iGRp~l~ala  261 (301)
T pfam01070       199 HG-G---------RQLDG-------APATIDALPEIVAAVGGRIPVLVDGGIRRGTDVLKALALGADAVLLGRPFLYGLA  261 (301)
T ss_pred             CC-C---------CCCCC-------CCCHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHCCCCEEEECHHHHHHHH
T ss_conf             98-5---------44688-------8679999999999856774899638747626899999808986655689999999


Q ss_pred             --CH----HHHHHHHHHHHHHHHHCCCCCHHHHHCC
Q ss_conf             --97----8999999999999998389977896169
Q gi|254780434|r  323 --GI----SLPKRIIQGLSDFLNKENEVNFENIRGS  352 (362)
Q Consensus       323 --Gp----~~~~~I~~~L~~~l~~~G~~si~e~iG~  352 (362)
                        |.    .+++.+.+||..-|..-|.+||+|+.-.
T Consensus       262 ~~G~~Gv~~~l~~l~~El~~~M~l~G~~~i~~l~~~  297 (301)
T pfam01070       262 AGGEAGVAHALEILRDELERTMALLGCTSIADLTPS  297 (301)
T ss_pred             HCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCCHH
T ss_conf             657999999999999999999998589997895998


No 21 
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO). In green plants, glycolate oxidase is one of the key enzymes in photorespiration where it oxidizes glycolate to glyoxylate. LMO catalyzes the oxidation of L-lactate to acetate and carbon dioxide. MDH oxidizes (S)-mandelate to phenylglyoxalate. It is an enzyme in the mandelate pathway that occurs in several strains of Pseudomonas which converts (R)-mandelate to benzoate.
Probab=99.75  E-value=5.2e-15  Score=120.95  Aligned_cols=256  Identities=19%  Similarity=0.275  Sum_probs=161.5

Q ss_pred             CHHHHHHHHHHHHH-HHHHHC-CCCCCCCCCEEEECCEECCCCEEECC----C-CCCCHHH--HHHHHHCCCCEEECCCC
Q ss_conf             96788999999996-201110-46788963116888733599748534----6-8886779--88874036752410200
Q gi|254780434|r   17 DPEIAHHLSIVALK-SGLLSF-FPVHSDPRLNTKVAGISLSNPLGMAA----G-YDKNAEV--PIELLKLGFGFVEIGTV   87 (362)
Q Consensus        17 ~pe~ah~~~~~~~~-~~~~~~-~~~~~~~~L~~~~~Gl~~~nPiglAa----G-~dk~~~~--~~~l~~~G~G~v~~kti   87 (362)
                      +.|.+++-...++. ..+.++ +...+++|++|+++|.+|+.||++|.    + +..++|.  .+.....|..++.--  
T Consensus        24 ~de~t~~~N~~af~~~~l~PRvL~dv~~~dt~t~llG~~~~~P~~iAP~g~~~l~~p~GE~~~AraA~~~gi~~~lSt--  101 (299)
T cd02809          24 GDEVTLRRNRAAFDRIRLRPRVLRDVSKRDTSTTLLGQKLAMPFGIAPTGLQGLAHPDGELATARAAAAAGIPFTLST--  101 (299)
T ss_pred             CCCHHHHHHHHHHHHCCEECCCCCCCCCCCCCEEECCCCCCCCEEECCHHHHCCCCCCHHHHHHHHHHHHCCCEECCC--
T ss_conf             744999999999983647740134887788766678976889768885220125678726999999997056431137--


Q ss_pred             CCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             13687899886268842555410000247777788999876410001210001104542467887765554206755269
Q gi|254780434|r   88 TPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYF  167 (362)
Q Consensus        88 t~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~i  167 (362)
                                               +  .|..+|.+.+..    + .+.+-.+-... ..+..++..+-+++.  ++.++
T Consensus       102 -------------------------~--ss~slEei~~~~----~-~~~wfQLY~~~-d~~~~~~li~rA~~a--G~~al  146 (299)
T cd02809         102 -------------------------V--STTSLEEVAAAA----P-GPRWFQLYVPR-DREITEDLLRRAEAA--GYKAL  146 (299)
T ss_pred             -------------------------C--CCCCHHHHHHHC----C-CCEEEEEECCC-CHHHHHHHHHHHHHC--CCCEE
T ss_conf             -------------------------6--656689999744----8-98467764369-999999999999985--99989


Q ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE--CCCCCCHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             830333653221100002343211112244455655312688517865--057777488899999876449829998066
Q gi|254780434|r  168 TINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLK--ISPDLSEEELDDIAVEVLSHKVEGIIVSNT  245 (362)
Q Consensus       168 EiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vK--LsPd~~~~~i~~ia~~a~~~g~dGiv~~NT  245 (362)
                      .+.+=.|... .|               ..+.+....+...+.|+++|  ++|        +=+..+.++|+|||+++|-
T Consensus       147 ~lTvD~p~~g-~R---------------~~w~~i~~l~~~~~~p~i~KGi~~~--------~DA~~a~~~G~dgI~VSNH  202 (299)
T cd02809         147 VLTVDTPVLG-RR---------------LTWDDLAWLRSQWKGPLILKGILTP--------EDALRAVDAGADGIVVSNH  202 (299)
T ss_pred             EEECCCCCCC-CC---------------CCHHHHHHHHHHCCCCEEEECCCCH--------HHHHHHHHCCCCEEEECCC
T ss_conf             9970589878-87---------------9999999999866998799727889--------9999999859988997288


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCC---
Q ss_conf             55532345775446322113564542468999999974089748999678899999999998399975452787706---
Q gi|254780434|r  246 TLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYE---  322 (362)
Q Consensus       246 ~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~---  322 (362)
                      =          .+...+       .|-+++.+.++++.++++++|+--|||.+|.|+++.+..||++|.++..++|-   
T Consensus       203 G----------GRqlD~-------~p~~i~~L~~i~~~v~~~~~v~~DgGvR~G~Dv~KAlaLGA~~V~iGRp~l~~l~~  265 (299)
T cd02809         203 G----------GRQLDG-------APATIDALPEIVAAVGGRIEVLLDGGIRRGTDVLKALALGADAVLIGRPFLYGLAA  265 (299)
T ss_pred             C----------CCCCCC-------CCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECHHHHHHHHH
T ss_conf             7----------333688-------87789999999998546728997188475368999997699889877899999885


Q ss_pred             -CH----HHHHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             -97----89999999999999983899778961
Q gi|254780434|r  323 -GI----SLPKRIIQGLSDFLNKENEVNFENIR  350 (362)
Q Consensus       323 -Gp----~~~~~I~~~L~~~l~~~G~~si~e~i  350 (362)
                       |.    .+++.+.+||..-|..-|+++++|+-
T Consensus       266 ~G~~Gv~~~~~~l~~El~~~M~l~G~~~i~~l~  298 (299)
T cd02809         266 GGEAGVAHVLEILRDELERAMALLGCASLADLD  298 (299)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCC
T ss_conf             449999999999999999999984899877779


No 22 
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family; InterPro: IPR004652   This family represents one branch of COG0042 from COG (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family) and includes NifR3 itself, from Rhodobacter capsulatus. Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes , and also in some archaea. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. ; GO: 0016491 oxidoreductase activity, 0050660 FAD binding, 0008033 tRNA processing.
Probab=99.73  E-value=2e-16  Score=130.47  Aligned_cols=234  Identities=21%  Similarity=0.226  Sum_probs=162.6

Q ss_pred             ECCEECCCCEEEC--CCC-CCCHHHHHHHHHCC-------CCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCC
Q ss_conf             8873359974853--468-88677988874036-------7524102001368789988626884255541000024777
Q gi|254780434|r   49 VAGISLSNPLGMA--AGY-DKNAEVPIELLKLG-------FGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNA  118 (362)
Q Consensus        49 ~~Gl~~~nPiglA--aG~-dk~~~~~~~l~~~G-------~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~  118 (362)
                      +..+.|+|||.+|  ||+ |---..+-.-  .+       .|+++.-=|+.++                 |+-    .+ 
T Consensus         1 IG~~~L~s~V~~APmAGvtD~~FR~l~~~--~~~skvGtvagL~~~EMvs~~~-----------------~~~----~~-   56 (336)
T TIGR00737         1 IGNIQLKSRVVLAPMAGVTDLAFRRLVAE--YGQSKVGTVAGLTVSEMVSSEA-----------------IVY----KS-   56 (336)
T ss_pred             CCCCCCCCCEEECCCCCCCCHHHHHHHHH--HCCCCCCCCCCCCEECCCCCHH-----------------HHH----HH-
T ss_conf             98722367656436778767178999998--5214433124100222004537-----------------886----23-


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCC------CCCCCCCCCHHHHHHHH
Q ss_conf             778899987641000121000110454246788776555420675526983033365------32211000023432111
Q gi|254780434|r  119 GYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPN------TPGLRSLQKKKNLERLL  192 (362)
Q Consensus       119 G~~~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPN------t~g~~~~~~~~~l~~~l  192 (362)
                       -+.....+.......|+.+-|.+..  ++.+.|=++++. -...||.|-||+.||-      ..|-..+++++.+.+++
T Consensus        57 -r~~~~~~~~~~~~~~~~~~Ql~Gs~--P~~~aeAAk~i~-~~~ga~~IDiN~GCP~~Kitk~~aGsaLl~~p~~~~~iv  132 (336)
T TIGR00737        57 -RERTKKLLDIDEDETPISVQLFGSD--PDTMAEAAKLIN-EELGADIIDINMGCPVPKITKKGAGSALLRDPDLIGKIV  132 (336)
T ss_pred             -HHHHHHHHHHCCCCCCCEEEEECCC--HHHHHHHHHHHH-HCCCCCEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             -5557765321258885478764788--268999999985-305898885367654884216763543235868999999


Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEEC--CCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             122444556553126885178650--577774888999998764498299980665553234577544632211356454
Q gi|254780434|r  193 IHVMQTREEEKIKTGKFVPIFLKI--SPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLF  270 (362)
Q Consensus       193 ~~v~~~~~~~~~~~~~~~Pi~vKL--sPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~  270 (362)
                      .+++.+...      .++||-||+  .+|...-+..+++++++++|+.++++    ..|+.         .=+++|++= 
T Consensus       133 ~~vV~AV~~------~~iPVTVK~R~GWD~~h~n~~~~a~~a~~~Ga~Av~l----HGRTR---------aQ~Y~G~A~-  192 (336)
T TIGR00737       133 KAVVDAVDA------QDIPVTVKIRIGWDDAHINAVEAARIAEDAGAQAVTL----HGRTR---------AQGYEGEAN-  192 (336)
T ss_pred             HHHHHHHCC------CCCCEEEEEECCCCCCCCCHHHHHHHHHHCCCCEEEH----HHHHH---------CCCCCCCCC-
T ss_conf             999987518------7665166551563624488899999998724000211----10000---------015788760-


Q ss_pred             HHHHHHHHHHHHHCCCC--EEEEEECCCCCHHHHHHHHHC-CCCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             24689999999740897--489996788999999999983-99975452787706978999999999
Q gi|254780434|r  271 LKSTIALAKIRQRVGPK--IAIIGTGGISSTKDALDKIMA-GANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       271 ~~al~~i~~i~~~~~~~--i~IIg~GGI~s~~Da~e~l~a-GAs~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                         -+.|+.+++.+.+.  ||+||.|-|++++||..+|.- |||.|+++-|. +--|+++++|.+=|
T Consensus       193 ---wd~I~~vKq~v~~~GeiPVigNGDi~~~~~A~~~L~~TG~DGvm~gRG~-lG~PWl~~~i~~yL  255 (336)
T TIGR00737       193 ---WDIIARVKQAVRKEGEIPVIGNGDIFSPEDAKAMLETTGADGVMIGRGA-LGNPWLFKQIEQYL  255 (336)
T ss_pred             ---HHHHHHHHHHHHCCCCCCEECCCCCCCHHHHHHHHHHCCCCEEEEECHH-CCCCHHHHHHHHHH
T ss_conf             ---6899999999716875332227742467899999863788689850022-27875899999997


No 23 
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain.  FCB2 (AKA L-lactate:cytochrome c oxidoreductase) is a respiratory enzyme located in the intermembrane space of fungal mitochondria which catalyzes the oxidation of L-lactate to pyruvate. FCB2 also participates in a short electron-transport chain involving cytochrome c and cytochrome oxidase which ultimately directs the reducing equivalents gained from L-lactate oxidation to oxygen, yielding one molecule of ATP for every L-lactate molecule consumed. FCB2  is composed of 2 domains: a C-terminal flavin-binding domain, which includes the active site for lacate oxidation, and an N-terminal b2-cytochrome domain, required for efficient cytochrome c reduction. FCB2 is a homotetramer and contains two noncovalently bound cofactors, FMN and heme per subunit.
Probab=99.73  E-value=4.5e-14  Score=114.63  Aligned_cols=289  Identities=17%  Similarity=0.158  Sum_probs=164.4

Q ss_pred             HHHHHHHHHHH-HHHHHHCC-CCCCCCCCEEEECCEECCCCEEEC----CC-CCCCHHH--HHHHHHCCCCEEEC--CCC
Q ss_conf             78899999999-62011104-678896311688873359974853----46-8886779--88874036752410--200
Q gi|254780434|r   19 EIAHHLSIVAL-KSGLLSFF-PVHSDPRLNTKVAGISLSNPLGMA----AG-YDKNAEV--PIELLKLGFGFVEI--GTV   87 (362)
Q Consensus        19 e~ah~~~~~~~-~~~~~~~~-~~~~~~~L~~~~~Gl~~~nPiglA----aG-~dk~~~~--~~~l~~~G~G~v~~--kti   87 (362)
                      |.+++-...++ +..+.|+. ...+.++++|+++|.+++.||++|    .+ +..++|.  -+...+.|.-++.-  .|.
T Consensus        26 e~Tl~~N~~Af~~~~l~Pr~L~dvs~~dtst~l~G~~~~~P~~iAP~g~~~l~hp~gE~a~AraA~~~gi~~~lSt~ss~  105 (344)
T cd02922          26 EITLRENLEAFQRIRFRPRVLRDVEKVDTSTTILGHKVSLPFFISPAALAKLAHPDGELNLARAAGKHGILQMISTNASC  105 (344)
T ss_pred             HHHHHHHHHHHHHCCEECCCCCCCCCCCCCEEECCEECCCCEEECHHHHHHHCCCCHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             49999999999847676533248888988556898336775156647776432884569999999974886574057778


Q ss_pred             CCCCC-CCCC--CCCEEEEECCCCCEEECCCCCCC-HHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             13687-8998--86268842555410000247777-78899987641000121000110454246788776555420675
Q gi|254780434|r   88 TPHPQ-AGNP--RPRVFRLTKDRAIINKLGFNNAG-YHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTI  163 (362)
Q Consensus        88 t~~p~-~GNp--~PR~~r~~~~~~iiN~~Gl~N~G-~~~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~  163 (362)
                      +++.- +..|  .|+.|.+.-         +.++. .+.++++-++.... -|.+.+-..-.+. -..|.-..+......
T Consensus       106 slEdVa~a~~~~~~~wfQLY~---------~~dr~~~~~li~RA~~aG~~-alvlTvD~p~~G~-R~rd~r~~~~~~~~~  174 (344)
T cd02922         106 SLEEIVDARPPDQPLFFQLYV---------NKDRTKTEELLKRAEKLGAK-AIFLTVDAPVLGK-RERDERLKAEEAVSD  174 (344)
T ss_pred             CHHHHHHHCCCCCCEEEEEEC---------CCCHHHHHHHHHHHHHCCCC-EEEEECCCCCCCC-CHHHHHCCCCCCCCC
T ss_conf             889999865689866999824---------77679999999999986998-8999567888775-226665077778876


Q ss_pred             CCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE--CCCCCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             5269830333653221100002343211112244455655312688517865--05777748889999987644982999
Q gi|254780434|r  164 ASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLK--ISPDLSEEELDDIAVEVLSHKVEGII  241 (362)
Q Consensus       164 aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vK--LsPd~~~~~i~~ia~~a~~~g~dGiv  241 (362)
                      ......+-..+.       .....+......-..+......+...+.|+++|  ++|        +=+..+.++|+|||+
T Consensus       175 ~~~~~~~~~~~~-------~~~~~~~~~~~~~~tw~di~~lr~~~~~plivKGIl~~--------~DA~~A~~~G~dgIi  239 (344)
T cd02922         175 GPAGKKTKAKGG-------GAGRAMSGFIDPTLTWDDIKWLRKHTKLPIVLKGVQTV--------EDAVLAAEYGVDGIV  239 (344)
T ss_pred             CCCCCCCCCCCC-------HHHHHHHHCCCCCCCHHHHHHHHHHCCCCEEECCCCCH--------HHHHHHHHCCCCEEE
T ss_conf             654333344663-------16677775048889999999999866997010025779--------999999965998899


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH---HCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHH
Q ss_conf             80665553234577544632211356454246899999997---408974899967889999999999839997545278
Q gi|254780434|r  242 VSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQ---RVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSA  318 (362)
Q Consensus       242 ~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~---~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Ta  318 (362)
                      ++|-          ...+.-|       .|.+++.+-++++   .++++++|+--|||.+|.|+++.|..||++|.++..
T Consensus       240 VSNH----------GGRqLD~-------~~~~i~~Lp~I~~~~~av~~~~~v~~DgGiR~G~DV~KAlALGA~aV~iGRp  302 (344)
T cd02922         240 LSNH----------GGRQLDT-------APAPIEVLLEIRKHCPEVFDKIEVYVDGGVRRGTDVLKALCLGAKAVGLGRP  302 (344)
T ss_pred             EECC----------CCCCCCC-------CCCHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECHH
T ss_conf             7188----------6212578-------8318999899999889858870899718857578999999769998976789


Q ss_pred             HHCC----CH----HHHHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             7706----97----89999999999999983899778961
Q gi|254780434|r  319 MIYE----GI----SLPKRIIQGLSDFLNKENEVNFENIR  350 (362)
Q Consensus       319 li~~----Gp----~~~~~I~~~L~~~l~~~G~~si~e~i  350 (362)
                      ++|-    |-    .+++-+.+||..-|..-|..||+|+-
T Consensus       303 ~l~gla~~G~~Gv~~~l~il~~El~~~M~l~G~~si~~l~  342 (344)
T cd02922         303 FLYALSAYGEEGVEKAIQILKDEIETTMRLLGVTSLDQLG  342 (344)
T ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCC
T ss_conf             9999884439999999999999999999985899888749


No 24 
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional
Probab=99.72  E-value=2.4e-15  Score=123.20  Aligned_cols=259  Identities=22%  Similarity=0.283  Sum_probs=159.7

Q ss_pred             CCCCCCCEEEECCEECCCCEEECC---CCCCCHHH----HHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEE
Q ss_conf             788963116888733599748534---68886779----88874036752410200136878998862688425554100
Q gi|254780434|r   39 VHSDPRLNTKVAGISLSNPLGMAA---GYDKNAEV----PIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIIN  111 (362)
Q Consensus        39 ~~~~~~L~~~~~Gl~~~nPiglAa---G~dk~~~~----~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN  111 (362)
                      ..++.|++|+|+|.++..||+++|   |-++..+.    -+...+.|.++ -+||-+.                      
T Consensus        44 ~~~diD~st~~lG~~l~~P~~I~aMTGG~~~~~~IN~~LA~~A~~~gi~m-~vGSqr~----------------------  100 (351)
T PRK05437         44 DLDDIDLSTEFLGKKLSAPFLINAMTGGSEKAKEINRKLAEAAEELGIAM-GVGSQRA----------------------  100 (351)
T ss_pred             CHHHCCCCEEECCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHCCCCE-EECCHHH----------------------
T ss_conf             88777065258872537876886534687546289999999999839877-7331788----------------------


Q ss_pred             ECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCC----CCCCCCCCCHHH
Q ss_conf             0024777778899987641000121000110454246788776555420675526983033365----322110000234
Q gi|254780434|r  112 KLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPN----TPGLRSLQKKKN  187 (362)
Q Consensus       112 ~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPN----t~g~~~~~~~~~  187 (362)
                        .+.++....-.+.+++..++.+++.|||.....+...++..+.++.+.  ||++.|.+--+-    ..|.|+|..   
T Consensus       101 --al~~~~~~~sf~vvR~~~p~~~l~aNiGa~~~~~~~~~~~~~av~~i~--AdAl~iHlN~~QEl~qpEGDr~f~~---  173 (351)
T PRK05437        101 --ALKDPELADSFSVVRKVAPDGLLFANIGAVQLYGYGVEEAQRAVEMIE--ADALQIHLNPLQELVQPEGDRDFRG---  173 (351)
T ss_pred             --HHCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHC--CCCEEEECCCHHHHCCCCCCCCHHH---
T ss_conf             --853914565699999868887388612721014358999999999716--7815752462454028888977889---


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEEEEE-----CCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCC--------CCCCCC
Q ss_conf             3211112244455655312688517865-----057777488899999876449829998066555--------323457
Q gi|254780434|r  188 LERLLIHVMQTREEEKIKTGKFVPIFLK-----ISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLS--------RKGVQC  254 (362)
Q Consensus       188 l~~~l~~v~~~~~~~~~~~~~~~Pi~vK-----LsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~--------~~~~~~  254 (362)
                         .+..+.      ......++||+||     +|        .+-+..+.+.|+++|.+.|.=+-        |.. ..
T Consensus       174 ---~l~~I~------~i~~~~~vPVIvKeVG~Gis--------~e~a~~l~~~Gv~~IdVsg~GGTnf~~IE~~R~~-~~  235 (351)
T PRK05437        174 ---WLDRIA------EIVSALPVPVIVKEVGFGIS--------KETAKRLADAGVKAIDVAGAGGTSWAAVENYRAK-QR  235 (351)
T ss_pred             ---HHHHHH------HHHHHCCCCEEEEECCCCCC--------HHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHC-CH
T ss_conf             ---999999------99986799889852157889--------9999999967999999579988557999988710-21


Q ss_pred             CCCC--CCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC----CCH----
Q ss_conf             7544--632211356454246899999997408974899967889999999999839997545278770----697----
Q gi|254780434|r  255 SDNH--EQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY----EGI----  324 (362)
Q Consensus       255 ~~~~--~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~----~Gp----  324 (362)
                      ....  ... |++       +...+.++++. .++++||++|||.++-|+.+-+..||++|.++-.+++    +|.    
T Consensus       236 ~~~~~~~~w-Gip-------T~~sL~e~~~~-~~~~~iiasGGIR~glDi~KaLaLGA~~vgia~p~L~~l~~~g~e~~~  306 (351)
T PRK05437        236 RLASYFADW-GIP-------TAQSLLEARSA-LPDLPIIASGGIRTGLDIAKALALGADAVGLAGPFLKAALEGGVEAVI  306 (351)
T ss_pred             HHHHHHHHC-CCC-------HHHHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHCCHHHHH
T ss_conf             245777734-866-------89999999974-799829962787878999999995510777589999999856999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHCCCC
Q ss_conf             899999999999999838997789616975
Q gi|254780434|r  325 SLPKRIIQGLSDFLNKENEVNFENIRGSYT  354 (362)
Q Consensus       325 ~~~~~I~~~L~~~l~~~G~~si~e~iG~~~  354 (362)
                      ..+..+.++|+..|---|..|++|++-+.+
T Consensus       307 ~~l~~~~~elk~~M~L~G~~~i~eL~~~~~  336 (351)
T PRK05437        307 EEIEGWIEELKTAMFLTGAKNIAELRQVPL  336 (351)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHCCCE
T ss_conf             999999999999999868998999817999


No 25 
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2.  This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).
Probab=99.68  E-value=2.8e-13  Score=109.29  Aligned_cols=287  Identities=20%  Similarity=0.254  Sum_probs=165.1

Q ss_pred             HHHHHHHHHHH-HHHHHHCC-CCCCCCCCEEEECCEECCCCEEECC----C-CCCCHHH--HHHHHHCCCCEEEC--CCC
Q ss_conf             78899999999-62011104-6788963116888733599748534----6-8886779--88874036752410--200
Q gi|254780434|r   19 EIAHHLSIVAL-KSGLLSFF-PVHSDPRLNTKVAGISLSNPLGMAA----G-YDKNAEV--PIELLKLGFGFVEI--GTV   87 (362)
Q Consensus        19 e~ah~~~~~~~-~~~~~~~~-~~~~~~~L~~~~~Gl~~~nPiglAa----G-~dk~~~~--~~~l~~~G~G~v~~--kti   87 (362)
                      |..++-...++ +..+.|+. ...+.++++|+++|.+++.||++|.    + +-.++|.  -+...+.|.-++.-  .|.
T Consensus        34 e~t~~~N~~af~~~~l~PrvL~dv~~~d~~t~llG~~~~~P~~iaP~g~~~l~hp~gE~~~AraA~~~gi~~~lSt~s~~  113 (351)
T cd04737          34 EWTLRENTRAFNHKQIVPRVLQGVESPDTSTELLGIKLKTPIIMAPIAAHGLAHATGEVATARGMAEVGSLFSISTYSNT  113 (351)
T ss_pred             HHHHHHHHHHHHHCCEECCCCCCCCCCCCCEEECCCCCCCCEEECHHHHHHHCCCCHHHHHHHHHHHCCCCEEECCCCCC
T ss_conf             29999999999847175533458777988435788025776265538874044684789999999975986340567777


Q ss_pred             CCCC--CCCCCCCCEEEEECCCCCEEECCCCCCC-HHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             1368--7899886268842555410000247777-788999876410001210001104542467887765554206755
Q gi|254780434|r   88 TPHP--QAGNPRPRVFRLTKDRAIINKLGFNNAG-YHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIA  164 (362)
Q Consensus        88 t~~p--~~GNp~PR~~r~~~~~~iiN~~Gl~N~G-~~~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~a  164 (362)
                      +.+.  +...-.|+.|.+.-         ..+++ .+.++++.++.... -+.+-+-..-.+. ...|...   .+    
T Consensus       114 s~Eeia~a~~~~~~wfQLY~---------~~dr~~~~~li~RA~~aG~~-alvlTVD~p~~g~-Rerd~r~---~~----  175 (351)
T cd04737         114 SLEEIAKASNGGPKWFQLYM---------SKDDGFNRSLLDRAKAAGAK-AIILTADATVGGN-READIRN---KF----  175 (351)
T ss_pred             CHHHHHHHCCCCCEEEEEEC---------CCCHHHHHHHHHHHHHCCCC-EEEEEECCCCCCC-CHHHHHC---CC----
T ss_conf             89999974679970899713---------58879999999999986999-8999631788786-2778862---99----


Q ss_pred             CEEEEECCCCCCCCC----CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE--CCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             269830333653221----100002343211112244455655312688517865--05777748889999987644982
Q gi|254780434|r  165 SYFTINISSPNTPGL----RSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLK--ISPDLSEEELDDIAVEVLSHKVE  238 (362)
Q Consensus       165 D~iEiNiSCPNt~g~----~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vK--LsPd~~~~~i~~ia~~a~~~g~d  238 (362)
                         .+-.++||....    ...............-..+.+-...+...+.|+++|  ++|        +=|..|.++|+|
T Consensus       176 ---~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~di~~lr~~~~lplilKGI~~~--------eDA~~A~~~G~d  244 (351)
T cd04737         176 ---QFPFGMPNLNHFSEGTGKGKGISEIYAAAKQKLSPADIEFIAKISGLPVIVKGIQSP--------EDADVAINAGAD  244 (351)
T ss_pred             ---CCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHCCCCEEECCCCCH--------HHHHHHHHCCCC
T ss_conf             ---889998722344677755555688988632579989999999864998532366779--------999999874998


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHH
Q ss_conf             99980665553234577544632211356454246899999997408974899967889999999999839997545278
Q gi|254780434|r  239 GIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSA  318 (362)
Q Consensus       239 Giv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Ta  318 (362)
                      ||+++|-          ..++.-|       .|.+.+.+-++++.++++++|+--|||.+|.|+++.|..||++|.++..
T Consensus       245 gIvVSNH----------GGRQLD~-------~p~~i~~LpeI~~av~~~~~V~~DgGIR~G~DV~KALALGA~aV~iGRp  307 (351)
T cd04737         245 GIWVSNH----------GGRQLDG-------GPASFDSLPEIAEAVNHRVPIIFDSGVRRGEHVFKALASGADAVAVGRP  307 (351)
T ss_pred             EEEECCC----------CCCCCCC-------CHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEEEECHH
T ss_conf             8997787----------5123567-------6047889999999866896499769867468999999769988975789


Q ss_pred             HHCC----CH----HHHHHHHHHHHHHHHHCCCCCHHHHHC
Q ss_conf             7706----97----899999999999999838997789616
Q gi|254780434|r  319 MIYE----GI----SLPKRIIQGLSDFLNKENEVNFENIRG  351 (362)
Q Consensus       319 li~~----Gp----~~~~~I~~~L~~~l~~~G~~si~e~iG  351 (362)
                      ++|-    |-    .+++-+.+||..-|..-|++||+|+--
T Consensus       308 ~l~glaa~G~~GV~~~l~iL~~El~~~M~l~G~~si~dl~~  348 (351)
T cd04737         308 VLYGLALGGAQGVASVLEHLNKELKIVMQLAGTRTIEDVKR  348 (351)
T ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCCC
T ss_conf             99988713389999999999999999999868999888490


No 26 
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain. LMO is a FMN-containing enzyme that catalyzes the conversion of L-lactate and oxygen to acetate, carbon dioxide, and water. LMO is a member of the family of alpha-hydroxy acid oxidases.  It is thought to be a homooctamer with two- and four- fold axes in the center of the octamer.
Probab=99.67  E-value=5.9e-13  Score=107.10  Aligned_cols=290  Identities=18%  Similarity=0.239  Sum_probs=166.8

Q ss_pred             HHHHHHHHHHHH-HHHHHCC-CCCCCCCCEEEECCEECCCCEEEC----CC-CCCCHHH--HHHHHHCCCCEEECC--CC
Q ss_conf             788999999996-2011104-678896311688873359974853----46-8886779--888740367524102--00
Q gi|254780434|r   19 EIAHHLSIVALK-SGLLSFF-PVHSDPRLNTKVAGISLSNPLGMA----AG-YDKNAEV--PIELLKLGFGFVEIG--TV   87 (362)
Q Consensus        19 e~ah~~~~~~~~-~~~~~~~-~~~~~~~L~~~~~Gl~~~nPiglA----aG-~dk~~~~--~~~l~~~G~G~v~~k--ti   87 (362)
                      |.+++-...+++ ..+.|+. ...++++++++++|.++.-||++|    ++ +..++|.  -+.....|.-++..-  |.
T Consensus        47 e~tl~~N~~af~~~~l~PRvL~dv~~~d~~t~llG~~~~~P~~iaP~g~~~l~hp~gE~~~AraA~~~g~~~~lSt~ss~  126 (383)
T cd03332          47 ESTARANRDAFSRWRIVPRMLRGVTERDLSVELFGRTLAAPLLLAPIGVQELFHPDAELATARAAAELGVPYILSTASSS  126 (383)
T ss_pred             HHHHHHHHHHHHHCCEECCCCCCCCCCCCCEEECCEECCCCEEECHHHHHHCCCCCHHHHHHHHHHHHCCCEECCCCCCC
T ss_conf             69999999999855776711358888888645798156777388778774414897789999999983586220577678


Q ss_pred             CCCCC-CCC-CCCCEEEEE--CCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEE----CCCCCH-----------H
Q ss_conf             13687-899-886268842--5554100002477777889998764100012100011----045424-----------6
Q gi|254780434|r   88 TPHPQ-AGN-PRPRVFRLT--KDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLG----ANKDSK-----------D  148 (362)
Q Consensus        88 t~~p~-~GN-p~PR~~r~~--~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~----~~~~s~-----------~  148 (362)
                      +++.- .-+ ..|+.|.+.  .|+.+          .+.+++|-++.... -+.+.+-    ++.+-+           .
T Consensus       127 slEeva~~~~~~~~wfQLY~~~Dr~~----------~~~ll~RA~~aG~~-aLvlTVD~Pv~G~Rerd~r~g~~P~~~~~  195 (383)
T cd03332         127 SIEDVAAAAGDAPRWFQLYWPKDDDL----------TESLLRRAEKAGYR-VLVVTLDTWSLGWRPRDLDLGYLPFLRGI  195 (383)
T ss_pred             CHHHHHHHCCCCCEEEEEECCCCHHH----------HHHHHHHHHHCCCC-EEEEECCCCCCCCCHHHHHCCCCCCCCCH
T ss_conf             89999986689963999951588899----------99999999973897-79992268666876545532688643303


Q ss_pred             HHHHHHH---HHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE--CCCCCCHH
Q ss_conf             7887765---554206755269830333653221100002343211112244455655312688517865--05777748
Q gi|254780434|r  149 FILDYVS---GIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLK--ISPDLSEE  223 (362)
Q Consensus       149 ~~~dy~~---~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vK--LsPd~~~~  223 (362)
                      ...++..   ....+.   .-...+...+.....   ............-..+.+....+...+.|+++|  ++|     
T Consensus       196 ~~~~~~~~p~~~~~~~---~~~~~~~~~~~~~~~---~~~~~~~~~~d~~ltW~di~wlr~~w~~plilKGI~~~-----  264 (383)
T cd03332         196 GIANYFSDPVFRKKLA---EPVGEDPEAPPPMEA---AVARFVSVFSGPSLTWEDLAFLREWTDLPIVLKGILHP-----  264 (383)
T ss_pred             HHHHHCCCHHHHHHHC---CCCCCCCCCCCCCHH---HHHHHHHHCCCCCCCHHHHHHHHHHCCCCEEECCCCCH-----
T ss_conf             6777547889999732---567765456775014---59999985378889989999999876998532356899-----


Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHH
Q ss_conf             88999998764498299980665553234577544632211356454246899999997408974899967889999999
Q gi|254780434|r  224 ELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDAL  303 (362)
Q Consensus       224 ~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~  303 (362)
                         +=|..|.++|+|||+++|-          ...+.-+       .|.+.+.+-++++.++++++|+--|||.+|.|++
T Consensus       265 ---eDA~~A~~~G~dgIiVSNH----------GGRQLD~-------apa~i~~LpeI~~aV~~~~~V~~DgGIRrG~DV~  324 (383)
T cd03332         265 ---DDARRAVEAGVDGVVVSNH----------GGRQVDG-------SIAALDALPEIVEAVGDRLTVLFDSGVRTGADIM  324 (383)
T ss_pred             ---HHHHHHHHCCCCEEEEECC----------CCCCCCC-------CCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHH
T ss_conf             ---9999999759988998078----------6344678-------8327899999999847998499979978679999


Q ss_pred             HHHHCCCCEEEECHHHHCC----CH----HHHHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             9998399975452787706----97----89999999999999983899778961
Q gi|254780434|r  304 DKIMAGANLIQLYSAMIYE----GI----SLPKRIIQGLSDFLNKENEVNFENIR  350 (362)
Q Consensus       304 e~l~aGAs~VQi~Tali~~----Gp----~~~~~I~~~L~~~l~~~G~~si~e~i  350 (362)
                      +.+..||++|.++..++|-    |-    .++.-+.+||..-|..-|..||+|+-
T Consensus       325 KAlALGA~~V~iGRp~l~glaa~G~~GV~~~l~iL~~El~~~M~l~G~~si~el~  379 (383)
T cd03332         325 KALALGAKAVLIGRPYAYGLALGGEDGVEHVLRNLLAELDLTMGLAGIRSIAELT  379 (383)
T ss_pred             HHHHCCCCEEEECHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCC
T ss_conf             9997699989877899998772319999999999999999999985899977859


No 27 
>PRK11197 lldD L-lactate dehydrogenase; Provisional
Probab=99.67  E-value=2.5e-13  Score=109.70  Aligned_cols=294  Identities=21%  Similarity=0.282  Sum_probs=168.9

Q ss_pred             HHHHHHHHHHH-HHHHHHC-CCCCCCCCCEEEECCEECCCCEEEC----CC-CCCCHHH--HHHHHHCCCCEEECC--CC
Q ss_conf             78899999999-6201110-4678896311688873359974853----46-8886779--888740367524102--00
Q gi|254780434|r   19 EIAHHLSIVAL-KSGLLSF-FPVHSDPRLNTKVAGISLSNPLGMA----AG-YDKNAEV--PIELLKLGFGFVEIG--TV   87 (362)
Q Consensus        19 e~ah~~~~~~~-~~~~~~~-~~~~~~~~L~~~~~Gl~~~nPiglA----aG-~dk~~~~--~~~l~~~G~G~v~~k--ti   87 (362)
                      |.+.+-...++ +..+.|+ +...+..+++++++|.+++-||++|    ++ +..++|.  -+...+.|.-++.--  |.
T Consensus        32 e~tl~~N~~af~~~~l~PRvL~dvs~~dtst~llG~~~~~P~~iaP~g~~~l~hp~gE~a~ArAA~~~gi~~~lSt~ss~  111 (381)
T PRK11197         32 EYTLRRNVEDLADIALRQRVLKNMSDLSLETELFGETLAMPVALAPVGLTGMYARRGEVQAARAADAKGIPFTLSTVSVC  111 (381)
T ss_pred             HHHHHHHHHHHHHCCEECCCCCCCCCCCCCEEECCCCCCCCEEECHHHHHCCCCCCHHHHHHHHHHHHCCCEEECCCCCC
T ss_conf             29999999999846175501468777888634788306777346757774167897579999999970771783277656


Q ss_pred             CCCC-CCCCCCCCEEEEECCCCCEEECCCCCCC-HHHHHHHHHHHHHCCCCCCEEE----CCCCCH---------HHHHH
Q ss_conf             1368-7899886268842555410000247777-7889998764100012100011----045424---------67887
Q gi|254780434|r   88 TPHP-QAGNPRPRVFRLTKDRAIINKLGFNNAG-YHTVFSRLSKIQPTSPIGINLG----ANKDSK---------DFILD  152 (362)
Q Consensus        88 t~~p-~~GNp~PR~~r~~~~~~iiN~~Gl~N~G-~~~~~~~l~~~~~~~pi~vsI~----~~~~s~---------~~~~d  152 (362)
                      +++. .+..+.|+.|.+.-         +.+++ .+.+++|-++.... -+.+.+-    ++.+.+         ....-
T Consensus       112 slEeva~a~~~~~WfQLY~---------~~Dr~~~~~ll~RA~~aG~~-alvlTVD~pv~g~R~rd~rn~~~~p~~~~~~  181 (381)
T PRK11197        112 PIEEVAPAIKRPMWFQLYV---------LRDRGFMRNALERAKAAGCS-TLVFTVDMPVPGARYRDAHSGMSGPNAAMRR  181 (381)
T ss_pred             CHHHHHHHCCCCEEEEEEE---------CCCHHHHHHHHHHHHHCCCC-EEEEECCCCCCCCCHHHHCCCCCCCCCHHHH
T ss_conf             7999986358973899841---------38889999999999984998-7998078887786655430677789812878


Q ss_pred             HHHHHHHHCCCCCEEEEE-CCCC----CCCC----CCCCCC-HHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE--CCCCC
Q ss_conf             765554206755269830-3336----5322----110000-2343211112244455655312688517865--05777
Q gi|254780434|r  153 YVSGIRLFFTIASYFTIN-ISSP----NTPG----LRSLQK-KKNLERLLIHVMQTREEEKIKTGKFVPIFLK--ISPDL  220 (362)
Q Consensus       153 y~~~~~~~~~~aD~iEiN-iSCP----Nt~g----~~~~~~-~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vK--LsPd~  220 (362)
                      +.+.+..  +. =.++.. ..-|    |...    .....+ ...+...+..-..+.+....+...+.||++|  ++|  
T Consensus       182 ~~~~~~~--P~-w~~~~~~~g~p~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~ltW~di~wlr~~w~~plvlKGIl~~--  256 (381)
T PRK11197        182 YLQAVTH--PQ-WAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLGNNFDPSISWKDLEWIREFWDGPMVIKGILDP--  256 (381)
T ss_pred             HHHHHCC--CH-HHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCEEEECCCCH--
T ss_conf             9988648--17-877633447886544310013776558889999875058889999999999872997678525889--


Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHH
Q ss_conf             74888999998764498299980665553234577544632211356454246899999997408974899967889999
Q gi|254780434|r  221 SEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTK  300 (362)
Q Consensus       221 ~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~  300 (362)
                            +=+..|.++|+|||+++|-          ...+.-+       .|.+++++-++++.++++++|+--|||.+|.
T Consensus       257 ------eDA~~A~~~G~dgIiVSNH----------GGRQLD~-------apa~i~~LpeI~~aV~~~~~V~~DgGiRrG~  313 (381)
T PRK11197        257 ------EDARDAVRFGADGIVVSNH----------GGRQLDG-------VLSSARALPAIADAVKGDIAILADSGIRNGL  313 (381)
T ss_pred             ------HHHHHHHHCCCCEEEEECC----------CCCCCCC-------CCCHHHHHHHHHHHHCCCCEEEEECCCCCHH
T ss_conf             ------9999999669988999577----------6321567-------8448999999999867897399968978668


Q ss_pred             HHHHHHHCCCCEEEECHHHHCC----C---H-HHHHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             9999998399975452787706----9---7-89999999999999983899778961
Q gi|254780434|r  301 DALDKIMAGANLIQLYSAMIYE----G---I-SLPKRIIQGLSDFLNKENEVNFENIR  350 (362)
Q Consensus       301 Da~e~l~aGAs~VQi~Tali~~----G---p-~~~~~I~~~L~~~l~~~G~~si~e~i  350 (362)
                      |+++.|..||++|.++..++|-    |   . .++.-+.+||..-|..-|..+|+|+-
T Consensus       314 DV~KALALGA~aV~vGRp~lygLaa~G~~GV~~~l~iL~~El~~~M~l~G~~~i~~l~  371 (381)
T PRK11197        314 DVVRMIALGADTVLLGRAFVYALAAAGQAGVANLLDLIEKEMRVAMTLTGAKSISEIT  371 (381)
T ss_pred             HHHHHHHCCCCEEEECHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCC
T ss_conf             9999997699889767599998771338899999999999999999985899967879


No 28 
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]
Probab=99.66  E-value=4.4e-14  Score=114.75  Aligned_cols=226  Identities=19%  Similarity=0.244  Sum_probs=151.5

Q ss_pred             EECCEECCCCEEEC--CCCCCCHHHHHHHHH-CCC-CEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHH
Q ss_conf             88873359974853--468886779888740-367-52410200136878998862688425554100002477777889
Q gi|254780434|r   48 KVAGISLSNPLGMA--AGYDKNAEVPIELLK-LGF-GFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTV  123 (362)
Q Consensus        48 ~~~Gl~~~nPiglA--aG~dk~~~~~~~l~~-~G~-G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~  123 (362)
                      ++....++|++.+|  +|. +|. .++.+.. .|. +.+.+-=|+..+..=+++.++                       
T Consensus         3 ~~~~~~~~~~~~lAPM~gv-td~-~fR~l~~~~ga~~l~~TEmv~~~~~~~~~~~~~-----------------------   57 (323)
T COG0042           3 KIGLIELRNRVILAPMAGV-TDL-PFRRLARELGAYDLLYTEMVSAKALLHGRKKFL-----------------------   57 (323)
T ss_pred             CCCCCCCCCCEEEECCCCC-CCH-HHHHHHHHHCCCCEEEEEEEECCHHHCCCHHHH-----------------------
T ss_conf             6455556787788348898-668-999999995887528974045304552770044-----------------------


Q ss_pred             HHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCC------CCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             9987641000121000110454246788776555420675526983033365------3221100002343211112244
Q gi|254780434|r  124 FSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPN------TPGLRSLQKKKNLERLLIHVMQ  197 (362)
Q Consensus       124 ~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPN------t~g~~~~~~~~~l~~~l~~v~~  197 (362)
                       ..+.......|+.+.|+++.+  +.+.+-+..+....  +|.|+||..||-      ..|-..+.+++.+.+++++++.
T Consensus        58 -~~~~~~~~e~p~~vQl~gsdp--~~laeaA~~~~~~g--~~~IDlN~GCP~~~V~~~g~Ga~Ll~~p~lv~~iv~a~~~  132 (323)
T COG0042          58 -LLLDELEEERPVAVQLGGSDP--ELLAEAAKIAEELG--ADIIDLNCGCPSPKVVKGGAGAALLKNPELLAEIVKAMVE  132 (323)
T ss_pred             -HCCCCCCCCCCEEEEECCCCH--HHHHHHHHHHHHCC--CCEEEEECCCCCHHHHCCCCCHHHCCCHHHHHHHHHHHHH
T ss_conf             -305645667877999738998--99999999998669--9989876899928980898447771798999999999998


Q ss_pred             HHHHHHHHCCCCCEEEEECC--CCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             45565531268851786505--7777488899999876449829998066555323457754463221135645424689
Q gi|254780434|r  198 TREEEKIKTGKFVPIFLKIS--PDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTI  275 (362)
Q Consensus       198 ~~~~~~~~~~~~~Pi~vKLs--Pd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~  275 (362)
                      ...        ++||.||+-  .|-.+....+++++++++|++.+++=-    |..         .-+++|+    .-.+
T Consensus       133 av~--------~iPVTVKiRlG~d~~~~~~~~ia~~~~~~G~~~ltVHg----Rtr---------~~~y~~~----a~~~  187 (323)
T COG0042         133 AVG--------DIPVTVKIRLGWDDDDILALEIARILEDAGADALTVHG----RTR---------AQGYLGP----ADWD  187 (323)
T ss_pred             HCC--------CCCEEEEEECCCCCHHCCHHHHHHHHHHCCCCEEEEEC----CCH---------HHCCCCC----CCHH
T ss_conf             538--------88749998578780020099999999967987899955----667---------6468986----4879


Q ss_pred             HHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHC-CCCEEEECHHHHCCCHHHHHHH
Q ss_conf             999999740897489996788999999999983-9997545278770697899999
Q gi|254780434|r  276 ALAKIRQRVGPKIAIIGTGGISSTKDALDKIMA-GANLIQLYSAMIYEGISLPKRI  330 (362)
Q Consensus       276 ~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~a-GAs~VQi~Tali~~Gp~~~~~I  330 (362)
                      .|+++++.++. +|||+.|+|.|++|+.+++.- |+|.|+++.+. |+.|+++++|
T Consensus       188 ~I~~vk~~~~~-ipvi~NGdI~s~~~a~~~l~~tg~DgVMigRga-~~nP~l~~~i  241 (323)
T COG0042         188 YIKELKEAVPS-IPVIANGDIKSLEDAKEMLEYTGADGVMIGRGA-LGNPWLFRQI  241 (323)
T ss_pred             HHHHHHHHCCC-CEEEECCCCCCHHHHHHHHHHHCCCEEEECHHH-HCCCHHHHHH
T ss_conf             99999986799-759857994999999999984189879974353-1695575533


No 29 
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain. Members of this family catalyze the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also in some archaea. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. It is likely that different family members have different substrate specificities, which may overlap. 1VHN, a putative flavin oxidoreductase, has high sequence similarity to DUS.  The enzymatic mechanism of 1VHN is not known at the present.
Probab=99.65  E-value=1.5e-14  Score=117.90  Aligned_cols=176  Identities=22%  Similarity=0.257  Sum_probs=126.7

Q ss_pred             HHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCC-CCCEEEEECCCCCC------CCCCCCCCHHHHHHHHHHHH
Q ss_conf             998764100012100011045424678877655542067-55269830333653------22110000234321111224
Q gi|254780434|r  124 FSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFT-IASYFTINISSPNT------PGLRSLQKKKNLERLLIHVM  196 (362)
Q Consensus       124 ~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~-~aD~iEiNiSCPNt------~g~~~~~~~~~l~~~l~~v~  196 (362)
                      ...+.....+.|+++.|++|.     .+++.+.++.+.+ ++|.+.||+.||--      .|-..+.+++.+.+++.+++
T Consensus        45 ~~~~~~~~~e~p~~~Ql~g~~-----p~~~~~aa~~~~~~g~d~IDlN~GCP~~~v~~~g~Ga~Ll~~p~~v~~iv~~~~  119 (231)
T cd02801          45 LRLLTRNPEERPLIVQLGGSD-----PETLAEAAKIVEELGADGIDLNMGCPSPKVTKGGAGAALLKDPELVAEIVRAVR  119 (231)
T ss_pred             HHHHCCCCCCCEEEEEECCCC-----HHHHHHHHHHHHHCCCCEEEEECCCCHHHHCCCCCCHHHHHCHHHHHHHHHHHH
T ss_conf             987244866780799875898-----999999999887539999998389996997089830787629789999999999


Q ss_pred             HHHHHHHHHCCCCCEEEEECC--CCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             445565531268851786505--777748889999987644982999806655532345775446322113564542468
Q gi|254780434|r  197 QTREEEKIKTGKFVPIFLKIS--PDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKST  274 (362)
Q Consensus       197 ~~~~~~~~~~~~~~Pi~vKLs--Pd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al  274 (362)
                      +.         ..+||.||+-  .+- .++..++++.++++|++.+++=-    |....         .++|++    -.
T Consensus       120 ~~---------~~ipVsvKiRlg~~~-~~~~~~~~~~l~~~G~~~ltvH~----Rt~~q---------~~~~~a----~~  172 (231)
T cd02801         120 EA---------VPIPVTVKIRLGWDD-EEETLELAKALEDAGASALTVHG----RTREQ---------RYSGPA----DW  172 (231)
T ss_pred             HH---------CCCCEEEEEEECCCC-HHHHHHHHHHHHHCCCCEEEEEC----CCHHH---------CCCCCC----CH
T ss_conf             75---------699479999707786-34799999999976998999835----61441---------467762----26


Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHC-CCCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             9999999740897489996788999999999983-99975452787706978999999999
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIMA-GANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~a-GAs~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                      +.|+++++..  ++|+|+.|||.|.+|+.+++.. |+|.|+++.+.+.+ |+++++|.+.+
T Consensus       173 e~i~~~~~~~--~ipvi~NGdI~s~~d~~~~~~~tg~dgvMigRgal~n-P~iF~~i~~~~  230 (231)
T cd02801         173 DYIAEIKEAV--SIPVIANGDIFSLEDALRCLEQTGVDGVMIGRGALGN-PWLFREIKELL  230 (231)
T ss_pred             HHHHHHHHCC--CCEEEEECCCCCHHHHHHHHHHHCCCEEEECHHHHHC-CHHHHHHHHHH
T ss_conf             9999998659--9779983890999999999985099999987888769-88999999975


No 30 
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2; InterPro: IPR011179   This group represents the bacterial and archaeal isopentenyl-diphosphate delta-isomerase (IPP isomerase). IPP isomerase catalyses the interconversion of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), and is a key enzyme in the biosynthesis of isoprenoids via the mevalonate pathway. The bacterial and archaeal IPP isomerase (type 2 enzyme) differs from that found in eukaryotes (type 1 enzyme), and requires NADPH, magnesium, and FMN for activity , .; GO: 0004452 isopentenyl-diphosphate delta-isomerase activity, 0010181 FMN binding, 0008299 isoprenoid biosynthetic process, 0005737 cytoplasm.
Probab=99.65  E-value=4.7e-15  Score=121.27  Aligned_cols=262  Identities=19%  Similarity=0.260  Sum_probs=172.2

Q ss_pred             CCCCCCCEEEECCEECCCCEEECCCCCC--------CHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCE
Q ss_conf             7889631168887335997485346888--------67798887403675241020013687899886268842555410
Q gi|254780434|r   39 VHSDPRLNTKVAGISLSNPLGMAAGYDK--------NAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAII  110 (362)
Q Consensus        39 ~~~~~~L~~~~~Gl~~~nPiglAaG~dk--------~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~ii  110 (362)
                      ..+|.||+|+|+|.+|+-||.++|=...        |.+.-+...++|++ +-+||-           |.          
T Consensus        40 ~~~~idl~t~flG~~~~~P~~I~aMTGG~~~~a~~IN~~LA~aA~e~gi~-mgvGSq-----------ra----------   97 (349)
T TIGR02151        40 NLDEIDLTTEFLGKRLKAPFLINAMTGGSEEKAGKINRKLARAAEELGIP-MGVGSQ-----------RA----------   97 (349)
T ss_pred             CHHHCCCEEEECCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHCCC-EEECHH-----------HH----------
T ss_conf             75362642444682211676761455773678889989999999981981-543002-----------22----------


Q ss_pred             EECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCH----HHHHHHHHHHHHHCCCCCEEEEECCCCC----CCCCCCC
Q ss_conf             0002477777889998764100012100011045424----6788776555420675526983033365----3221100
Q gi|254780434|r  111 NKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSK----DFILDYVSGIRLFFTIASYFTINISSPN----TPGLRSL  182 (362)
Q Consensus       111 N~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~----~~~~dy~~~~~~~~~~aD~iEiNiSCPN----t~g~~~~  182 (362)
                         -|.+|-...-.+.+++..|+.|+++|||....-+    ...++-.+.++.+.  ||+|.|-+-...    ..|.|.|
T Consensus        98 ---al~~P~~~~tF~~vR~~aP~~~l~AN~GA~q~~~~~~~~g~~~~~~aid~i~--AdAL~iHlN~~QE~vqpEGDr~F  172 (349)
T TIGR02151        98 ---ALKDPEVAETFEVVREEAPNGPLIANIGAPQLVEGGKKYGVEEAQEAIDMIE--ADALAIHLNVLQELVQPEGDRNF  172 (349)
T ss_pred             ---HHCCCHHHHHHHHHHHHCCCCCEEECCCHHHHHCCCCCCCHHHHHHHHHHHH--HHHHHHHHHHHCCCCCCCCCHHH
T ss_conf             ---1127124666999997679833787178788740653448899999998751--01335543233025579997015


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE-----CCCCCCHHHHHHHHHHHHHCCCCEEEEEC---CC-----CCC
Q ss_conf             002343211112244455655312688517865-----05777748889999987644982999806---65-----553
Q gi|254780434|r  183 QKKKNLERLLIHVMQTREEEKIKTGKFVPIFLK-----ISPDLSEEELDDIAVEVLSHKVEGIIVSN---TT-----LSR  249 (362)
Q Consensus       183 ~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vK-----LsPd~~~~~i~~ia~~a~~~g~dGiv~~N---T~-----~~~  249 (362)
                           ....+..+.+.      ...-++||+||     ||        .+.++.+.+.|+++|=+.-   |.     ..|
T Consensus       173 -----~~G~l~~i~~~------~~~~~vPVIvKEvG~G~S--------~e~a~~L~~~Gv~aiDv~G~GGTswa~vE~~R  233 (349)
T TIGR02151       173 -----SKGWLEKIAEI------CSAVSVPVIVKEVGFGIS--------KEVAKLLADAGVKAIDVSGAGGTSWAAVENYR  233 (349)
T ss_pred             -----HHHHHHHHHHH------HHHCCCCEEEEECCCCCC--------HHHHHHHHHCCEEEEEECCCCCCCHHHHHHHH
T ss_conf             -----65389999999------965289879982157998--------89999998789008870787675599999887


Q ss_pred             -CCCC--CC----CCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC-
Q ss_conf             -2345--77----544632211356454246899999997408974899967889999999999839997545278770-
Q gi|254780434|r  250 -KGVQ--CS----DNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY-  321 (362)
Q Consensus       250 -~~~~--~~----~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~-  321 (362)
                       ..-.  ..    ..-.+. |+|       +..++.+++....++.||||+|||.||-|+.+-|..||++|.+.-.+.. 
T Consensus       234 r~~~~~~~~~r~a~~f~~W-Gip-------T~~sL~~~~~~~~~~~~~iASGG~r~GlD~AKAlALGA~~~G~A~~~L~~  305 (349)
T TIGR02151       234 RAKESNQKYERLASAFSDW-GIP-------TAASLLEVRSIDAPDAPLIASGGLRTGLDVAKALALGADAVGMARPLLKA  305 (349)
T ss_pred             HHCCCCCHHHHHHHHHHHC-CCC-------HHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             5157523578887777414-886-------68999998642124773688467778889999999621188888999998


Q ss_pred             ---CCH----HHHHHHHHHHHHHHHHCCCCCHHHHHCCCC
Q ss_conf             ---697----899999999999999838997789616975
Q gi|254780434|r  322 ---EGI----SLPKRIIQGLSDFLNKENEVNFENIRGSYT  354 (362)
Q Consensus       322 ---~Gp----~~~~~I~~~L~~~l~~~G~~si~e~iG~~~  354 (362)
                         +|+    ..++.+.+||+-.|=--|.+||.|+..+..
T Consensus       306 ~~~~g~e~~~~~~~~~~~eLk~~mfl~G~~~i~EL~~~~~  345 (349)
T TIGR02151       306 ALDEGEEAVIEEIELIIEELKVAMFLTGAKNIKELKKVPL  345 (349)
T ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHCCCCE
T ss_conf             8526988999999999999999998717988798617871


No 31 
>pfam01207 Dus Dihydrouridine synthase (Dus). Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also in some archae. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. It is likely that different family members have different substrate specificities, which may overlap. Dus 1 from Saccharomyces cerevisiae acts on pre-tRNA-Phe, while Dus 2 acts on pre-tRNA-Tyr and pre-tRNA-Leu. Dus 1 is active as a single subunit, requiring NADPH or NADH, and is stimulated by the presence of FAD. Some family members may be targeted to the mitochondria and even have a role in mitochondria.
Probab=99.64  E-value=3.6e-14  Score=115.35  Aligned_cols=176  Identities=20%  Similarity=0.267  Sum_probs=127.6

Q ss_pred             HHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCC-CCCEEEEECCCCC------CCCCCCCCCHHHHHHHHHHH
Q ss_conf             9998764100012100011045424678877655542067-5526983033365------32211000023432111122
Q gi|254780434|r  123 VFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFT-IASYFTINISSPN------TPGLRSLQKKKNLERLLIHV  195 (362)
Q Consensus       123 ~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~-~aD~iEiNiSCPN------t~g~~~~~~~~~l~~~l~~v  195 (362)
                      ....+.......|+++.|+++.+     +++.+.++.+.+ ++|.+.||+.||-      ..|--.+.+++.+.+++.++
T Consensus        43 ~~~~~~~~~~e~P~~~Ql~G~dp-----~~~~~aa~~~~~~g~d~IDlN~GCP~~~v~~~g~GsaLl~~p~~~~~iv~a~  117 (309)
T pfam01207        43 RELMLPELEEPTPLAVQLGGSDP-----ALLAEAAKLVADLGADIIDINMGCPAKKVTRGGAGAALLRDPDLVAQIVKAV  117 (309)
T ss_pred             HHHHCCCCCCCCCEEEEEECCCH-----HHHHHHHHHHHHCCCCEEEEECCCCHHHHCCCCCCEEHHHCHHHHHHHHHHH
T ss_conf             88742007678972899936999-----9999999998863999896518999999878997762541778999999999


Q ss_pred             HHHHHHHHHHCCCCCEEEEEC--CCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             444556553126885178650--577774888999998764498299980665553234577544632211356454246
Q gi|254780434|r  196 MQTREEEKIKTGKFVPIFLKI--SPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKS  273 (362)
Q Consensus       196 ~~~~~~~~~~~~~~~Pi~vKL--sPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~a  273 (362)
                      +..         ..+||.||+  .+|-+.+...++++.++++|++.|++--    |..         .=+++|++    -
T Consensus       118 ~~~---------~~~PVtvK~RlG~d~~~~~~~~~~~~l~~~G~~~itvH~----Rt~---------~q~~~g~a----~  171 (309)
T pfam01207       118 VKA---------VDIPVTVKIRIGWDESHENAVEIARRVEDAGAQALTVHG----RTR---------AQNYEGPA----D  171 (309)
T ss_pred             HHH---------CCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEC----CCH---------HHCCCCCC----C
T ss_conf             975---------588546754337887638899999999846888799967----632---------40267865----4


Q ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHH-CCCCEEEECHHHHCCCHHHHHHHHH
Q ss_conf             8999999974089748999678899999999998-3999754527877069789999999
Q gi|254780434|r  274 TIALAKIRQRVGPKIAIIGTGGISSTKDALDKIM-AGANLIQLYSAMIYEGISLPKRIIQ  332 (362)
Q Consensus       274 l~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~-aGAs~VQi~Tali~~Gp~~~~~I~~  332 (362)
                      -+.|+++++.+  .+|+|+.|+|.|.+|+.+++. .|+|.|+++.+.+.+ |++++++..
T Consensus       172 w~~i~~~k~~~--~ipvi~NGdi~~~~d~~~~l~~tg~dgvMigRga~~n-Pwif~~~~~  228 (309)
T pfam01207       172 WDAIKQVKQAV--SIPVIANGDITDAEDAQRCLSYTGADGVMIGRGALGN-PWLFAEQHT  228 (309)
T ss_pred             HHHHHHHHHHC--CCCEEEECCCCCHHHHHHHHHHHCCCEEEECHHHHHC-CHHHHHHHH
T ss_conf             18999999858--9828980894889999999861099999984897749-888898899


No 32 
>PRK11815 tRNA-dihydrouridine synthase A; Provisional
Probab=99.61  E-value=7.4e-14  Score=113.18  Aligned_cols=179  Identities=18%  Similarity=0.196  Sum_probs=125.5

Q ss_pred             HHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCC-CCCEEEEECCCCCC------CCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             764100012100011045424678877655542067-55269830333653------22110000234321111224445
Q gi|254780434|r  127 LSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFT-IASYFTINISSPNT------PGLRSLQKKKNLERLLIHVMQTR  199 (362)
Q Consensus       127 l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~-~aD~iEiNiSCPNt------~g~~~~~~~~~l~~~l~~v~~~~  199 (362)
                      |.......|+++.|+++.+  +.   +.+.++.+.+ +.|.+.||+.||--      -|-..+.+++.+.+++.+++.. 
T Consensus        58 l~~~~~E~Pv~vQl~G~dp--~~---la~Aa~i~~~~g~d~IDlN~GCP~~kV~~g~~Ga~Lm~~p~~v~~iv~a~~~a-  131 (333)
T PRK11815         58 LAFDPEEHPVALQLGGSDP--AD---LAEAAKLAEDWGYDEINLNVGCPSDRVQNGRFGACLMAEPELVADCVKAMKDA-  131 (333)
T ss_pred             HHCCCCCCCEEEEECCCCH--HH---HHHHHHHHHHCCCCEECCCCCCCHHHHHCCCEEHHHHCCHHHHHHHHHHHHHH-
T ss_conf             5069877987999747999--99---99999999873988535238998688732780178707999999999999873-


Q ss_pred             HHHHHHCCCCCEEEEEC--CCCCC--HHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC---CCHH
Q ss_conf             56553126885178650--57777--48889999987644982999806655532345775446322113564---5424
Q gi|254780434|r  200 EEEKIKTGKFVPIFLKI--SPDLS--EEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSP---LFLK  272 (362)
Q Consensus       200 ~~~~~~~~~~~Pi~vKL--sPd~~--~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~---i~~~  272 (362)
                              .++||-||+  ..|-.  .+.+.++++.++++|++.+++-    .|.        ....|+|++.   +-|.
T Consensus       132 --------~~~PVTvK~RlG~d~~d~~~~l~~f~~~~~~aG~~~i~vH----~R~--------a~l~Glspk~nR~ippl  191 (333)
T PRK11815        132 --------VSIPVTVKHRIGIDDQDSYEFLCDFVDTVAEAGCDRFIVH----ARK--------AWLKGLSPKENREIPPL  191 (333)
T ss_pred             --------CCCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEE----EHH--------HHHCCCCHHHHCCCCCH
T ss_conf             --------4885357863167777528999999999997599889996----027--------87726787775058730


Q ss_pred             HHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             68999999974089748999678899999999998399975452787706978999999999
Q gi|254780434|r  273 STIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       273 al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                      --..|+++++.. +++|||+.|||.|.+|+.+++.- +|.|+++.+. |.-|+++.+|.+.+
T Consensus       192 ~~~~v~~lk~~~-p~ipvi~NGdI~s~~~~~~~l~~-~DGVMiGRga-~~nPwif~~id~~~  250 (333)
T PRK11815        192 DYDRVYRLKRDF-PHLTIEINGGIKTLEEAKEHLQH-VDGVMIGRAA-YHNPYLLAEVDREL  250 (333)
T ss_pred             HHHHHHHHHHHC-CCCEEEECCCCCCHHHHHHHHHC-CCEEEEHHHH-HCCCHHHHHHHHHH
T ss_conf             489999999766-78718845996999999999855-9962114867-55997899999998


No 33 
>PRK10550 tRNA-dihydrouridine synthase C; Provisional
Probab=99.61  E-value=1.3e-13  Score=111.54  Aligned_cols=170  Identities=16%  Similarity=0.191  Sum_probs=121.8

Q ss_pred             HHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCC------CCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             000121000110454246788776555420675526983033365------32211000023432111122444556553
Q gi|254780434|r  131 QPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPN------TPGLRSLQKKKNLERLLIHVMQTREEEKI  204 (362)
Q Consensus       131 ~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPN------t~g~~~~~~~~~l~~~l~~v~~~~~~~~~  204 (362)
                      ..+.|+++.|.++.  .+.+.+-+..+.++  ++|.+.||+.||-      ..|-..+.+++.+.+++.++++..     
T Consensus        60 ~~~~Pv~vQl~G~d--pe~~a~aA~~~~e~--g~~~IDlN~GCP~~~V~k~g~Gs~Ll~~p~~~~~iv~a~~~~v-----  130 (312)
T PRK10550         60 PSGTLVRIQLLGQY--PQWLAENAARAVEL--GSYGVDLNCGCPSKTVNGSGGGATLLKDPELIYQGAKAMREAV-----  130 (312)
T ss_pred             CCCCCEEEEEECCC--HHHHHHHHHHHHHC--CCCEEEEECCCCHHHHCCCCCEEEECCCHHHHHHHHHHHHHHC-----
T ss_conf             77883688842788--89999999999976--9996625479997896689926853289779999999999745-----


Q ss_pred             HCCCCCEEEEEC--CCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             126885178650--577774888999998764498299980665553234577544632211356454246899999997
Q gi|254780434|r  205 KTGKFVPIFLKI--SPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQ  282 (362)
Q Consensus       205 ~~~~~~Pi~vKL--sPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~  282 (362)
                        ..++||-||+  ..|-. +...++++.++++|++.|++--    |..         .-+++|++..   -..|+++++
T Consensus       131 --~~~iPVtvK~RlG~~~~-~~~~e~~~~~~~~G~~~ltvH~----RT~---------~q~y~~~~~d---w~~i~~~~~  191 (312)
T PRK10550        131 --PAHLPVTVKVRLGWDSG-DRKFEIADAVQQAGATELVVHG----RTK---------EQGYRAEHID---WQAIGEIRQ  191 (312)
T ss_pred             --CCCCCCEEEEECCCCCC-CHHHHHHHHHHHCCCCEEEEEC----CCH---------HHCCCCCCCC---HHHHHHHHH
T ss_conf             --87899547753589986-3199999999973998799905----526---------5358998348---999999997


Q ss_pred             HCCCCEEEEEECCCCCHHHHHHHHH-CCCCEEEECHHHHCCCHHHHHHHH
Q ss_conf             4089748999678899999999998-399975452787706978999999
Q gi|254780434|r  283 RVGPKIAIIGTGGISSTKDALDKIM-AGANLIQLYSAMIYEGISLPKRII  331 (362)
Q Consensus       283 ~~~~~i~IIg~GGI~s~~Da~e~l~-aGAs~VQi~Tali~~Gp~~~~~I~  331 (362)
                      .+  ++|+||.|+|.|.+|+.+++. -|+|.|+++.|.+-+ |+++++|.
T Consensus       192 ~~--~iPvi~NGdI~s~~d~~~~~~~tg~dgvMiGRgal~n-P~l~~~i~  238 (312)
T PRK10550        192 RL--TIPVIANGEIWDWQSAQQCMAISGCDAVMIGRGALNI-PNLSRVVK  238 (312)
T ss_pred             HC--CCCEEEECCCCCHHHHHHHHHHHCCCEEEECHHHHHC-CHHHHHHH
T ss_conf             48--9989970795999999999871489999965855309-77999861


No 34 
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain.  MDH is part of a widespread family of homologous FMN-dependent a-hydroxy acid oxidizing enzymes that oxidizes (S)-mandelate to phenylglyoxalate. MDH is an enzyme in the mandelate pathway that occurs in several strains of Pseudomonas which converts (R)-mandelate to benzoate. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).
Probab=99.57  E-value=3e-11  Score=95.66  Aligned_cols=291  Identities=16%  Similarity=0.157  Sum_probs=163.5

Q ss_pred             HHHHHHHHHHH-HHHHHHCC-CCCCCCCCEEEECCEECCCCEEECC-C----CCCCHH--HHHHHHHCCCCEEEC--CCC
Q ss_conf             78899999999-62011104-6788963116888733599748534-6----888677--988874036752410--200
Q gi|254780434|r   19 EIAHHLSIVAL-KSGLLSFF-PVHSDPRLNTKVAGISLSNPLGMAA-G----YDKNAE--VPIELLKLGFGFVEI--GTV   87 (362)
Q Consensus        19 e~ah~~~~~~~-~~~~~~~~-~~~~~~~L~~~~~Gl~~~nPiglAa-G----~dk~~~--~~~~l~~~G~G~v~~--kti   87 (362)
                      |.+.+-...++ +..+.|+. ...++++++|+++|.+++-||++|. |    +..++|  .-+...+.|.-++.-  .|.
T Consensus        26 e~t~~~N~~af~~~~l~PrvL~dv~~~d~st~llG~~~~~P~~iaP~g~~~l~hp~gE~a~AraA~~~gi~~~lSt~ss~  105 (361)
T cd04736          26 EKGLRHNRDAFDRWRFIPRRLVDVSKRDISASLFGKVWSAPLVIAPTGLNGAFWPNGDLALARAAAKAGIPFVLSTASNM  105 (361)
T ss_pred             HHHHHHHHHHHHHCCEECCCCCCCCCCCCCCCCCCCCCCCCEEECCHHHHHHHCCCCHHHHHHHHHHCCCCEEECCCCCC
T ss_conf             59999999999847576622358878997631588405785478763577660888429999999987987896799999


Q ss_pred             CCCCC-CCCCCCCEEEEECCCCCEEECCCCCCC-HHHHHHHHHHHHHCCCCCCEEE----CCCC-------------CHH
Q ss_conf             13687-899886268842555410000247777-7889998764100012100011----0454-------------246
Q gi|254780434|r   88 TPHPQ-AGNPRPRVFRLTKDRAIINKLGFNNAG-YHTVFSRLSKIQPTSPIGINLG----ANKD-------------SKD  148 (362)
Q Consensus        88 t~~p~-~GNp~PR~~r~~~~~~iiN~~Gl~N~G-~~~~~~~l~~~~~~~pi~vsI~----~~~~-------------s~~  148 (362)
                      +++.- +.-+.|+.|.+.-          .++. .+.++++-++.... -+.+-+-    ++.+             +..
T Consensus       106 s~EeVa~~~~g~~wfQLY~----------~~r~~~~~li~RA~~aG~~-alvlTvD~pv~G~Rerd~rngf~~P~~~~~~  174 (361)
T cd04736         106 SIEDVARQADGDLWFQLYV----------VHRELAELLVKRALAAGYT-TLVLTTDVAVNGYRERDLRNGFAIPFRYTPR  174 (361)
T ss_pred             CHHHHHHHCCCCEEEEEEE----------CCHHHHHHHHHHHHHCCCC-EEEEECCCCCCCCCCHHHHCCCCCCCCCCHH
T ss_conf             9999986259984799887----------2879999999999985998-6899507888788835432256788655677


Q ss_pred             HHHHHH----HHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE--CCCCCCH
Q ss_conf             788776----5554206755269830333653221100002343211112244455655312688517865--0577774
Q gi|254780434|r  149 FILDYV----SGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLK--ISPDLSE  222 (362)
Q Consensus       149 ~~~dy~----~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vK--LsPd~~~  222 (362)
                      ...|..    -.++.+..... ---|+.-+...+..  .....+...+..-..+.+....+...+.|+++|  ++|    
T Consensus       175 ~~~~~~~~P~w~~~~~~~g~p-~~~~~~~~~~~~~~--~~~~~~~~~~~~~~tW~di~wlr~~w~~plilKGI~~~----  247 (361)
T cd04736         175 VLLDGILHPRWLLRFLRNGMP-QLANFASDDAIDVE--VQAALMSRQMDASFNWQDLRWLRDLWPHKLLVKGIVTA----  247 (361)
T ss_pred             HHHHHCCCCHHHHHHHHCCCC-CCCCCCCCCCCCCH--HHHHHHHHCCCCCCCHHHHHHHHHHCCCCEEEECCCCH----
T ss_conf             887751593889976502773-10234677777705--78899884368899999999999866997455214899----


Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHH
Q ss_conf             88899999876449829998066555323457754463221135645424689999999740897489996788999999
Q gi|254780434|r  223 EELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDA  302 (362)
Q Consensus       223 ~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da  302 (362)
                          +=+..|.++|+|||+++|-          ...+.-|       .|.+++++.++++.++  .+|+=-|||.+|.|+
T Consensus       248 ----eDA~~A~~~G~dgIiVSNH----------GGRQLD~-------a~~~id~Lp~I~~av~--~~V~~DgGIRrG~DV  304 (361)
T cd04736         248 ----EDAKRCIELGADGVILSNH----------GGRQLDD-------AIAPIEALAEIVAATY--KPVLIDSGIRRGSDI  304 (361)
T ss_pred             ----HHHHHHHHCCCCEEEECCC----------CCCCCCC-------CCCHHHHHHHHHHHHC--CEEEEECCCCCHHHH
T ss_conf             ----9999998769999997588----------6333577-------7414777999999719--949994898878999


Q ss_pred             HHHHHCCCCEEEECHHHHCC----CH----HHHHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             99998399975452787706----97----89999999999999983899778961
Q gi|254780434|r  303 LDKIMAGANLIQLYSAMIYE----GI----SLPKRIIQGLSDFLNKENEVNFENIR  350 (362)
Q Consensus       303 ~e~l~aGAs~VQi~Tali~~----Gp----~~~~~I~~~L~~~l~~~G~~si~e~i  350 (362)
                      ++.|..||++|.++..++|-    |-    .+++-+.+||..-|..-|+.||+|+-
T Consensus       305 ~KALALGA~aV~iGRp~lygLaa~G~~GV~~~l~iL~~El~~~M~l~G~~sv~el~  360 (361)
T cd04736         305 VKALALGANAVLLGRATLYGLAARGEAGVSEVLRLLKEEIDRTLALIGCPDIASLT  360 (361)
T ss_pred             HHHHHCCCCEEEECHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCC
T ss_conf             99997799989877899998771109999999999999999999985899867769


No 35 
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day.  Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.
Probab=99.51  E-value=1.2e-11  Score=98.40  Aligned_cols=258  Identities=22%  Similarity=0.246  Sum_probs=151.5

Q ss_pred             EEEECCEECCCCEEECCCC----CCC-------HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECC
Q ss_conf             1688873359974853468----886-------77988874036752410200136878998862688425554100002
Q gi|254780434|r   46 NTKVAGISLSNPLGMAAGY----DKN-------AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLG  114 (362)
Q Consensus        46 ~~~~~Gl~~~nPiglAaG~----dk~-------~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~G  114 (362)
                      +.++.+++++|.|+.|+=.    +.+       ..++.+...-|+|.++++.+...|.. ...|+.            +|
T Consensus         3 P~~ig~~~lkNRiv~apm~~~~a~~~G~pt~~~~~yy~~rA~gG~GLIite~~~v~~~~-~~~~~~------------~~   69 (327)
T cd02803           3 PIKIGGLTLKNRIVMAPMTENMATEDGTPTDELIEYYEERAKGGVGLIITEAAYVDPEG-KGYPGQ------------LG   69 (327)
T ss_pred             CEEECCEEECCCCEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCEEECHHH-CCCCCC------------CC
T ss_conf             83189999877368814185734589999999999999997499617998777876512-479997------------50


Q ss_pred             CCCC----CHHHHHHHHHHHHHCCCCCCEEE---------------------C-----CC---CC----HHHHHHHHHHH
Q ss_conf             4777----77889998764100012100011---------------------0-----45---42----46788776555
Q gi|254780434|r  115 FNNA----GYHTVFSRLSKIQPTSPIGINLG---------------------A-----NK---DS----KDFILDYVSGI  157 (362)
Q Consensus       115 l~N~----G~~~~~~~l~~~~~~~pi~vsI~---------------------~-----~~---~s----~~~~~dy~~~~  157 (362)
                      +-++    ++..+.+.+.+  .+..+++.++                     .     ..   -|    ++.+++|...+
T Consensus        70 i~~d~~i~~~k~l~~~vh~--~G~~i~~QL~H~Gr~~~~~~~~~~~~~~s~~~~~~~~~~p~~mt~~eI~~ii~~f~~AA  147 (327)
T cd02803          70 IYDDEQIPGLRKLTEAVHA--HGAKIFAQLAHAGRQAQPNLTGGPPPAPSAIPSPGGGEPPREMTKEEIEQIIEDFAAAA  147 (327)
T ss_pred             CCCHHHHHHHHHHHHHHHC--CCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             3623547888799887632--79879987202765567444689988877544456898886299999999999999999


Q ss_pred             HHHC-CCCCEEEEECC---------CCC--CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCC-----
Q ss_conf             4206-75526983033---------365--322110000234321111224445565531268851786505777-----
Q gi|254780434|r  158 RLFF-TIASYFTINIS---------SPN--TPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDL-----  220 (362)
Q Consensus       158 ~~~~-~~aD~iEiNiS---------CPN--t~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~-----  220 (362)
                      +.+. .+.|.+||.-.         ||.  ...-+...+.++=.+++..+.+....   ....+.||.+||+|+-     
T Consensus       148 ~~A~~AGfDgVEIh~ahGyLl~qFlSp~~N~RtD~YGGs~eNR~Rf~~eii~air~---~vg~df~vgvRls~~d~~~~g  224 (327)
T cd02803         148 RRAKEAGFDGVEIHGAHGYLLSQFLSPYTNKRTDEYGGSLENRARFLLEIVAAVRE---AVGPDFPVGVRLSADDFVPGG  224 (327)
T ss_pred             HHHHHCCCCEEEECCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH---HCCCCCCEEEEECHHHCCCCC
T ss_conf             99998499989983576618887217546987777888989998999999999999---739887617997702126899


Q ss_pred             -CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCH
Q ss_conf             -7488899999876449829998066555323457754463221135645424689999999740897489996788999
Q gi|254780434|r  221 -SEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISST  299 (362)
Q Consensus       221 -~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~  299 (362)
                       +.++..++++.+++.|+|-|.++--..........      ....++   ..-+.....+++.+  ++|+|++|+|.++
T Consensus       225 ~~~~e~~~~~~~l~~~gvd~i~vs~g~~~~~~~~~~------~~~~~~---~~~~~~~~~ik~~~--~~pvi~~G~i~~~  293 (327)
T cd02803         225 LTLEEAIEIAKALEEAGVDALHVSGGSYESPPPIIP------PPYVPE---GYFLELAEKIKKAV--KIPVIAVGGIRDP  293 (327)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCC------CCCCCC---CCCHHHHHHHHHHC--CCCEEEECCCCCH
T ss_conf             998999999999985599989977784566754467------877775---22389999999976--9819998998999


Q ss_pred             HHHHHHHHCC-CCEEEECHHHHCCCHHHHHHHHHH
Q ss_conf             9999999839-997545278770697899999999
Q gi|254780434|r  300 KDALDKIMAG-ANLIQLYSAMIYEGISLPKRIIQG  333 (362)
Q Consensus       300 ~Da~e~l~aG-As~VQi~Tali~~Gp~~~~~I~~~  333 (362)
                      +++.+.|..| ||+|.++.+++.+ |.+++++.+|
T Consensus       294 ~~a~~~l~~g~~D~V~~gR~~iad-Pd~~~k~~~G  327 (327)
T cd02803         294 EVAEEILAEGKADLVALGRALLAD-PDLPNKAREG  327 (327)
T ss_pred             HHHHHHHHCCCCCHHHHHHHHHHC-CCHHHHHHCC
T ss_conf             999999988993125866999979-1499999775


No 36 
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain. YqjM is involved in the oxidative stress response of Bacillus subtilis.  Like the other OYE members, each monomer of YqjM contains FMN as a non-covalently bound cofactor and uses NADPH as a reducing agent.   The YqjM enzyme exists as a homotetramer that is assembled as a dimer of catalytically dependent dimers, while other OYE members exist only as monomers or dimers. Moreover, the protein displays a shared active site architecture where an arginine finger at the COOH terminus of one monomer extends into the active site of the adjacent monomer and is directly involved in substrate recognition. Another remarkable difference in the binding of the ligand in YqjM is represented by the contribution of the NH2-terminal tyrosine instead of a COOH-terminal tyrosine in OYE and its homologs.
Probab=99.50  E-value=6.9e-12  Score=99.93  Aligned_cols=257  Identities=17%  Similarity=0.159  Sum_probs=148.8

Q ss_pred             EEEECCEECCCCEEECC--------CCCC--CHHHHHHHHHCCCCEEECCCCCCCCCC-CCCC-CCEEEEECCCCCEEEC
Q ss_conf             16888733599748534--------6888--677988874036752410200136878-9988-6268842555410000
Q gi|254780434|r   46 NTKVAGISLSNPLGMAA--------GYDK--NAEVPIELLKLGFGFVEIGTVTPHPQA-GNPR-PRVFRLTKDRAIINKL  113 (362)
Q Consensus        46 ~~~~~Gl~~~nPiglAa--------G~dk--~~~~~~~l~~~G~G~v~~ktit~~p~~-GNp~-PR~~r~~~~~~iiN~~  113 (362)
                      +.++.+++++|.|+.|+        |...  ..+++.+...-|+|.++++.+...|.- ++|. |.++.   ++ .+   
T Consensus         4 Pi~ig~~~l~NRiv~apm~~~~~~dG~pt~~~~~yy~~rA~gG~GlIite~~~V~~~g~~~~~~~gi~~---d~-~i---   76 (336)
T cd02932           4 PLTLRGVTLKNRIVVSPMCQYSAEDGVATDWHLVHYGSRALGGAGLVIVEATAVSPEGRITPGDLGLWN---DE-QI---   76 (336)
T ss_pred             CEEECCEEECCCCEECCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEECCEEECCCCCCCCCCCCCCH---HH-HH---
T ss_conf             825899988885286875768188998999999999999759973899745586612056998656567---99-99---


Q ss_pred             CCCCCCHHHHHHHHHHHH--------------------------------HCCCCCCEEECCC--------CC----HHH
Q ss_conf             247777788999876410--------------------------------0012100011045--------42----467
Q gi|254780434|r  114 GFNNAGYHTVFSRLSKIQ--------------------------------PTSPIGINLGANK--------DS----KDF  149 (362)
Q Consensus       114 Gl~N~G~~~~~~~l~~~~--------------------------------~~~pi~vsI~~~~--------~s----~~~  149 (362)
                          +|+..+.+.+.+..                                ...++..|-....        -|    ++.
T Consensus        77 ----~~~~~l~~avh~~G~~i~~QL~H~Gr~a~~~~~~~~~~~~~~~~~~~~~~~apS~v~~~~~~~~pr~mt~~eI~~i  152 (336)
T cd02932          77 ----EALKRIVDFIHSQGAKIGIQLAHAGRKASTAPPWEGGGPLLPPGGGGWQVVAPSAIPFDEGWPTPRELTREEIAEV  152 (336)
T ss_pred             ----HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             ----9999999999866987998622466432345753356777764357985057887766779998856899999999


Q ss_pred             HHHHHHHHHHHC-CCCCEEEEEC---------CCCCC--CCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             887765554206-7552698303---------33653--22110000234321111224445565531268851786505
Q gi|254780434|r  150 ILDYVSGIRLFF-TIASYFTINI---------SSPNT--PGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKIS  217 (362)
Q Consensus       150 ~~dy~~~~~~~~-~~aD~iEiNi---------SCPNt--~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLs  217 (362)
                      +++|...++.+. .+.|.+||.-         -||.+  ..-+...+.++=.+++..+.+....   ....+.||.+|||
T Consensus       153 i~~f~~AA~rA~~AGfDGVEIH~ahGYLl~qFLsp~~N~RtDeYGGs~enR~Rf~~Eii~aVr~---~vg~d~~vgvRis  229 (336)
T cd02932         153 VDAFVAAARRAVEAGFDVIEIHAAHGYLLHQFLSPLSNKRTDEYGGSLENRMRFLLEVVDAVRA---VWPEDKPLFVRIS  229 (336)
T ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH---HHCCCCCEEEEEC
T ss_conf             9999999999998399999863137479998369411677786799789998899999999999---8399887068964


Q ss_pred             CC------CCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             77------774888999998764498299980665553234577544632211356454246899999997408974899
Q gi|254780434|r  218 PD------LSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAII  291 (362)
Q Consensus       218 Pd------~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~II  291 (362)
                      ++      .+.++..++++.+++.|+|.|.++--  ....  ......      ++.   .-+...+.+++.+  ++|+|
T Consensus       230 ~~d~~~~g~~~~e~~~~a~~l~~~gvd~i~vs~G--~~~~--~~~~~~------~~~---~~~~~a~~ik~~~--~ipvi  294 (336)
T cd02932         230 ATDWVEGGWDLEDSVELAKALKELGVDLIDVSSG--GNSP--AQKIPV------GPG---YQVPFAERIRQEA--GIPVI  294 (336)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCC--CCCC--CCCCCC------CCC---CCHHHHHHHHHHC--CCCEE
T ss_conf             5235789989999999999999759978995589--8776--666777------864---2679999999878--98399


Q ss_pred             EECCCCCHHHHHHHHHCC-CCEEEECHHHHCCCHHHHHHHHH
Q ss_conf             967889999999999839-99754527877069789999999
Q gi|254780434|r  292 GTGGISSTKDALDKIMAG-ANLIQLYSAMIYEGISLPKRIIQ  332 (362)
Q Consensus       292 g~GGI~s~~Da~e~l~aG-As~VQi~Tali~~Gp~~~~~I~~  332 (362)
                      ++|||.+++++.+.|..| ||+|.++.+++-+ |.++++...
T Consensus       295 ~~G~i~~p~~ae~~l~~G~~DlV~~gR~~iad-Pdlp~kaAa  335 (336)
T cd02932         295 AVGLITDPEQAEAILESGRADLVALGRELLRN-PYWPLHAAA  335 (336)
T ss_pred             EECCCCCHHHHHHHHHCCCCEEHHHHHHHHHC-CCHHHHHHC
T ss_conf             97998999999999987994006867999979-339999867


No 37 
>PRK13523 NADPH dehydrogenase NamA; Provisional
Probab=99.49  E-value=8.9e-12  Score=99.17  Aligned_cols=258  Identities=16%  Similarity=0.141  Sum_probs=152.9

Q ss_pred             EEEECCEECCCCEEECCC----C-CCCH-------HHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEEC
Q ss_conf             168887335997485346----8-8867-------798887403675241020013687899886268842555410000
Q gi|254780434|r   46 NTKVAGISLSNPLGMAAG----Y-DKNA-------EVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKL  113 (362)
Q Consensus        46 ~~~~~Gl~~~nPiglAaG----~-dk~~-------~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~  113 (362)
                      +.++.+++++|.|+.|+=    . +.++       +++.+...-|+|.++++.+...|. |...|+.            +
T Consensus         6 P~~ig~l~lkNRiv~aPm~~~~~~~~dG~~t~~~~~yy~~rA~GG~GlIi~e~~~V~~~-g~~~~~~------------~   72 (337)
T PRK13523          6 PYTIKDVTLKNRIVMSPMCMYSSENKDGKVTNFHLIHYGTRAAGQVGLIIVEATAVTPE-GRISDKD------------L   72 (337)
T ss_pred             CCEECCEEECCCCEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCEEECCC-CCCCCCC------------C
T ss_conf             70289999778617066688656688999999999999999768972999835886622-1479987------------5


Q ss_pred             CCCC----CCHHHHHHHHHHHH----------------HCCCCCCEEECCC--------CC----HHHHHHHHHHHHHHC
Q ss_conf             2477----77788999876410----------------0012100011045--------42----467887765554206
Q gi|254780434|r  114 GFNN----AGYHTVFSRLSKIQ----------------PTSPIGINLGANK--------DS----KDFILDYVSGIRLFF  161 (362)
Q Consensus       114 Gl~N----~G~~~~~~~l~~~~----------------~~~pi~vsI~~~~--------~s----~~~~~dy~~~~~~~~  161 (362)
                      |+-+    +|+..+.+.+.+..                ...|+..|-....        -|    ++-+++|.+.++.+.
T Consensus        73 ~i~~d~~i~~~~~l~~avh~~G~~i~~QL~H~Gr~~~~~~~~~aPS~i~~~~~~~~p~~mt~~eI~~ii~~f~~AA~rA~  152 (337)
T PRK13523         73 GIWDDEHIEGLHKLVTFIHDHGAKAAIQLAHAGRKAELEGDIVAPSAIPFDEKSKTPVEMTKEQIKETVLAFKQAAKRAK  152 (337)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             56627789999999999975588688750017755678998107778867889998864999999999999999999999


Q ss_pred             -CCCCEEEEE---------CCCC--CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCC------CHH
Q ss_conf             -755269830---------3336--5322110000234321111224445565531268851786505777------748
Q gi|254780434|r  162 -TIASYFTIN---------ISSP--NTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDL------SEE  223 (362)
Q Consensus       162 -~~aD~iEiN---------iSCP--Nt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~------~~~  223 (362)
                       .+.|.+||.         +-+|  |-..-+...+.++-.+++..+.+....     ...-|+++|||++-      +.+
T Consensus       153 ~AGfDgVEIH~ahGYLl~QFlSp~~N~RtD~YGGs~eNR~Rf~lEii~aVr~-----~~~~~v~vRis~~d~~~gG~~~~  227 (337)
T PRK13523        153 EAGFDVIEIHGAHGYLINEFLSPLSNKRTDEYGGSPENRYRFLREIIDAVKE-----VWDGPLFVRISASDYHPDGLTVQ  227 (337)
T ss_pred             HCCCCEEEEECCCCHHHHHHCCHHHCCCCCCCCCCHHHHHHHHHHHHHHHHH-----HCCCCEEEEECCCCCCCCCCCHH
T ss_conf             8499989981354358998479232489585588889998899999999998-----65886399933655578998989


Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHH
Q ss_conf             88999998764498299980665553234577544632211356454246899999997408974899967889999999
Q gi|254780434|r  224 ELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDAL  303 (362)
Q Consensus       224 ~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~  303 (362)
                      +..++++.+++.|+|.+-++.-..  .    +......-|+        .+.....+++.+  ++|+|++|+|.++++|.
T Consensus       228 d~~~~~~~l~~~GvD~i~vs~G~~--~----~~~~~~~~g~--------~~~~a~~ik~~~--~ipvi~vG~i~~~~~ae  291 (337)
T PRK13523        228 DYVQYAKWMKEQGVDLIDVSSGAV--V----PARIDVYPGY--------QVPFAEHIKEHA--NIATGAVGLITTGAQAE  291 (337)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCC--C----CCCCCCCCCC--------CHHHHHHHHHHC--CCCEEEECCCCCHHHHH
T ss_conf             999999999974999899578855--4----7767778753--------348999999876--97099983869999999


Q ss_pred             HHHHCC-CCEEEECHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             999839-99754527877069789999999999999
Q gi|254780434|r  304 DKIMAG-ANLIQLYSAMIYEGISLPKRIIQGLSDFL  338 (362)
Q Consensus       304 e~l~aG-As~VQi~Tali~~Gp~~~~~I~~~L~~~l  338 (362)
                      +.|..| ||+|.++.+++-. |.+++++.+++..-.
T Consensus       292 ~~l~~G~aD~V~~gR~~iad-Pd~p~kaa~~~~~ei  326 (337)
T PRK13523        292 EILNNNRADLIFIGRELLRN-PYFPRIAANELGFEI  326 (337)
T ss_pred             HHHHCCCCCHHHHHHHHHHC-CCHHHHHHHHCCCCC
T ss_conf             99987994799989999989-109999997669999


No 38 
>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism]
Probab=99.48  E-value=7.9e-12  Score=99.52  Aligned_cols=270  Identities=24%  Similarity=0.280  Sum_probs=157.3

Q ss_pred             HCCCCCCCCCCEEEECCEECCCCEEECCC-C----CCCHHHHHHHH-H-CC--CCEEECCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             10467889631168887335997485346-8----88677988874-0-36--752410200136878998862688425
Q gi|254780434|r   35 SFFPVHSDPRLNTKVAGISLSNPLGMAAG-Y----DKNAEVPIELL-K-LG--FGFVEIGTVTPHPQAGNPRPRVFRLTK  105 (362)
Q Consensus        35 ~~~~~~~~~~L~~~~~Gl~~~nPiglAaG-~----dk~~~~~~~l~-~-~G--~G~v~~ktit~~p~~GNp~PR~~r~~~  105 (362)
                      ..++..++.||+++++|.+++-||++++= .    ...++.+.+-. . +|  +-...++|.+.+.-.            
T Consensus        44 ~~L~~v~~idlst~~~G~~l~~Pi~iapmt~g~~~~~~ge~~~a~~A~~a~~~~i~s~~gs~~ie~~~------------  111 (360)
T COG1304          44 RVLPEVDDIDLSTTFLGQKLSAPIIIAPMTGGGLAHPEGEVINAKLAAAAGEPFILSTVGSQRIEEVA------------  111 (360)
T ss_pred             CCCCCCCCCCCCEEECCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHH------------
T ss_conf             45788665765157558602588788044455535735699999999980887010032557299952------------


Q ss_pred             CCCCEEECCCCCCCHHHHHHHHHHHHHCCC-CCCEEECCC-----CCHHHHHHHHHHHHHHCCCCCE--EEEEC----CC
Q ss_conf             554100002477777889998764100012-100011045-----4246788776555420675526--98303----33
Q gi|254780434|r  106 DRAIINKLGFNNAGYHTVFSRLSKIQPTSP-IGINLGANK-----DSKDFILDYVSGIRLFFTIASY--FTINI----SS  173 (362)
Q Consensus       106 ~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~p-i~vsI~~~~-----~s~~~~~dy~~~~~~~~~~aD~--iEiNi----SC  173 (362)
                                .+++...+....+...++.+ ...|+|+..     ++....+...+..+.+.  +|+  .-.|+    ..
T Consensus       112 ----------~~~~~q~y~~~~R~~~~~~~~~a~n~G~~~lv~t~d~~~~~~r~~d~~~~i~--a~~~~~h~n~~qe~~~  179 (360)
T COG1304         112 ----------AAPPFQLYFSKDREFAPNLVDRAANAGAKQLVLTVDSPVGGERERDAVNGIS--APALAIHLNVLQEATQ  179 (360)
T ss_pred             ----------CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCCHHHHHHHHHHCCC--CCCCCCCCCHHHHHCC
T ss_conf             ----------1715455659877764999999996698403631575426788999985347--7720133547787348


Q ss_pred             CCCCCCCCCCC-----HHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE-CCCCCCHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             65322110000-----2343211112244455655312688517865-05777748889999987644982999806655
Q gi|254780434|r  174 PNTPGLRSLQK-----KKNLERLLIHVMQTREEEKIKTGKFVPIFLK-ISPDLSEEELDDIAVEVLSHKVEGIIVSNTTL  247 (362)
Q Consensus       174 PNt~g~~~~~~-----~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vK-LsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~  247 (362)
                      |-  |.+.++.     .+.......++..+......+.....|+.+| +.   +   -.+ +..+.+.|+++|++.|.-.
T Consensus       180 p~--g~~~~~~~~~~i~~~~~~~~~P~i~ked~~~i~~~~~~~lv~kGV~---~---~~D-~~~a~~tg~~~I~vsnhgg  250 (360)
T COG1304         180 PE--GDRDGKGGLDSIAEYVSALSVPVISKEDGAGISKEWAGPLVLKGIL---A---PED-AAGAGGTGADGIEVSNHGG  250 (360)
T ss_pred             CC--CCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHCCC---C---HHH-HHHHCCCCCEEEEEECCCC
T ss_conf             76--6656530045899999843787333777767877507758774789---7---888-8763368822899976787


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC----CC
Q ss_conf             53234577544632211356454246899999997408974899967889999999999839997545278770----69
Q gi|254780434|r  248 SRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY----EG  323 (362)
Q Consensus       248 ~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~----~G  323 (362)
                                ...-||.|       +.+.+.++++.++++++||+.|||.+|.|+++.|..||++|.++-.++|    .|
T Consensus       251 ----------rqlD~g~s-------t~~~L~ei~~av~~~~~vi~dGGiR~G~Dv~KAlALGA~~v~igrp~L~~l~~~g  313 (360)
T COG1304         251 ----------RQLDWGIS-------TADSLPEIVEAVGDRIEVIADGGIRSGLDVAKALALGADAVGIGRPFLYGLAAGG  313 (360)
T ss_pred             ----------CCCCCCCC-------HHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHCC
T ss_conf             ----------40257877-------6999999999718871799638878778999999937765452599999998556


Q ss_pred             H----HHHHHHHHHHHHHHHHCCCCCHHHHHCCCC
Q ss_conf             7----899999999999999838997789616975
Q gi|254780434|r  324 I----SLPKRIIQGLSDFLNKENEVNFENIRGSYT  354 (362)
Q Consensus       324 p----~~~~~I~~~L~~~l~~~G~~si~e~iG~~~  354 (362)
                      -    .++.-|.+||+.-|.--|.+||+|+....+
T Consensus       314 ~~GV~~~le~~~~El~~~M~L~G~~~i~el~~~~l  348 (360)
T COG1304         314 EAGVERVLEIIRKELKIAMALTGAKNIEELKRVPL  348 (360)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCHHHHCCCCE
T ss_conf             87899999999999999997428881999655736


No 39 
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2.  Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.
Probab=99.47  E-value=2.1e-11  Score=96.71  Aligned_cols=263  Identities=20%  Similarity=0.226  Sum_probs=150.9

Q ss_pred             EEEEC-CEECCCCEEECCC----CCCCH-------HHHHHHHHCCCCEEECCCCCCCCC-CCCCCCCEEEEECCCCCEEE
Q ss_conf             16888-7335997485346----88867-------798887403675241020013687-89988626884255541000
Q gi|254780434|r   46 NTKVA-GISLSNPLGMAAG----YDKNA-------EVPIELLKLGFGFVEIGTVTPHPQ-AGNPRPRVFRLTKDRAIINK  112 (362)
Q Consensus        46 ~~~~~-Gl~~~nPiglAaG----~dk~~-------~~~~~l~~~G~G~v~~ktit~~p~-~GNp~PR~~r~~~~~~iiN~  112 (362)
                      +.++. |++|+|.|+.|+=    .+.++       ++..+...-|+|.++++.+...|+ .+.|           +-.+.
T Consensus         4 P~~l~ng~tlkNRiv~apm~~~~~~~dG~~t~~~~~yy~~rA~gG~glIit~~~~v~~~~~~~~-----------~~~~~   72 (338)
T cd04733           4 PLTLPNGATLPNRLAKAAMSERLADGRGLPTPELIRLYRRWAEGGIGLIITGNVMVDPRHLEEP-----------GIIGN   72 (338)
T ss_pred             CEECCCCCEECCCCEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCEEECCCCCCCC-----------CCCCC
T ss_conf             9889999598684688988887457999899999999998862783488970389867767799-----------98888


Q ss_pred             CCCCCC----CHHHHHHHHHHHHHCCCCCCEEE--------------------C---------C--C-CC----HHHHHH
Q ss_conf             024777----77889998764100012100011--------------------0---------4--5-42----467887
Q gi|254780434|r  113 LGFNNA----GYHTVFSRLSKIQPTSPIGINLG--------------------A---------N--K-DS----KDFILD  152 (362)
Q Consensus       113 ~Gl~N~----G~~~~~~~l~~~~~~~pi~vsI~--------------------~---------~--~-~s----~~~~~d  152 (362)
                      +++.++    ++..+.+.+.+.  +..+++.++                    .         .  + -|    ++.+++
T Consensus        73 ~~~~~d~~i~~~k~l~d~vh~~--g~~i~~QL~H~Gr~~~~~~~~~~~~~s~~~~~~~~~~~~~~p~~mt~~eI~~ii~~  150 (338)
T cd04733          73 VVLESGEDLEAFREWAAAAKAN--GALIWAQLNHPGRQSPAGLNQNPVAPSVALDPGGLGKLFGKPRAMTEEEIEDVIDR  150 (338)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHC--CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             8879999999999999999856--98699951565412450007898887655676655557898864899999999999


Q ss_pred             HHHHHHHHC-CCCCEEEEEC---------CCCCC--CCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCC-
Q ss_conf             765554206-7552698303---------33653--2211000023432111122444556553126885178650577-
Q gi|254780434|r  153 YVSGIRLFF-TIASYFTINI---------SSPNT--PGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPD-  219 (362)
Q Consensus       153 y~~~~~~~~-~~aD~iEiNi---------SCPNt--~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd-  219 (362)
                      |.+.++.+. .+.|.+||.-         -+|.+  ..-+...+.++=.+++..+.+....   ......||.+|||++ 
T Consensus       151 f~~AA~rA~~AGfDgVEiH~ahGYLl~qFlS~~~N~RtDeYGGS~ENR~Rf~lEii~avr~---~vg~d~~v~~Ris~~d  227 (338)
T cd04733         151 FAHAARLAQEAGFDGVQIHAAHGYLLSQFLSPLTNKRTDEYGGSLENRARLLLEIYDAIRA---AVGPGFPVGIKLNSAD  227 (338)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH---HHCCCCEEEEEECHHH
T ss_conf             9999999998399989982365548998629876899685798988998899999999999---7199886999845354


Q ss_pred             -----CCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             -----774888999998764498299980665553234577544632211356454246899999997408974899967
Q gi|254780434|r  220 -----LSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTG  294 (362)
Q Consensus       220 -----~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~G  294 (362)
                           .+.++..++++.+++.|+|.+.++.....-+........      +...-...-+.....+++.+  ++|+|++|
T Consensus       228 ~~~~G~~~~d~~~~~~~l~~~GvD~i~vs~G~~~~~~~~~~~~~------~~~~~~~~~~~~a~~ik~~~--~~Pvi~~G  299 (338)
T cd04733         228 FQRGGFTEEDALEVVEALEEAGVDLVELSGGTYESPAMAGAKKE------STIAREAYFLEFAEKIRKVT--KTPLMVTG  299 (338)
T ss_pred             HCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCC------CCCCCCCCHHHHHHHHHHHC--CCCEEEEC
T ss_conf             24799998999999999987699889946885457322477654------44567510599999999984--99799989


Q ss_pred             CCCCHHHHHHHHHCC-CCEEEECHHHHCCCHHHHHHHHHH
Q ss_conf             889999999999839-997545278770697899999999
Q gi|254780434|r  295 GISSTKDALDKIMAG-ANLIQLYSAMIYEGISLPKRIIQG  333 (362)
Q Consensus       295 GI~s~~Da~e~l~aG-As~VQi~Tali~~Gp~~~~~I~~~  333 (362)
                      ||.+.++|.+.+..| ||+|.++.+++-+ |.+++++.+|
T Consensus       300 ~i~~~~~ae~~l~~g~~DlV~~gR~~iad-Pdl~~k~~~G  338 (338)
T cd04733         300 GFRTRAAMEQALASGAVDGIGLARPLALE-PDLPNKLLAG  338 (338)
T ss_pred             CCCCHHHHHHHHHCCCCEEHHHHHHHHHC-CCHHHHHHCC
T ss_conf             98999999999987995108988999979-0599998675


No 40 
>cd02911 arch_FMN Archeal FMN-binding domain. This family of archaeal proteins are part of the NAD(P)H-dependent flavin oxidoreductase (oxidored) FMN-binding family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN. The specific function of this group is unknown.
Probab=99.47  E-value=3.1e-12  Score=102.27  Aligned_cols=215  Identities=16%  Similarity=0.263  Sum_probs=129.1

Q ss_pred             CEEEC--CCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEE--CC-CCCCCHHHHHHHHHHHH
Q ss_conf             74853--468886779888740367524102001368789988626884255541000--02-47777788999876410
Q gi|254780434|r   57 PLGMA--AGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINK--LG-FNNAGYHTVFSRLSKIQ  131 (362)
Q Consensus        57 PiglA--aG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~--~G-l~N~G~~~~~~~l~~~~  131 (362)
                      ||.||  ||.. |.- +.+...-.||..+++.......+         ......+..+  -- +.+...+.+..++....
T Consensus         1 PvvLAPMAGVT-D~p-Frr~~~~~~g~~~~gg~~~~~~~---------~~~~~~~~~~~~ke~~~~~~~~~~~~~~~~~~   69 (233)
T cd02911           1 PVALASMAGIT-DGD-FCRKRADHAGLVFLGGYNLDERT---------IEAARKLVKRGRKEFLPDDPLEFIEGEIKALK   69 (233)
T ss_pred             CEEEECCCCCC-CHH-HHHHHHHHCCCEEEECCCCHHHH---------HHHHHHHHHCCCHHHCCCCCHHHHHHHHHHHC
T ss_conf             94885789995-899-99999983795797212201899---------99999999717232123451013367887622


Q ss_pred             -HCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCC------CCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -00121000110454246788776555420675526983033365------32211000023432111122444556553
Q gi|254780434|r  132 -PTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPN------TPGLRSLQKKKNLERLLIHVMQTREEEKI  204 (362)
Q Consensus       132 -~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPN------t~g~~~~~~~~~l~~~l~~v~~~~~~~~~  204 (362)
                       ...|+++.|.++.  .+   ...+.++.+.+.+|.++||..||-      ..|--.+.+++.+.+++.+++.       
T Consensus        70 ~~~~pv~vQi~g~~--~e---~~~~Aa~~~~~~~d~IDiN~GCP~~kV~~~g~GsaLl~dp~~~~~iv~avk~-------  137 (233)
T cd02911          70 DSNVLVGVNVRSSS--LE---PLLNAAALVAKNAAILEINAHCRQPEMVEAGAGEALLKDPERLSEFIKALKE-------  137 (233)
T ss_pred             CCCCCEEEEEECCC--HH---HHHHHHHHHHCCCCEEEEECCCCCHHHCCCCCHHHHCCCHHHHHHHHHHHHH-------
T ss_conf             46897189930699--99---9999999974369999997999928983797537773898999999999985-------


Q ss_pred             HCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             12688517865057777488899999876449829998066555323457754463221135645424689999999740
Q gi|254780434|r  205 KTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRV  284 (362)
Q Consensus       205 ~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~  284 (362)
                         .++|+.||+--..+. +..++++.++++|++++++- +             ..+|   |.    .-...|+++    
T Consensus       138 ---~~~PVtvKiR~G~d~-~~~~~a~~~e~aG~~~l~v~-~-------------~~~~---~~----ad~~~I~~~----  188 (233)
T cd02911         138 ---TGVPVSVKIRAGVDV-DDEELARLIEKAGADIIHVD-A-------------MDPG---NH----ADLKKIRDI----  188 (233)
T ss_pred             ---HCCCEEEEEECCCCC-CHHHHHHHHHHHCCCEEEEE-C-------------CCCC---CH----HHHHHHHHH----
T ss_conf             ---389842798569998-88999999998396079943-2-------------0778---50----899999986----


Q ss_pred             CCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCC
Q ss_conf             897489996788999999999983999754527877069
Q gi|254780434|r  285 GPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEG  323 (362)
Q Consensus       285 ~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~G  323 (362)
                      ..++||||.|+|.|.+||.+++..|||.|+|+.+.+-+-
T Consensus       189 ~~~i~VigNGDI~s~eda~~~~~~G~DgVMIgRgAL~n~  227 (233)
T cd02911         189 STELFIIGNNSVTTIESAKEMFSYGADMVSVARASLPEN  227 (233)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCEEEECHHHCCCC
T ss_conf             379879980896999999999985999999738755685


No 41 
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase. One member of this subgroup, the Sinorhizobium meliloti stachydrine utilization protein stcD, has been idenified as a putative N-methylproline demethylase.
Probab=99.46  E-value=3e-11  Score=95.60  Aligned_cols=261  Identities=18%  Similarity=0.179  Sum_probs=151.5

Q ss_pred             EEEECCEECCCCEEECCC---CCCC-------HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCC
Q ss_conf             168887335997485346---8886-------779888740367524102001368789988626884255541000024
Q gi|254780434|r   46 NTKVAGISLSNPLGMAAG---YDKN-------AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGF  115 (362)
Q Consensus        46 ~~~~~Gl~~~nPiglAaG---~dk~-------~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl  115 (362)
                      +.++.+++++|.|+.++=   ++.+       .+++.+...-|+|.++++.+...|. |.+.|+.            +|+
T Consensus         4 Pikig~~~lkNRiv~~pm~~~~~~~G~~~~~~~~~y~~rA~gG~GlIi~~~~~v~~~-~~~~~~~------------~~i   70 (343)
T cd04734           4 PLQLGHLTLRNRIVSTAHATNYAEDGLPSERYIAYHEERARGGAGLIITEGSSVHPS-DSPAFGN------------LNA   70 (343)
T ss_pred             CEEECCEEECCCEEECCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEEEEECCC-CCCCCCC------------CCC
T ss_conf             804899998883254546788688998999999999999678983799700676465-5689998------------766


Q ss_pred             CC----CCHHHHHHHHHHHHHCCCCCCEEE---------------------CC--------CCC----HHHHHHHHHHHH
Q ss_conf             77----777889998764100012100011---------------------04--------542----467887765554
Q gi|254780434|r  116 NN----AGYHTVFSRLSKIQPTSPIGINLG---------------------AN--------KDS----KDFILDYVSGIR  158 (362)
Q Consensus       116 ~N----~G~~~~~~~l~~~~~~~pi~vsI~---------------------~~--------~~s----~~~~~dy~~~~~  158 (362)
                      -+    +++..+.+.+.+.  +..+++.++                     .+        .-|    ++.++||...++
T Consensus        71 ~~d~~i~~~k~l~~~vH~~--G~~i~~QL~H~Gr~~~~~~~~~~~~~pS~~~~~~~~~~p~~mt~eeI~~ii~~f~~AA~  148 (343)
T cd04734          71 SDDEIIPGFRRLAEAVHAH--GAVIMIQLTHLGRRGDGDGSWLPPLAPSAVPEPRHRAVPKAMEEEDIEEIIAAFADAAR  148 (343)
T ss_pred             CCHHHHHHHHHHHHHHHHC--CCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             8999999999999999735--88189871157766676679986268888866567987944899999999999999999


Q ss_pred             HHC-CCCCEEEEE---------CCCCCC--CCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCC------
Q ss_conf             206-755269830---------333653--22110000234321111224445565531268851786505777------
Q gi|254780434|r  159 LFF-TIASYFTIN---------ISSPNT--PGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDL------  220 (362)
Q Consensus       159 ~~~-~~aD~iEiN---------iSCPNt--~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~------  220 (362)
                      .+. .+.|.+||.         +-||-+  ..-+...+-++=.+++..+.+....   ....+.||.+|+||+-      
T Consensus       149 ~A~~AGfDgVEIH~ahGYLl~qFlSp~~N~RtDeYGGs~eNR~Rf~~EIi~~Ir~---~vg~~f~i~~Ris~~~~~~~g~  225 (343)
T cd04734         149 RCQAGGLDGVELQAAHGHLIDQFLSPLTNRRTDEYGGSLENRMRFLLEVLAAVRA---AVGPDFIVGIRISGDEDTEGGL  225 (343)
T ss_pred             HHHHCCCCEEEECCCCCCHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH---HHCCCCCEEEEECCCCCCCCCC
T ss_conf             9997399889844577746998469855899676798889998999999999999---8198776158867623568989


Q ss_pred             CHHHHHHHHHHHHHCC-CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCH
Q ss_conf             7488899999876449-829998066555323457754463221135645424689999999740897489996788999
Q gi|254780434|r  221 SEEELDDIAVEVLSHK-VEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISST  299 (362)
Q Consensus       221 ~~~~i~~ia~~a~~~g-~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~  299 (362)
                      +.++..++++.+++.| +|-+-++--...........    ...+.-+  ...-+....++++.+  ++|+|++|||.+.
T Consensus       226 ~~~e~~~~~~~l~~~G~vD~l~vs~g~~~~~~~~~~~----~p~~~~~--~g~~~~~a~~ik~~~--~~pvi~~G~i~~~  297 (343)
T cd04734         226 SPDEALEIAARLAAEGLIDYVNVSAGSYYTLLGLAHV----VPSMGMP--PGPFLPLAARIKQAV--DLPVFHAGRIRDP  297 (343)
T ss_pred             CHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCHHHC----CCCCCCC--CCCCHHHHHHHHHHC--CCCEEEECCCCCH
T ss_conf             9899999999999669976899656754332221100----6876677--643488999999972--9859997998999


Q ss_pred             HHHHHHHHCC-CCEEEECHHHHCCCHHHHHHHHHH
Q ss_conf             9999999839-997545278770697899999999
Q gi|254780434|r  300 KDALDKIMAG-ANLIQLYSAMIYEGISLPKRIIQG  333 (362)
Q Consensus       300 ~Da~e~l~aG-As~VQi~Tali~~Gp~~~~~I~~~  333 (362)
                      +++.+.+..| +|+|.++..++.+ |.+++++.++
T Consensus       298 ~~ae~~l~~g~~D~V~~gR~~lad-Pd~v~k~~~G  331 (343)
T cd04734         298 AEAEQALAAGHADMVGMTRAHIAD-PHLVAKAREG  331 (343)
T ss_pred             HHHHHHHHCCCCEEHHHHHHHHHC-CCHHHHHHCC
T ss_conf             999999987996216978999978-1199999768


No 42 
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain.  DCR in E. coli  is an iron-sulfur flavoenzyme which contains FMN, FAD, and a 4Fe-4S cluster. It is also a monomer, unlike that of its eukaryotic counterparts which form homotetramers and lack the flavin and iron-sulfur cofactors. Metabolism of unsaturated fatty acids requires auxiliary enzymes in addition to those used in b-oxidation. After a given number of cycles through the b-oxidation pathway, those unsaturated fatty acyl-CoAs with double bonds at even-numbered carbon positions contain 2-trans, 4-cis double bonds that can not be modified by enoyl-CoA hydratase. DCR utilizes NADPH to remove the C4-C5 double bond. DCR can catalyze the reduction of both natural fatty acids with cis double bonds, as well as substrates containing trans double bonds. The reaction is initiated by hybrid transfer from NADPH to FAD, which in turn transfers electrons, one at a time, to FMN via the 4Fe-4S cluster. The fully reduced FMN provi
Probab=99.46  E-value=2.2e-11  Score=96.47  Aligned_cols=263  Identities=16%  Similarity=0.110  Sum_probs=154.0

Q ss_pred             EEEECCEECCCCEEECCC---CC---C----CHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCC
Q ss_conf             168887335997485346---88---8----6779888740367524102001368789988626884255541000024
Q gi|254780434|r   46 NTKVAGISLSNPLGMAAG---YD---K----NAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGF  115 (362)
Q Consensus        46 ~~~~~Gl~~~nPiglAaG---~d---k----~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl  115 (362)
                      +.++.+++++|.|+.|+=   +.   .    ..++..+...-|+|.++++.+...+ .|...|+..++..++ .+     
T Consensus         4 P~kig~~~lkNRiv~apm~~~~~~~~~~~~~~~~yy~~rA~gG~glIi~e~~~v~~-~g~~~~~~~~i~~d~-~i-----   76 (353)
T cd02930           4 PLDLGFTTLRNRVLMGSMHTGLEELDDGIDRLAAFYAERARGGVGLIVTGGFAPNE-AGKLGPGGPVLNSPR-QA-----   76 (353)
T ss_pred             CCEECCEEECCCCEECCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEEEEEECC-CCCCCCCCCCCCCHH-HH-----
T ss_conf             83289999788678557463436799786999999999976786348976289880-417699976327999-99-----


Q ss_pred             CCCCHHHHHHHHHHHH---------------HCCCCCCEEECCC--------CC----HHHHHHHHHHHHHHC-CCCCEE
Q ss_conf             7777788999876410---------------0012100011045--------42----467887765554206-755269
Q gi|254780434|r  116 NNAGYHTVFSRLSKIQ---------------PTSPIGINLGANK--------DS----KDFILDYVSGIRLFF-TIASYF  167 (362)
Q Consensus       116 ~N~G~~~~~~~l~~~~---------------~~~pi~vsI~~~~--------~s----~~~~~dy~~~~~~~~-~~aD~i  167 (362)
                        +|+..+.+.+.++.               ...++..|-..+.        -|    ++.+++|.+.++.+. .+.|.+
T Consensus        77 --~~~k~l~~~vH~~G~~i~~QL~H~Gr~~~~~~~~~ps~~~~~~~~~~p~~mt~~eI~~ii~~f~~AA~rA~~AGfDgV  154 (353)
T cd02930          77 --AGHRLITDAVHAEGGKIALQILHAGRYAYHPLCVAPSAIRAPINPFTPRELSEEEIEQTIEDFARCAALAREAGYDGV  154 (353)
T ss_pred             --HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             --999999999997699799973147866689888189877788899988659999999999999999999998299989


Q ss_pred             EEE---------CCCCCC--CCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCC------CCHHHHHHHHH
Q ss_conf             830---------333653--2211000023432111122444556553126885178650577------77488899999
Q gi|254780434|r  168 TIN---------ISSPNT--PGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPD------LSEEELDDIAV  230 (362)
Q Consensus       168 EiN---------iSCPNt--~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd------~~~~~i~~ia~  230 (362)
                      ||.         +-+|.+  ..-+...+.++=.+++..+.+....   ......||.+|++++      .+.++..++++
T Consensus       155 EIH~ahGyLl~qFLSp~~N~RtDeYGGs~eNR~Rf~~Eiv~aVr~---~vg~d~~v~~Ris~~d~~~~G~~~~e~~~~~~  231 (353)
T cd02930         155 EIMGSEGYLINQFLAPRTNKRTDEWGGSFENRMRFPVEIVRAVRA---AVGEDFIIIYRLSMLDLVEGGSTWEEVVALAK  231 (353)
T ss_pred             EECCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH---HHCCCCEEEEECCCCCCCCCCCCHHHHHHHHH
T ss_conf             962567614877338754788574579878887999999999999---70998749997360126899989999999999


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCC-
Q ss_conf             8764498299980665553234577544632211356454246899999997408974899967889999999999839-
Q gi|254780434|r  231 EVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAG-  309 (362)
Q Consensus       231 ~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aG-  309 (362)
                      .+++.|+|-+.++--  ... ...+...     .+-+  ...-....+.+++.+  ++|+|.+|||.+++.+.+.|..| 
T Consensus       232 ~l~~~GvD~i~vs~G--~~~-~~~~~~~-----~~~p--~g~~~~~a~~ir~~~--~~Pvi~~G~i~~p~~ae~~l~~g~  299 (353)
T cd02930         232 ALEAAGADILNTGIG--WHE-ARVPTIA-----TSVP--RGAFAWATAKLKRAV--DIPVIASNRINTPEVAERLLADGD  299 (353)
T ss_pred             HHHHCCCCEEEECCC--CCC-CCCCCCC-----CCCC--CHHHHHHHHHHHHHC--CCCEEECCCCCCHHHHHHHHHCCC
T ss_conf             999819999996377--444-6687533-----4577--236699999988754--834896599798999999998799


Q ss_pred             CCEEEECHHHHCCCHHHHHHHHHH
Q ss_conf             997545278770697899999999
Q gi|254780434|r  310 ANLIQLYSAMIYEGISLPKRIIQG  333 (362)
Q Consensus       310 As~VQi~Tali~~Gp~~~~~I~~~  333 (362)
                      ||+|.++.+++.+ |.+++++.+|
T Consensus       300 aD~V~~gR~liad-Pdl~~K~~~G  322 (353)
T cd02930         300 ADMVSMARPFLAD-PDFVAKAAAG  322 (353)
T ss_pred             CCHHHHHHHHHHC-CHHHHHHHCC
T ss_conf             6247840998769-3699999818


No 43 
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4.  Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.
Probab=99.42  E-value=5.8e-11  Score=93.70  Aligned_cols=259  Identities=16%  Similarity=0.202  Sum_probs=145.6

Q ss_pred             EEEEC-CEECCCCEEECCC---C-CCCH-------HHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEEC
Q ss_conf             16888-7335997485346---8-8867-------798887403675241020013687899886268842555410000
Q gi|254780434|r   46 NTKVA-GISLSNPLGMAAG---Y-DKNA-------EVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKL  113 (362)
Q Consensus        46 ~~~~~-Gl~~~nPiglAaG---~-dk~~-------~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~  113 (362)
                      +.++. |++++|.|+.|+=   . +.++       ++..+.. -|+|.++++.+...|. |-..|.            ..
T Consensus         4 P~~igngl~lkNRiv~apm~~~~a~~dG~~t~~~~~yy~~rA-gG~GliIte~~~V~~~-g~~~~~------------~~   69 (353)
T cd04735           4 PFTLKNGVTLKNRFVMAPMTTYSSNPDGTITDDELAYYQRRA-GGVGMVITGATYVSPS-GIGFEG------------GF   69 (353)
T ss_pred             CEECCCCCEECCCEEEHHHCCCCCCCCCCCCHHHHHHHHHHH-CCCEEEEECCEEECCC-CCCCCC------------CC
T ss_conf             877799969518776600038664679999999999999983-9614999894888613-257899------------87


Q ss_pred             CCCCC----CHHHHHHHHHHH-------------------HH-CCCCCCEEECC--------C-CCH----HHHHHHHHH
Q ss_conf             24777----778899987641-------------------00-01210001104--------5-424----678877655
Q gi|254780434|r  114 GFNNA----GYHTVFSRLSKI-------------------QP-TSPIGINLGAN--------K-DSK----DFILDYVSG  156 (362)
Q Consensus       114 Gl~N~----G~~~~~~~l~~~-------------------~~-~~pi~vsI~~~--------~-~s~----~~~~dy~~~  156 (362)
                      |+-++    |+..+.+.+.+.                   .. ..|++.|-...        + -|.    +-+++|.+.
T Consensus        70 ~i~~d~~i~~~k~l~~avH~~G~~i~~QL~H~Gr~~~~~~~~~~~~~~pS~~~~~~~~~~~p~~mt~~eI~~ii~~f~~A  149 (353)
T cd04735          70 SADDDSDIPGLRKLAQAIKSKGAKAILQIFHAGRMANPALVPGGDVVSPSAIAAFRPGAHTPRELTHEEIEDIIDAFGEA  149 (353)
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             64799999999999999985799189751136654661007899865777757677899988619999999999999999


Q ss_pred             HHHHC-CCCCEEEEE---------CCCCCC--CCCCCCCCHHHHHHHHHHHHHHHHHHH-HHCCCCCEEEEECCCC----
Q ss_conf             54206-755269830---------333653--221100002343211112244455655-3126885178650577----
Q gi|254780434|r  157 IRLFF-TIASYFTIN---------ISSPNT--PGLRSLQKKKNLERLLIHVMQTREEEK-IKTGKFVPIFLKISPD----  219 (362)
Q Consensus       157 ~~~~~-~~aD~iEiN---------iSCPNt--~g~~~~~~~~~l~~~l~~v~~~~~~~~-~~~~~~~Pi~vKLsPd----  219 (362)
                      ++.+. .+.|.+||.         +-+|.+  ..-+...+-++=.+++..+.+...... .......||.+|+||+    
T Consensus       150 A~rA~~AGfDgVEiH~ahGYLl~qFlSp~~N~RtDeYGGs~eNR~Rf~~Eii~aIr~~vg~~~~~df~vgvRis~~e~~~  229 (353)
T cd04735         150 TRRAIEAGFDGVEIHGANGYLIQQFFSPHSNRRTDEWGGSLENRMRFPLAVVKAVQEVIDKHADKDFILGYRFSPEEPEE  229 (353)
T ss_pred             HHHHHHCCCCEEEECCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCHHHCCC
T ss_conf             99999839998997546575999853998899847367988999889999999999985400589733675158654147


Q ss_pred             --CCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             --774888999998764498299980665553234577544632211356454246899999997408974899967889
Q gi|254780434|r  220 --LSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGIS  297 (362)
Q Consensus       220 --~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~  297 (362)
                        .+.++..++++.+++.|+|.|.++--  ...   ....       .++   +........+++....++|+|++|||.
T Consensus       230 ~G~~~~e~~~~~~~l~~~gvD~l~vs~g--~~~---~~~~-------~~~---~~~~~~~~~~~~~~~~~iPvi~~G~i~  294 (353)
T cd04735         230 PGIRMEDTLALVDKLADKGLDYLHISLW--DFD---RKSR-------RGR---DDNQTIMELVKERIAGRLPLIAVGSIN  294 (353)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEECCC--CCC---CCCC-------CCC---CCCHHHHHHHHHHHCCCCCEEEECCCC
T ss_conf             9999999999999998479988996037--766---7776-------677---753558999999967898099989999


Q ss_pred             CHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             9999999998399975452787706978999999999
Q gi|254780434|r  298 STKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       298 s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                      +++++.+.+..|||+|.++.+++-+ |.+++++.+|=
T Consensus       295 ~~~~ae~~l~~gaD~V~~gR~liad-Pd~~~K~~~Gr  330 (353)
T cd04735         295 TPDDALEALETGADLVAIGRGLLVD-PDWVEKIKEGR  330 (353)
T ss_pred             CHHHHHHHHHCCCCHHHHHHHHHHC-HHHHHHHHCCC
T ss_conf             8999999998699829986999979-31999998589


No 44 
>pfam00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family.
Probab=99.41  E-value=1.1e-10  Score=91.80  Aligned_cols=266  Identities=18%  Similarity=0.134  Sum_probs=149.4

Q ss_pred             EEEECCEECCCCEEECCCC----CCC-------HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECC
Q ss_conf             1688873359974853468----886-------77988874036752410200136878998862688425554100002
Q gi|254780434|r   46 NTKVAGISLSNPLGMAAGY----DKN-------AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLG  114 (362)
Q Consensus        46 ~~~~~Gl~~~nPiglAaG~----dk~-------~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~G  114 (362)
                      +.++.+++++|.|+.++=.    +.+       ...+.....-|+|.++++.+...+. |...|+...+..++ .+    
T Consensus         5 P~~ig~~~lkNRi~~apm~~~~~~~dG~~t~~~~~~y~~rA~gG~GlIi~e~~~V~~~-~~~~~~~~~i~~d~-~i----   78 (336)
T pfam00724         5 PIKIGNLTLKNRIVMAPMTRLRALEDGTVPERLAEYYSQRAQGGGTLIITEAVFVDPK-GGGFDNQPGLWDDE-QV----   78 (336)
T ss_pred             CCEECCEEECCCCEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEECCCEECHH-HCCCCCCCCCCCHH-HH----
T ss_conf             8158999977842761107763358999999999999999646974899687178820-05799987467689-99----


Q ss_pred             CCCCCHHHHHHHHHHHH-------------------HCCCCCCEEECC--------CCC----HHHHHHHHHHHHHHC-C
Q ss_conf             47777788999876410-------------------001210001104--------542----467887765554206-7
Q gi|254780434|r  115 FNNAGYHTVFSRLSKIQ-------------------PTSPIGINLGAN--------KDS----KDFILDYVSGIRLFF-T  162 (362)
Q Consensus       115 l~N~G~~~~~~~l~~~~-------------------~~~pi~vsI~~~--------~~s----~~~~~dy~~~~~~~~-~  162 (362)
                         +++..+.+.+.+..                   ...+...|....        .-|    ++.+++|...++.+. .
T Consensus        79 ---~~~~~l~~~vh~~G~~i~~QL~H~Gr~~~~~~~~~~~~~~s~~~~~~~~~~p~~mt~~eI~~ii~~f~~AA~rA~~A  155 (336)
T pfam00724        79 ---EGWKKLTEAVHENGSKIGVQLWHLGREAPPEYLEDLGLRPSDPSALPASIKVRELTKEEIKEIIQEFVQAAKRAVEA  155 (336)
T ss_pred             ---HHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             ---99999999998559849997035777688233788888887876678898887699999999999999999999982


Q ss_pred             CCCEEEEE---------CCCC--CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCC-------CHHH
Q ss_conf             55269830---------3336--5322110000234321111224445565531268851786505777-------7488
Q gi|254780434|r  163 IASYFTIN---------ISSP--NTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDL-------SEEE  224 (362)
Q Consensus       163 ~aD~iEiN---------iSCP--Nt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~-------~~~~  224 (362)
                      +-|.+||+         +-||  |...-+...+.|+=-+++..+.+....   ....+.||.+|++++-       .++.
T Consensus       156 GfDGVEIh~ahGyLl~QFLSp~~N~RtDeYGGslENR~Rf~~eIi~aIR~---~vg~d~~i~vRis~~d~~~~g~~~~e~  232 (336)
T pfam00724       156 GFDGVEIHGAHGYLLDQFLSPGSNKRTDEYGGSIENRARFPLEVVDAVKE---AVGEDRPIGYRLSPDDVFEGGLTGAET  232 (336)
T ss_pred             CCCEEEECHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH---HHCCCCCCEEEECCCCCCCCCCCCHHH
T ss_conf             99989961426789998628765889776788988975489999999999---728776642674652246899884268


Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHH
Q ss_conf             89999987644982999806655532345775446322113564542468999999974089748999678899999999
Q gi|254780434|r  225 LDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALD  304 (362)
Q Consensus       225 i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e  304 (362)
                      +..++..+.+.++|.+-++...  ......+...   +  +...-..........+++.+  ++|+|++|||.+++++.+
T Consensus       233 ~~~~~~~~~~~g~d~~~~~~~~--~~~~~~~~~~---~--~~~~~~~~~~~~~~~~k~~~--~~pvi~~G~i~~~~~ae~  303 (336)
T pfam00724       233 LAQFAYAAGELGVRVLDGTRLA--YIHAIEPRVT---G--PFPVETGQQVENNEFIKKVW--KGPVITVGRINDPEFAAE  303 (336)
T ss_pred             HHHHHHHHHHHCCCEEECCCCC--EEECCCCCCC---C--CCCCCCCHHHHHHHHHHHHC--CCEEEEECCCCCHHHHHH
T ss_conf             9999999998387756427662--2320244335---7--87756312478999999876--985999699998999999


Q ss_pred             HHHCC-CCEEEECHHHHCCCHHHHHHHHHH
Q ss_conf             99839-997545278770697899999999
Q gi|254780434|r  305 KIMAG-ANLIQLYSAMIYEGISLPKRIIQG  333 (362)
Q Consensus       305 ~l~aG-As~VQi~Tali~~Gp~~~~~I~~~  333 (362)
                      .+..| ||+|.++.+++.+ |.+++++.++
T Consensus       304 ~l~~g~~D~V~~gR~~iad-Pd~~~k~~~G  332 (336)
T pfam00724       304 IVEEGRADLVAMGRPFLAD-PDLVKKAKEG  332 (336)
T ss_pred             HHHCCCCEEHHHHHHHHHC-HHHHHHHHCC
T ss_conf             9987994436866999979-1399999808


No 45 
>KOG2335 consensus
Probab=99.39  E-value=3.2e-11  Score=95.39  Aligned_cols=190  Identities=21%  Similarity=0.205  Sum_probs=133.9

Q ss_pred             HHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCC-----CCCCC-CHHHHHHHHHHHHHHHHHHHH
Q ss_conf             000121000110454246788776555420675526983033365322-----11000-023432111122444556553
Q gi|254780434|r  131 QPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPG-----LRSLQ-KKKNLERLLIHVMQTREEEKI  204 (362)
Q Consensus       131 ~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g-----~~~~~-~~~~l~~~l~~v~~~~~~~~~  204 (362)
                      ..+.|++|.+++|.     .+.+++.++.+++++|++-||..||-..-     +..++ +++.+.+++.++.        
T Consensus        71 ~~D~PLIvQf~~nd-----p~~ll~Aa~lv~~y~D~idlNcGCPq~~a~~g~yGa~L~~~~eLv~e~V~~v~--------  137 (358)
T KOG2335          71 PEDRPLIVQFGGND-----PENLLKAARLVQPYCDGIDLNCGCPQKVAKRGGYGAFLMDNPELVGEMVSAVR--------  137 (358)
T ss_pred             CCCCCEEEEECCCC-----HHHHHHHHHHHHHHCCCCCCCCCCCHHHHHCCCCCCEECCCHHHHHHHHHHHH--------
T ss_conf             77786699974799-----89999999986533472041589987888437726000238899999999998--------


Q ss_pred             HCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             12688517865057777488899999876449829998066555323457754463221135645424689999999740
Q gi|254780434|r  205 KTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRV  284 (362)
Q Consensus       205 ~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~  284 (362)
                       .....||.+|+-=..+.++-.+.++.++++|++=+++-..|    .       ...|..+    .|.....|+.+++.+
T Consensus       138 -~~l~~pVs~KIRI~~d~~kTvd~ak~~e~aG~~~ltVHGRt----r-------~~kg~~~----~pad~~~i~~v~~~~  201 (358)
T KOG2335         138 -ANLNVPVSVKIRIFVDLEKTVDYAKMLEDAGVSLLTVHGRT----R-------EQKGLKT----GPADWEAIKAVRENV  201 (358)
T ss_pred             -HHCCCCEEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCC----H-------HHCCCCC----CCCCHHHHHHHHHHC
T ss_conf             -52599869999855767878999999986798689993655----7-------7628888----876779999999747


Q ss_pred             CCCEEEEEECCCCCHHHHHHHHH-CCCCEEEECHHHHCCCHHHH---------HHHHHHHHHHHHHCCCCC-HHHHHC
Q ss_conf             89748999678899999999998-39997545278770697899---------999999999999838997-789616
Q gi|254780434|r  285 GPKIAIIGTGGISSTKDALDKIM-AGANLIQLYSAMIYEGISLP---------KRIIQGLSDFLNKENEVN-FENIRG  351 (362)
Q Consensus       285 ~~~i~IIg~GGI~s~~Da~e~l~-aGAs~VQi~Tali~~Gp~~~---------~~I~~~L~~~l~~~G~~s-i~e~iG  351 (362)
                      +. +|+|+-|+|.+.+|+..-+. -||+-|+++-|+.++ |.+|         -.+.++--.+..+.+-.+ ...++.
T Consensus       202 ~~-ipviaNGnI~~~~d~~~~~~~tG~dGVM~arglL~N-Pa~F~~~~~~~~~~~~~~~~l~~~~e~~g~~~~~~~~~  277 (358)
T KOG2335         202 PD-IPVIANGNILSLEDVERCLKYTGADGVMSARGLLYN-PALFLTAGYGPTPWGCVEEYLDIAREFGGLSSFSLIRH  277 (358)
T ss_pred             CC-CCEEEECCCCCHHHHHHHHHHHCCCEEEECCHHHCC-CHHHCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHH
T ss_conf             67-708950885768999999997587468860000038-41202688777878899999999997279723667888


No 46 
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain.  Enoate reductase catalyzes the NADH-dependent reduction of carbon-carbon double bonds of several molecules, including nonactivated 2-enoates, alpha,beta-unsaturated aldehydes, cyclic ketones, and methylketones. ERs are similar to 2,4-dienoyl-CoA reductase from E. coli and to the old yellow enzyme from Saccharomyces cerevisiae.
Probab=99.38  E-value=2.2e-10  Score=89.85  Aligned_cols=262  Identities=16%  Similarity=0.142  Sum_probs=143.7

Q ss_pred             EEEECCEECCCCEEECCC----C-CCC-------HHHHHHHHHCCCCEEECCCCCCCCCCC-CCCCCEEEEECCCCCEEE
Q ss_conf             168887335997485346----8-886-------779888740367524102001368789-988626884255541000
Q gi|254780434|r   46 NTKVAGISLSNPLGMAAG----Y-DKN-------AEVPIELLKLGFGFVEIGTVTPHPQAG-NPRPRVFRLTKDRAIINK  112 (362)
Q Consensus        46 ~~~~~Gl~~~nPiglAaG----~-dk~-------~~~~~~l~~~G~G~v~~ktit~~p~~G-Np~PR~~r~~~~~~iiN~  112 (362)
                      +.++.+++|+|.|+.++=    + +.+       .++..+...-|+|.++++.+...+... .+.|...          .
T Consensus         4 P~~ig~l~lkNRiv~apm~~~~~~~~dG~~t~~~~~yy~~rA~gG~GlIi~e~~~V~~~~~~~~~~~~~----------~   73 (382)
T cd02931           4 PIKIGKVEIKNRFAMAPMGPLGLADNDGAFNQRGIDYYVERAKGGTGLIITGVTMVDNEIEQFPMPSLP----------C   73 (382)
T ss_pred             CCEECCEEECCCCEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCEEECCCCCCCCCCCCC----------C
T ss_conf             844899986885277887865666899898999999999996658647895241266665668988878----------7


Q ss_pred             CCCCC----CCHHHHHHHHHHHHHCCCCCCEE-----------------------ECCC---------CC----HHHHHH
Q ss_conf             02477----77788999876410001210001-----------------------1045---------42----467887
Q gi|254780434|r  113 LGFNN----AGYHTVFSRLSKIQPTSPIGINL-----------------------GANK---------DS----KDFILD  152 (362)
Q Consensus       113 ~Gl~N----~G~~~~~~~l~~~~~~~pi~vsI-----------------------~~~~---------~s----~~~~~d  152 (362)
                      .++..    +++..+.+.+.+  .+..+++.+                       ..+.         -|    ++.+++
T Consensus        74 ~~~~~~~~i~~~k~l~~~vH~--~G~~i~~QL~h~~gr~~~~~~~~~~~~~~pS~~~~~~~~~~~~r~mt~~eI~~ii~~  151 (382)
T cd02931          74 PTYNPTAFIRTAKEMTERVHA--YGTKIFLQLTAGFGRVCIPGFLGEDKPVAPSPIPNRWLPEITCRELTTEEVETFVGK  151 (382)
T ss_pred             CCCCCHHHHHHHHHHHHHHHH--CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             776859999999999999985--489068630665466457654789985788656445688877776899999999999


Q ss_pred             HHHHHHHHC-CCCCEEEEEC----------CCC--CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             765554206-7552698303----------336--532211000023432111122444556553126885178650577
Q gi|254780434|r  153 YVSGIRLFF-TIASYFTINI----------SSP--NTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPD  219 (362)
Q Consensus       153 y~~~~~~~~-~~aD~iEiNi----------SCP--Nt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd  219 (362)
                      |.+.++.+. .+.|.+||.-          -+|  |...-+...+-++=-+++..+.+...   .....+.||.+|+|++
T Consensus       152 f~~AA~rA~~AGfDgVEIH~ah~GyLl~qFlSp~~N~RtDeYGGSlenR~Rf~~Evi~aVR---~~vg~d~~v~~R~s~~  228 (382)
T cd02931         152 FGESAVIAKEAGFDGVEIHAVHEGYLLDQFTISLFNKRTDKYGGSLENRLRFAIEIVEEIK---ARCGEDFPVSLRYSVK  228 (382)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHCCHHHHHHHHHH---HHHCCCCEEEEEECCC
T ss_conf             9999999998499989962453035899854873589886458987885618999999999---9709887389996563


Q ss_pred             C--------------------CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             7--------------------74888999998764498299980665553234577544632211356454246899999
Q gi|254780434|r  220 L--------------------SEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAK  279 (362)
Q Consensus       220 ~--------------------~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~  279 (362)
                      .                    +.++...+++.+++.|+|.+-++-...+......+......         ..-+...+.
T Consensus       229 ~~~~~~~~g~~~~~~~~~~g~~l~e~~~~~~~l~~~G~D~l~vs~g~~~~~~~~~~~~~~~~---------g~~~~~a~~  299 (382)
T cd02931         229 SYIKDLRQGALPGEEFQEKGRDLEEGLKAAKILEEAGYDALDVDAGSYDAWYWNHPPMYQKK---------GMYLPYCKA  299 (382)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCHHCCCCCCCCCC---------CCCHHHHHH
T ss_conf             34566545788577788876359999999999998398889647774211010379754676---------314899999


Q ss_pred             HHHHCCCCEEEEEECCCCCHHHHHHHHHCC-CCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             997408974899967889999999999839-9975452787706978999999999
Q gi|254780434|r  280 IRQRVGPKIAIIGTGGISSTKDALDKIMAG-ANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       280 i~~~~~~~i~IIg~GGI~s~~Da~e~l~aG-As~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                      +++.+  ++|+|++|||.++++|.+.|..| ||+|.++.+++-+ |.+++++.++-
T Consensus       300 ik~~~--~iPvi~~G~i~~p~~ae~~l~~g~aD~V~~gR~~iad-P~~v~K~~~G~  352 (382)
T cd02931         300 LKEVV--DVPVIMAGRMEDPELASEAINEGIADMISLGRPLLAD-PDVVNKIRRGR  352 (382)
T ss_pred             HHHHC--CCCEEEECCCCCHHHHHHHHHCCCCCHHHHHHHHHHC-CCHHHHHHCCC
T ss_conf             99873--9988996896999999999986996543622898869-35999998299


No 47 
>KOG0538 consensus
Probab=99.38  E-value=5.8e-10  Score=86.93  Aligned_cols=296  Identities=18%  Similarity=0.172  Sum_probs=168.7

Q ss_pred             HHHHHHHHHHHHHHH-HHH-CCCCCCCCCCEEEECCEECCCCEEECCC-------CCCCHHHHHHHHHCCCCEEECC--C
Q ss_conf             678899999999620-111-0467889631168887335997485346-------8886779888740367524102--0
Q gi|254780434|r   18 PEIAHHLSIVALKSG-LLS-FFPVHSDPRLNTKVAGISLSNPLGMAAG-------YDKNAEVPIELLKLGFGFVEIG--T   86 (362)
Q Consensus        18 pe~ah~~~~~~~~~~-~~~-~~~~~~~~~L~~~~~Gl~~~nPiglAaG-------~dk~~~~~~~l~~~G~G~v~~k--t   86 (362)
                      -|..|+-.+.+.+.. +.| .+.....+|++|+++|-+..-||++|.-       +|......++...+|...+..-  |
T Consensus        29 d~~Tl~~N~~AF~ri~~rPr~L~dV~~iD~sTtvlG~~i~~Pi~iapTa~qkma~pdGE~~taraa~~~~~~~i~Ss~at  108 (363)
T KOG0538          29 DQETLDENINAFRRILFRPRILRDVSKIDTSTTVLGQKISAPIMIAPTAMQKMAHPDGELATARAAQAAGTIMILSSWAT  108 (363)
T ss_pred             CHHHHHHHHHHHHHHHCCCHHHEECCCCCCCEEECCCCCCCEEEECCHHHHHCCCCCCCHHHHHHHHHCCCCEEEECCHH
T ss_conf             40218778999875501421430025355410331401264168751667660488622788898865698589731010


Q ss_pred             CCCCC--CCCCCCCCEEEEE--CCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCC
Q ss_conf             01368--7899886268842--5554100002477777889998764100012100011045424678877655542067
Q gi|254780434|r   87 VTPHP--QAGNPRPRVFRLT--KDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFT  162 (362)
Q Consensus        87 it~~p--~~GNp~PR~~r~~--~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~  162 (362)
                      .|.+.  ..+-|.-|.|.+.  +++.+          -+.+.+|.++.... -+.+-+-...- +....|.-.   .|.-
T Consensus       109 ~S~EdI~~aap~~~rwfQLYvykdr~I----------t~~Lv~raEk~Gfk-AlvlTvDtP~l-G~R~~D~~n---~f~l  173 (363)
T KOG0538         109 CSVEDIASAAPPGIRWFQLYVYKDRDI----------TEQLVKRAEKAGFK-ALVLTVDTPRL-GRRESDIKN---KFSL  173 (363)
T ss_pred             CCHHHHHHHCCCCCEEEEEEECCCHHH----------HHHHHHHHHHCCCE-EEEEEECCCCC-CCCHHHHHH---CCCC
T ss_conf             789999851887737999985374468----------99999999972966-99998346112-676044440---2568


Q ss_pred             CCCEEEEECCCCCCCCCCCCCCH----HHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             55269830333653221100002----34321111224445565531268851786505777748889999987644982
Q gi|254780434|r  163 IASYFTINISSPNTPGLRSLQKK----KNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVE  238 (362)
Q Consensus       163 ~aD~iEiNiSCPNt~g~~~~~~~----~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~d  238 (362)
                      -....--|+-.+.-.....- ..    .........-.++.+-...+..++.||++|==  ++    .+=|..|.|+|++
T Consensus       174 p~~l~lknfe~~~~~~v~~~-~~sg~~~~~~~~id~Sl~W~Di~wLr~~T~lPIvvKGi--lt----~eDA~~Ave~G~~  246 (363)
T KOG0538         174 PKNLTLKNFEGLKLTEVEEA-GDSGLAAYVSSQIDPSLSWKDIKWLRSITKLPIVVKGV--LT----GEDARKAVEAGVA  246 (363)
T ss_pred             CCCCCCCCCCCCCCCCCCCC-CCHHHHHHHHCCCCCCCCHHHHHHHHHCCCCCEEEEEE--CC----CHHHHHHHHHCCC
T ss_conf             74210026555665567866-31346666423788777742469998527587699831--14----3879999980886


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHH
Q ss_conf             99980665553234577544632211356454246899999997408974899967889999999999839997545278
Q gi|254780434|r  239 GIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSA  318 (362)
Q Consensus       239 Giv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Ta  318 (362)
                      ||+++|-- .|         +.-+       -|.+...+.++-+.+++++++.=-|||.+|.|+++.+..||..|-++..
T Consensus       247 GIIVSNHG-gR---------QlD~-------vpAtI~~L~Evv~aV~~ri~V~lDGGVR~G~DVlKALALGAk~VfiGRP  309 (363)
T KOG0538         247 GIIVSNHG-GR---------QLDY-------VPATIEALPEVVKAVEGRIPVFLDGGVRRGTDVLKALALGAKGVFIGRP  309 (363)
T ss_pred             EEEEECCC-CC---------CCCC-------CCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCC
T ss_conf             59985787-53---------2576-------6411887999999862854799726733542799998516736885672


Q ss_pred             HHC----CCHHHHHH----HHHHHHHHHHHCCCCCHHHHHCC
Q ss_conf             770----69789999----99999999998389977896169
Q gi|254780434|r  319 MIY----EGISLPKR----IIQGLSDFLNKENEVNFENIRGS  352 (362)
Q Consensus       319 li~----~Gp~~~~~----I~~~L~~~l~~~G~~si~e~iG~  352 (362)
                      ++|    +|-.-+++    +.+|+.--|.--|+.|+.|+--.
T Consensus       310 ~v~gLA~~Ge~GV~~vl~iL~~efe~tmaLsGc~sv~ei~~~  351 (363)
T KOG0538         310 IVWGLAAKGEAGVKKVLDILRDEFELTMALSGCRSVKEITRN  351 (363)
T ss_pred             CEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHCCCC
T ss_conf             102000256032999999999999999998478606540745


No 48 
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion]
Probab=99.35  E-value=8.4e-10  Score=85.87  Aligned_cols=260  Identities=23%  Similarity=0.276  Sum_probs=152.2

Q ss_pred             EEEECCEECCCCEEECC---------CC--CCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECC
Q ss_conf             16888733599748534---------68--88677988874036752410200136878998862688425554100002
Q gi|254780434|r   46 NTKVAGISLSNPLGMAA---------GY--DKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLG  114 (362)
Q Consensus        46 ~~~~~Gl~~~nPiglAa---------G~--dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~G  114 (362)
                      +.++.+++++|.|..|.         |.  |...++..+...-|+|.+.+++....|. |...|            |..|
T Consensus         9 P~~lg~~~L~NRivmaPm~~~~a~~dG~pt~~~~~yy~~RA~gG~Glii~~~~~v~~~-g~~~~------------~~~~   75 (363)
T COG1902           9 PLKLGGLTLKNRIVMAPMTRNRATPDGLPTDLLAEYYAERAKGGAGLIITEATAVDPG-GRGYP------------GQPG   75 (363)
T ss_pred             CEEECCEEECCCEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEEEEECCC-CCCCC------------CCCC
T ss_conf             8147998760523654755454569999888999999998648977799966740755-46589------------9866


Q ss_pred             CCC----CCHHHHHHHHHHHHH------------------C--CCCCCEEECC----C--C---C----HHHHHHHHHHH
Q ss_conf             477----777889998764100------------------0--1210001104----5--4---2----46788776555
Q gi|254780434|r  115 FNN----AGYHTVFSRLSKIQP------------------T--SPIGINLGAN----K--D---S----KDFILDYVSGI  157 (362)
Q Consensus       115 l~N----~G~~~~~~~l~~~~~------------------~--~pi~vsI~~~----~--~---s----~~~~~dy~~~~  157 (362)
                      +-+    +|+..+.+.+.+...                  .  .++..|-...    .  +   |    ++-++||.+.+
T Consensus        76 l~~d~~i~~~~~vt~avH~~G~~i~iQL~H~Gr~~~~~~~~~~~~vapS~~~~~~~~~~~pr~mt~eeI~~ii~~f~~AA  155 (363)
T COG1902          76 LWSDAQIPGLKRLTEAVHAHGAKIFIQLWHAGRKARASHPWLPSAVAPSAIPAPGGRRATPRELTEEEIEEVIEDFARAA  155 (363)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             57866738899999999856995999822776133223567876457774425667888886589999999999999999


Q ss_pred             HHHC-CCCCEEEE---------ECCCCCC--CCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCC----
Q ss_conf             4206-75526983---------0333653--221100002343211112244455655312688517865057777----
Q gi|254780434|r  158 RLFF-TIASYFTI---------NISSPNT--PGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLS----  221 (362)
Q Consensus       158 ~~~~-~~aD~iEi---------NiSCPNt--~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~----  221 (362)
                      +.+. .+-|.+||         .+=||.+  ..-+...+-|+=.+++..+.+.....   -....||.++|||+-.    
T Consensus       156 ~rA~~AGFDgVEIH~AhGYLi~qFlsp~tN~RtD~YGGSlENR~Rf~~EVv~aVr~~---vg~~~~vg~Rls~~d~~~~~  232 (363)
T COG1902         156 RRAKEAGFDGVEIHGAHGYLLSQFLSPLTNKRTDEYGGSLENRARFLLEVVDAVREA---VGADFPVGVRLSPDDFFDGG  232 (363)
T ss_pred             HHHHHCCCCEEEEEECCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH---HCCCCEEEEEECCCCCCCCC
T ss_conf             999983999899840444499985587557777766885899988999999999997---29886699997745467788


Q ss_pred             ---HHHHHHHHHHHHHCC-CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             ---488899999876449-8299980665553234577544632211356454246899999997408974899967889
Q gi|254780434|r  222 ---EEELDDIAVEVLSHK-VEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGIS  297 (362)
Q Consensus       222 ---~~~i~~ia~~a~~~g-~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~  297 (362)
                         .++..++++.+.+.| +|-+.++.-.....      ......+ .|     .-+.....++...  .+|+|++|+|.
T Consensus       233 g~~~~e~~~la~~L~~~G~~d~i~vs~~~~~~~------~~~~~~~-~~-----~~~~~a~~i~~~~--~~pvi~~G~i~  298 (363)
T COG1902         233 GLTIEEAVELAKALEEAGLVDYIHVSEGGYERG------GTITVSG-PG-----YQVEFAARIKKAV--RIPVIAVGGIN  298 (363)
T ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCC------CCCCCCC-CC-----HHHHHHHHHHHHC--CCCEEEECCCC
T ss_conf             888999999999998558844799603644578------8744466-41-----2478999998860--78779868979


Q ss_pred             CHHHHHHHHHCC-CCEEEECHHHHCCCHHHHHHHHHHHHH
Q ss_conf             999999999839-997545278770697899999999999
Q gi|254780434|r  298 STKDALDKIMAG-ANLIQLYSAMIYEGISLPKRIIQGLSD  336 (362)
Q Consensus       298 s~~Da~e~l~aG-As~VQi~Tali~~Gp~~~~~I~~~L~~  336 (362)
                      +++.|.+.+..| ||+|.++.+++-+ |.++.++.+++..
T Consensus       299 ~~~~Ae~~l~~g~aDlVa~gR~~lad-P~~v~k~~~g~~~  337 (363)
T COG1902         299 DPEQAEEILASGRADLVAMGRPFLAD-PDLVLKAAEGREL  337 (363)
T ss_pred             CHHHHHHHHHCCCCCEEEECHHHHCC-CCHHHHHHCCCCC
T ss_conf             99999999982998888726366509-2089999737876


No 49 
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure. Specific for this family is the conserved phosphate binding site at the edges of strands 7 and 8. The phosphate comes either from the substrate, as in the case of inosine monophosphate dehydrogenase (IMPDH), or from ribulose-5-phosphate 3-epimerase (RPE) or from cofactors, like FMN.
Probab=99.32  E-value=1.8e-10  Score=90.35  Aligned_cols=189  Identities=17%  Similarity=0.200  Sum_probs=121.3

Q ss_pred             CCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCC
Q ss_conf             88677988874036752410200136878998862688425554100002477777889998764100012100011045
Q gi|254780434|r   65 DKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANK  144 (362)
Q Consensus        65 dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~  144 (362)
                      +...|..+.+.+.|+.++.+++.+..|+...+.-                      ....++. +...+.|+++++..+.
T Consensus        12 ~~~~E~a~~~~~aGa~~i~~~~~~~~~~~~~~~~----------------------~~~i~~~-~~~t~~P~~v~~~~~~   68 (200)
T cd04722          12 GDPVELAKAAAEAGADAIIVGTRSSDPEEAETDD----------------------KEVLKEV-AAETDLPLGVQLAIND   68 (200)
T ss_pred             CCHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHH----------------------HHHHHHH-HHHCCCCEEEEEECCC
T ss_conf             7899999999868873688648879824616999----------------------9999999-9707998799842056


Q ss_pred             CCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHH
Q ss_conf             42467887765554206755269830333653221100002343211112244455655312688517865057777488
Q gi|254780434|r  145 DSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEE  224 (362)
Q Consensus       145 ~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~  224 (362)
                      ... ....+.+.+  ...++|.++++-.||+..        +...+++..+++.        ....++++|++|..    
T Consensus        69 ~~~-~~~~~~~~~--~~~g~d~v~i~~~~~~~~--------~~~~~~~~~~~~~--------~~~~~vi~~~~~~~----  125 (200)
T cd04722          69 AAA-AVDIAAAAA--RAAGADGVEIHGAVGYLA--------REDLELIRELREA--------VPDVKVVVKLSPTG----  125 (200)
T ss_pred             CCC-CCHHHHHHH--HHCCCCEEEECCCCCCCC--------CCHHHHHHHHHHH--------CCCCEEEEECCCCC----
T ss_conf             666-775999999--983999899789996543--------0068999999984--------48964999689999----


Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHH
Q ss_conf             89999987644982999806655532345775446322113564542468999999974089748999678899999999
Q gi|254780434|r  225 LDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALD  304 (362)
Q Consensus       225 i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e  304 (362)
                       ...+..+++.|+|.+.+.+...               +-.++...+....++..+++..  ++|+|+.|||.+++|+.+
T Consensus       126 -~~~~~~a~~~g~~~v~~~~~~~---------------~~~~~~~~~~~~~~~~~~~~~~--~ipvi~~gGi~~~~~~~~  187 (200)
T cd04722         126 -ELAAAAAEEAGVDEVGLGNGGG---------------GGGGRDAVPIADLLLILAKRGS--KVPVIAGGGINDPEDAAE  187 (200)
T ss_pred             -HHHHHHHHHCCCCEEEECCCCC---------------CCCCCCCCCHHHHHHHHHHHHC--CCCEEEECCCCCHHHHHH
T ss_conf             -9999999980997999708746---------------7888766611689999999857--999899758799999999


Q ss_pred             HHHCCCCEEEECH
Q ss_conf             9983999754527
Q gi|254780434|r  305 KIMAGANLIQLYS  317 (362)
Q Consensus       305 ~l~aGAs~VQi~T  317 (362)
                      .+.+|||.|+++|
T Consensus       188 ~~~~gAdgv~vGs  200 (200)
T cd04722         188 ALALGADGVIVGS  200 (200)
T ss_pred             HHHCCCCEEEECC
T ss_conf             9985998898188


No 50 
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain.  TMADH is an iron-sulfur flavoprotein that catalyzes the oxidative demethylation of trimethylamine to form dimethylamine and formaldehyde. The protein forms a symetrical dimer with each subunit containing one 4Fe-4S cluster and one FMN cofactor.  It contains a unique flavin, in the form of a 6-S-cysteinyl FMN  which is bent by ~25 degrees along the N5-N10 axis of the flavin isoalloxazine ring. This modification of the conformation of the flavin is thought to facilitate catalysis.The closely related histamine dehydrogenase catalyzes oxidative deamination of histamine.
Probab=99.30  E-value=5.7e-10  Score=87.01  Aligned_cols=259  Identities=17%  Similarity=0.163  Sum_probs=139.6

Q ss_pred             EEEECCEECCCCEEECC---CC--CCCH---HHHHHHHHCCCCEEECCCCCCCCCC-CCCC--CCEEEEECCCCCEEECC
Q ss_conf             16888733599748534---68--8867---7988874036752410200136878-9988--62688425554100002
Q gi|254780434|r   46 NTKVAGISLSNPLGMAA---GY--DKNA---EVPIELLKLGFGFVEIGTVTPHPQA-GNPR--PRVFRLTKDRAIINKLG  114 (362)
Q Consensus        46 ~~~~~Gl~~~nPiglAa---G~--dk~~---~~~~~l~~~G~G~v~~ktit~~p~~-GNp~--PR~~r~~~~~~iiN~~G  114 (362)
                      +.++.+++++|.|+.|+   +.  +...   .+......-|+|.++++.+...|.. ..|.  ++++.   + ..+    
T Consensus        11 P~~ig~l~lkNRiv~ap~~~~~~~~~~~~~~~~~~~rA~GG~GlIite~~~V~~~~~~~~~~~~~l~~---d-~~i----   82 (370)
T cd02929          11 PIKIGPVTARNRFYQVPHCNGMGYRKPSAQAAMRGIKAEGGWGVVNTEQCSIHPSSDDTPRISARLWD---D-GDI----   82 (370)
T ss_pred             CCCCCCEEECCCCEECCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCEEECCCCCCCCCCCCCCCC---H-HHH----
T ss_conf             83289999898678798988888999579999999984668149996504861030458898877379---8-999----


Q ss_pred             CCCCCHHHHHHHHHHHH-------------------HCCCCCCEEECC----------CC-C----HHHHHHHHHHHHHH
Q ss_conf             47777788999876410-------------------001210001104----------54-2----46788776555420
Q gi|254780434|r  115 FNNAGYHTVFSRLSKIQ-------------------PTSPIGINLGAN----------KD-S----KDFILDYVSGIRLF  160 (362)
Q Consensus       115 l~N~G~~~~~~~l~~~~-------------------~~~pi~vsI~~~----------~~-s----~~~~~dy~~~~~~~  160 (362)
                         +|+..+.+.+.++.                   ...|+..|-...          .. |    ++.+++|.+.++.+
T Consensus        83 ---~~~k~l~d~vH~~G~~i~~QL~H~G~~~~~~~~~~~~~~pS~~~~~~~~~~~~~~r~mt~~eI~~ii~~f~~AA~rA  159 (370)
T cd02929          83 ---RNLAAMTDAVHKHGALAGIELWHGGAHAPNRESRETPLGPSQLPSEFPTGGPVQAREMDKDDIKRVRRWYVDAALRA  159 (370)
T ss_pred             ---HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             ---99999999999669967885335667776434689987864355566779998786689999999999999999999


Q ss_pred             C-CCCCEEEEE---------CCCCCC--CCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCC--------
Q ss_conf             6-755269830---------333653--22110000234321111224445565531268851786505777--------
Q gi|254780434|r  161 F-TIASYFTIN---------ISSPNT--PGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDL--------  220 (362)
Q Consensus       161 ~-~~aD~iEiN---------iSCPNt--~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~--------  220 (362)
                      . .+-|.+||.         +-||.+  ..-+...+.++=.+++..+.++...   ....+.||.+|++++.        
T Consensus       160 ~~AGfDgVEIHaahGYLl~qFlSp~~N~RtDeYGGS~enR~Rf~~Eii~aVr~---~vg~df~i~~R~s~~~~~~~~g~~  236 (370)
T cd02929         160 RDAGFDIVYVYAAHGYLPLQFLLPRYNKRTDEYGGSLENRARFWRETLEDTKD---AVGDDCAVATRFSVDELIGPGGIE  236 (370)
T ss_pred             HHCCCCEEEECCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH---HHCCCCEEEEEECCCCCCCCCCCC
T ss_conf             98598989977113559997347745787774689889998999999999999---719987599998941256889998


Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHH
Q ss_conf             74888999998764498299980665553234577544632211356454246899999997408974899967889999
Q gi|254780434|r  221 SEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTK  300 (362)
Q Consensus       221 ~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~  300 (362)
                      +.++..++++.+.+. +|-+-+.-..  .............         ...+...+.+++.+  ++|+|++|||.+++
T Consensus       237 ~~~~~~~~~~~~~~~-~d~~~vs~g~--~~~~~~~~~~~~~---------g~~~~~~~~ik~~~--~~Pvi~vG~i~~p~  302 (370)
T cd02929         237 SEGEGVEFVEMLDEL-PDLWDVNVGD--WANDGEDSRFYPE---------GHQEPYIKFVKQVT--SKPVVGVGRFTSPD  302 (370)
T ss_pred             CHHHHHHHHHHHHCC-CCEEEEEECC--CCCCCCCCCCCCC---------CCCHHHHHHHHHHC--CCCEEEECCCCCHH
T ss_conf             889999999997365-7979988555--5665677776786---------43659999999860--88089978979999


Q ss_pred             HHHHHHHCC-CCEEEECHHHHCCCHHHHHHHHHH
Q ss_conf             999999839-997545278770697899999999
Q gi|254780434|r  301 DALDKIMAG-ANLIQLYSAMIYEGISLPKRIIQG  333 (362)
Q Consensus       301 Da~e~l~aG-As~VQi~Tali~~Gp~~~~~I~~~  333 (362)
                      .|.+.|..| ||+|.++.+++-+ |.+++++.+|
T Consensus       303 ~ae~~l~~G~aD~V~~gR~llaD-Pd~~~K~~~G  335 (370)
T cd02929         303 KMVEVVKSGILDLIGAARPSIAD-PFLPKKIREG  335 (370)
T ss_pred             HHHHHHHCCCCCHHHHHHHHHHC-CHHHHHHHCC
T ss_conf             99999987994264534798769-5399999808


No 51 
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit. Members of this protein family are YgfK, predicted to be one subunit of a three-subunit, molybdopterin-containing selenate reductase. This enzyme is found, typically, in genomic regions associated with xanthine dehydrogenase homologs predicted to belong to the selenium-dependent molybdenum hydroxylases (SDMH). Therefore, the selenate reductase is suggested to play a role in furnishing selenide for SelD, the selenophosphate synthase.
Probab=99.29  E-value=3.9e-10  Score=88.14  Aligned_cols=291  Identities=18%  Similarity=0.161  Sum_probs=161.6

Q ss_pred             HHCCCCCCCCCCEEEECCEECCCCEEECCCCCCC-HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEE
Q ss_conf             1104678896311688873359974853468886-779888740367524102001368789988626884255541000
Q gi|254780434|r   34 LSFFPVHSDPRLNTKVAGISLSNPLGMAAGYDKN-AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINK  112 (362)
Q Consensus        34 ~~~~~~~~~~~L~~~~~Gl~~~nPiglAaG~dk~-~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~  112 (362)
                      +....+..++..+.+++|-++.+|+|.|||+-+. +.-+-...-.|.-|+|.|||-.--..-=|||++-  .+|++. |-
T Consensus        30 ~~~~~y~~~~~~~~~~fg~~~~tp~GpAaGPhtQlaQNiv~s~~~G~Rf~ElKTvQ~~d~~el~kPCI~--a~de~y-N~  106 (1012)
T TIGR03315        30 PKRKFYRADPGKYISLFGEKLETPVGPAAGPHTQLAQNIVASYLTGGRFFELKTVQVLDGLDLPKPCID--AADECY-NV  106 (1012)
T ss_pred             CHHHCEECCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCCCC--CCCCEE-EE
T ss_conf             477631079997651103337888887889558999999999974561578776676044436777636--566234-10


Q ss_pred             CCCCCCCH-HHHHHH---------HHHH-----HHCCCCCCEEECCCCC--HHHHHHHHHHHHHHCC-------------
Q ss_conf             02477777-889998---------7641-----0001210001104542--4678877655542067-------------
Q gi|254780434|r  113 LGFNNAGY-HTVFSR---------LSKI-----QPTSPIGINLGANKDS--KDFILDYVSGIRLFFT-------------  162 (362)
Q Consensus       113 ~Gl~N~G~-~~~~~~---------l~~~-----~~~~pi~vsI~~~~~s--~~~~~dy~~~~~~~~~-------------  162 (362)
                      -+-.---+ +.+-+.         |.+.     ..+...-.|+|++-+.  ...+++|.+.|+...+             
T Consensus       107 EWStEl~v~~a~~EYikaw~~l~~l~~~~~~~~~~~f~fnmSvGYdl~GIks~kv~~fi~~m~das~~~~~~~~~~~l~~  186 (1012)
T TIGR03315       107 EWSTELTVPEAYDEYVKAWFLLHLLEKEFELGDPRGFMFNMSVGYDLAGIKSPKVDRYIEEMQDASGTPIFAECRATLKK  186 (1012)
T ss_pred             ECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHH
T ss_conf             21300020788999999999999999970888877617973313174545766689999986633157699999999999


Q ss_pred             CCC------EEEEECCCC---CCCCCCCCCC--HHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC-------------
Q ss_conf             552------698303336---5322110000--2343211112244455655312688517865057-------------
Q gi|254780434|r  163 IAS------YFTINISSP---NTPGLRSLQK--KKNLERLLIHVMQTREEEKIKTGKFVPIFLKISP-------------  218 (362)
Q Consensus       163 ~aD------~iEiNiSCP---Nt~g~~~~~~--~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsP-------------  218 (362)
                      ..|      .--|+=-+|   |+--+..||.  ++.++.+..-+.+         .+++-.|+|+-|             
T Consensus       187 ~~~~f~~~~~~~~~~i~~~i~~~~tlST~HGcpp~EIe~I~~yl~~---------ek~l~t~iK~NpTllgy~~~r~~ld  257 (1012)
T TIGR03315       187 YIDYFKKVDDEFIDAISPKVCHSVTLSTMHGCPPDEIEAICRYLLE---------EKGLHTFVKLNPTLLGYKFVRDTMD  257 (1012)
T ss_pred             HHHHHHHCCHHHHHCCCHHHCCCEEEHHCCCCCHHHHHHHHHHHHH---------CCCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             9988753368777318922218466410469897999999999985---------0577668851742015899999998


Q ss_pred             ----------------CCCHHHHHHHH----HHHHHCCC-CEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             ----------------77748889999----98764498-2999806655532345775446322113564542468999
Q gi|254780434|r  219 ----------------DLSEEELDDIA----VEVLSHKV-EGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIAL  277 (362)
Q Consensus       219 ----------------d~~~~~i~~ia----~~a~~~g~-dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i  277 (362)
                                      |++.++...+.    +.+.+.|. -|+-++||..-.  ......+.+.==|||++|+|++..+.
T Consensus       258 ~~g~~yi~~~~~~F~~Dlq~~~a~~ml~rl~~la~~~~l~fGvKltNT~~v~--~~~~~lP~~eMYmSG~~L~plsi~~a  335 (1012)
T TIGR03315       258 EMGFDYIVLKEESFSHDLQYEDAVAMLQRLQLLAKEKGLGFGVKLTNTLPVT--IAKGELPGEEMYMSGRALFPLSINLA  335 (1012)
T ss_pred             HCCCCEEECCHHHCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCEEEE--ECCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             6098527427665344354678999999999999972965658870430056--12687996332035885620158999


Q ss_pred             HHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC-CCHHHHHHHHHHHHHHHH
Q ss_conf             99997408974899967889999999999839997545278770-697899999999999999
Q gi|254780434|r  278 AKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY-EGISLPKRIIQGLSDFLN  339 (362)
Q Consensus       278 ~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~-~Gp~~~~~I~~~L~~~l~  339 (362)
                      .++++..++++||.=+||+.- ....+-+.+|-.-|-++|-+.- -|+.-...+.++|...+.
T Consensus       336 ~~l~~~f~g~l~isysgGad~-~ni~~i~~~gi~piT~at~lLkpgGy~r~~q~a~~l~~~~~  397 (1012)
T TIGR03315       336 AKLSREFDGKLQISYSGGADI-FNIKEIFDTGIWPITMATTLLKPGGYLRLNQCANELETSEY  397 (1012)
T ss_pred             HHHHHHHCCCCCEEEECCCCH-HCHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             999997099751366467542-25999997298500321021687627999999999874023


No 52 
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes.
Probab=99.28  E-value=1.6e-09  Score=83.98  Aligned_cols=250  Identities=19%  Similarity=0.213  Sum_probs=137.0

Q ss_pred             EEEECCEECCCCEEECCC----CCCCH----HHHHHHH-HCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCC
Q ss_conf             168887335997485346----88867----7988874-03675241020013687899886268842555410000247
Q gi|254780434|r   46 NTKVAGISLSNPLGMAAG----YDKNA----EVPIELL-KLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFN  116 (362)
Q Consensus        46 ~~~~~Gl~~~nPiglAaG----~dk~~----~~~~~l~-~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~  116 (362)
                      +.++.|++++|.|+.|+=    .+.++    .++..+. .+|+|.++++.+...|. |-..|            +..|+-
T Consensus         5 P~~Ig~~~lkNRiv~apm~~~~~~~~G~pt~~~~~yy~~rAg~GlIi~e~~~V~~~-g~~~~------------~~~~l~   71 (338)
T cd02933           5 PLKLGNLTLKNRIVMAPLTRSRADPDGVPTDLMAEYYAQRASAGLIITEATQISPQ-GQGYP------------NTPGIY   71 (338)
T ss_pred             CCEECCEEECCCEEECCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCEEECCC-CCCCC------------CCCCCC
T ss_conf             80689998478728634578745999999999999999858855799723697542-04699------------987322


Q ss_pred             CC----CHHHHHHHHHHHH---------------------HCCCCCCEEEC--------------C--C-CC----HHHH
Q ss_conf             77----7788999876410---------------------00121000110--------------4--5-42----4678
Q gi|254780434|r  117 NA----GYHTVFSRLSKIQ---------------------PTSPIGINLGA--------------N--K-DS----KDFI  150 (362)
Q Consensus       117 N~----G~~~~~~~l~~~~---------------------~~~pi~vsI~~--------------~--~-~s----~~~~  150 (362)
                      ++    ++..+.+.+.++.                     -..|++.|--.              .  + -|    ++.+
T Consensus        72 ~d~~i~~~~~l~~~vh~~Ga~~~~QL~H~Gr~~~~~~~~~g~~~~apS~~~~~~~~~~~~~~~~~~~pr~mt~~eI~~ii  151 (338)
T cd02933          72 TDEQVEGWKKVTDAVHAKGGKIFLQLWHVGRVSHPSLLPGGAPPVAPSAIAAEGKVFTPAGKVPYPTPRALTTEEIPGIV  151 (338)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             39999999999999985589558875026766786355689960536888778775455666688888558999999999


Q ss_pred             HHHHHHHHHHC-CCCCEEEEEC---------CCCC--CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC
Q ss_conf             87765554206-7552698303---------3365--3221100002343211112244455655312688517865057
Q gi|254780434|r  151 LDYVSGIRLFF-TIASYFTINI---------SSPN--TPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISP  218 (362)
Q Consensus       151 ~dy~~~~~~~~-~~aD~iEiNi---------SCPN--t~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsP  218 (362)
                      ++|+..++.+. .+.|.+||.-         -||-  ...-+...+-++=.+++..+.+......   ... .|.+||||
T Consensus       152 ~~f~~aA~ra~~AGfDgVEiHaaHGyLl~qFLSp~~N~RtDeYGGS~eNR~Rf~~Eii~aIR~~v---g~d-~i~vRlSp  227 (338)
T cd02933         152 ADFRQAARNAIEAGFDGVEIHGANGYLIDQFLRDGSNKRTDEYGGSIENRARFLLEVVDAVAEAI---GAD-RVGIRLSP  227 (338)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH---CCC-EEEEEECC
T ss_conf             99999999999839999998224406899853853268989789998999899999999999972---987-08999657


Q ss_pred             CC---------CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             77---------748889999987644982999806655532345775446322113564542468999999974089748
Q gi|254780434|r  219 DL---------SEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIA  289 (362)
Q Consensus       219 d~---------~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~  289 (362)
                      ..         +.++...+++.+.+.|+|-+.++..     .            .++.+ ...-......+++.+  ++|
T Consensus       228 ~~~~~g~~~~~~~~~~~~~~~~l~~~gid~~~v~~~-----~------------~~~~~-~~~~~~~~~~ir~~~--~~p  287 (338)
T cd02933         228 FGTFNDMGDSDPEATFSYLAKELNKRGLAYLHLVEP-----R------------VAGNP-EDQPPDFLDFLRKAF--KGP  287 (338)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC-----C------------CCCCC-CCCCHHHHHHHHHHC--CCC
T ss_conf             667688788877999999999999859988997268-----7------------77777-776577999999986--997


Q ss_pred             EEEECCCCCHHHHHHHHHCC-CCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             99967889999999999839-9975452787706978999999999
Q gi|254780434|r  290 IIGTGGISSTKDALDKIMAG-ANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       290 IIg~GGI~s~~Da~e~l~aG-As~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                      +|++||+ +.+.+.+.|..| ||+|.++.+++-+ |.+++++.+|.
T Consensus       288 vi~~G~i-~~~~ae~~l~~G~~D~V~~gR~liaD-P~~~~K~~~G~  331 (338)
T cd02933         288 LIAAGGY-DAESAEAALADGKADLVAFGRPFIAN-PDLVERLKNGA  331 (338)
T ss_pred             EEEECCC-CHHHHHHHHHCCCCCHHHHHHHHHHC-CCHHHHHHCCC
T ss_conf             9996998-99999999987996036852999879-13999996399


No 53 
>TIGR02708 L_lactate_ox L-lactate oxidase; InterPro: IPR014080   Members of this entry oxidize L-lactate to pyruvate, reducing molecular oxygen to hydrogen peroxide. The enzyme is known in Aerococcus viridans, Streptococcus iniae, and some strains of Streptococcus pyogenes where it appears to contribute to virulence..
Probab=99.27  E-value=9.7e-10  Score=85.45  Aligned_cols=284  Identities=19%  Similarity=0.274  Sum_probs=165.6

Q ss_pred             HHHHHHHHHH--HHHCCCCCCCCCCEEEECCEECCCCEEEC--C--CC---CCCHHHHHHHHHCCCCEEECCC----CCC
Q ss_conf             9999999620--11104678896311688873359974853--4--68---8867798887403675241020----013
Q gi|254780434|r   23 HLSIVALKSG--LLSFFPVHSDPRLNTKVAGISLSNPLGMA--A--GY---DKNAEVPIELLKLGFGFVEIGT----VTP   89 (362)
Q Consensus        23 ~~~~~~~~~~--~~~~~~~~~~~~L~~~~~Gl~~~nPiglA--a--G~---dk~~~~~~~l~~~G~G~v~~kt----it~   89 (362)
                      +-...+.++.  .+........|+-++++.|-++++|+++|  |  ++   .+..-.-+.+.++|  -+-+-|    +++
T Consensus        46 r~N~Raf~HKL~~P~~~~~VE~P~T~~~~~G~~l~~P~I~APvAAH~LA~~~~E~atAr~v~EFG--~i~~~S~YS~~~l  123 (368)
T TIGR02708        46 RENIRAFNHKLIVPHLLQDVENPSTEIEFLGEKLKSPLIMAPVAAHKLANEQGEVATARGVSEFG--SIYTTSSYSTADL  123 (368)
T ss_pred             HHCCHHHCCCCCCCHHHCCCCCCCCEEEECCCEECCCEEECCHHHHHHHHCCCCHHHHHHHHHCC--CCEEEECCCCCCH
T ss_conf             43102232420135233046788731676264104860441157643310012012210021203--1001101246767


Q ss_pred             CC-CCC-CCCCCEEEE--ECCCCCEEECCCCCCCHHHHHHHHHHHHHCC-CCC--CEEECCCCCHHHHHHHHHHHHHHCC
Q ss_conf             68-789-988626884--2555410000247777788999876410001-210--0011045424678877655542067
Q gi|254780434|r   90 HP-QAG-NPRPRVFRL--TKDRAIINKLGFNNAGYHTVFSRLSKIQPTS-PIG--INLGANKDSKDFILDYVSGIRLFFT  162 (362)
Q Consensus        90 ~p-~~G-Np~PR~~r~--~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~-pi~--vsI~~~~~s~~~~~dy~~~~~~~~~  162 (362)
                      ++ .++ |=.||-|.+  .+|+.+ |         ..++.+.|.--... .|-  .-+++|.+-+ .-.           
T Consensus       124 ~EIS~aL~G~P~WFQ~Y~~KDD~~-N---------R~I~D~~Ka~G~~AIvLTADaTV~GNR~~D-~~N-----------  181 (368)
T TIGR02708       124 PEISEALNGTPHWFQFYMSKDDGI-N---------RDILDRVKADGAKAIVLTADATVGGNREVD-KRN-----------  181 (368)
T ss_pred             HHHHHHHCCCCCEEEEEEECCCCC-C---------HHHHHHHHHCCCEEEEEECCCCCCCCCCCC-CCC-----------
T ss_conf             999976279971588887403433-3---------467888752785289972146335774413-558-----------


Q ss_pred             CCCEEEEECCCCCCCC-CCCCCCHHHHHHHHHHHH---HHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             5526983033365322-110000234321111224---445565531268851786505777748889999987644982
Q gi|254780434|r  163 IASYFTINISSPNTPG-LRSLQKKKNLERLLIHVM---QTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVE  238 (362)
Q Consensus       163 ~aD~iEiNiSCPNt~g-~~~~~~~~~l~~~l~~v~---~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~d  238 (362)
                         -+..=+.-|=+.. ++--.....|+.+-.+-+   ..++.+.+....-+|||||=. .     ..+=++.+.++|+.
T Consensus       182 ---~FVfP~GMPIV~~YL~G~~~G~s~~~vY~~aKQ~lsprDiE~IA~ySGLPVyVKG~-Q-----~~ED~~~al~AGAS  252 (368)
T TIGR02708       182 ---GFVFPVGMPIVQEYLPGEGAGKSLDYVYKSAKQKLSPRDIEEIAAYSGLPVYVKGP-Q-----CPEDADRALKAGAS  252 (368)
T ss_pred             ---CEEECCCCCHHHHCCCCCCCCCHHHHHHHHHHCCCCCCHHHHHHHHCCCCEEEECC-C-----CHHHHHHHHHCCCC
T ss_conf             ---73611556033310788767740666665541157810089997217983686078-8-----86689999972886


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHH
Q ss_conf             99980665553234577544632211356454246899999997408974899967889999999999839997545278
Q gi|254780434|r  239 GIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSA  318 (362)
Q Consensus       239 Giv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Ta  318 (362)
                      ||=++|-          ..+...|       -|-|-+.+.++.++++.++||+=--||..|+++++-|..|||+|-++.-
T Consensus       253 GIWV~NH----------G~RQl~~-------~PaaFD~L~~vAE~V~~rVPIVFDSGvRRG~Hv~KALASGAD~VAlGRP  315 (368)
T TIGR02708       253 GIWVTNH----------GGRQLDG-------GPAAFDSLQEVAEAVDKRVPIVFDSGVRRGQHVFKALASGADLVALGRP  315 (368)
T ss_pred             EEEEECC----------CCCCCCC-------CCCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCCEEECCCH
T ss_conf             2576047----------7502367-------8752000699999852855668508843257899987235644301323


Q ss_pred             HHCC----C----HHHHHHHHHHHHHHHHHCCCCCHHHHHCCCCHH
Q ss_conf             7706----9----789999999999999983899778961697526
Q gi|254780434|r  319 MIYE----G----ISLPKRIIQGLSDFLNKENEVNFENIRGSYTEY  356 (362)
Q Consensus       319 li~~----G----p~~~~~I~~~L~~~l~~~G~~si~e~iG~~~~~  356 (362)
                      .+|-    |    ..++..++++|+.-|+--|-.+|+|+.+-++.+
T Consensus       316 v~yGLAlGG~~G~~~V~~~l~~~L~~VMQL~G~Q~i~D~K~~~L~~  361 (368)
T TIGR02708       316 VIYGLALGGSVGARQVLEYLNKELKRVMQLTGTQTIEDVKGLDLRH  361 (368)
T ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHCCCCCC
T ss_conf             5666550102218999999998877776413875156532141333


No 54 
>pfam03060 NPD 2-nitropropane dioxygenase. Members of this family catalyse the denitrification of a number of nitroalkanes using either FAD or FMN as a cofactor.
Probab=99.24  E-value=2.5e-10  Score=89.37  Aligned_cols=90  Identities=17%  Similarity=0.304  Sum_probs=68.3

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             51786505777748889999987644982999806655532345775446322113564542468999999974089748
Q gi|254780434|r  210 VPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIA  289 (362)
Q Consensus       210 ~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~  289 (362)
                      +.++..++   +    .+-++.++++|+|+|++-+.              +.||-.|...-.....++.++++.+  ++|
T Consensus       138 ~~v~~~v~---s----~~~A~~a~~~G~D~iV~qG~--------------eAGGH~G~~~~~~~~~L~~~v~~~~--~iP  194 (330)
T pfam03060       138 TKVIPTVS---S----AKEARKAEAAGADAVVAQGP--------------EAGGHRGTEVGTGTFLLVPTVVDAV--DIP  194 (330)
T ss_pred             CEEEEECC---C----HHHHHHHHHCCCCEEEEECC--------------CCCCCCCCCCCCCHHHHHHHHHHHC--CCC
T ss_conf             98999818---9----99999999819998999667--------------6677788877730777789999871--697


Q ss_pred             EEEECCCCCHHHHHHHHHCCCCEEEECHHHHCC
Q ss_conf             999678899999999998399975452787706
Q gi|254780434|r  290 IIGTGGISSTKDALDKIMAGANLIQLYSAMIYE  322 (362)
Q Consensus       290 IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~  322 (362)
                      ||+.|||.+++|+...+.+||+.||++|.|+--
T Consensus       195 vIaAGGI~dg~~iaaalalGA~gV~mGTrFlat  227 (330)
T pfam03060       195 VIAAGGIADGRGIAAALALGAEGVQIGTRFLAT  227 (330)
T ss_pred             EEEECCCCCHHHHHHHHHCCCCEEEECCEEEEC
T ss_conf             785266289999999996799899971300115


No 55 
>PRK09853 putative selenate reductase subunit YgfK; Provisional
Probab=99.22  E-value=5.3e-09  Score=80.46  Aligned_cols=290  Identities=17%  Similarity=0.152  Sum_probs=160.2

Q ss_pred             HCCCCCCCCCCEEEECCEECCCCEEECCCCCCC-HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEEC
Q ss_conf             104678896311688873359974853468886-7798887403675241020013687899886268842555410000
Q gi|254780434|r   35 SFFPVHSDPRLNTKVAGISLSNPLGMAAGYDKN-AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKL  113 (362)
Q Consensus        35 ~~~~~~~~~~L~~~~~Gl~~~nPiglAaG~dk~-~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~  113 (362)
                      ....+..++.-..+++|-++.+|+|.|||+-+. +.-+-...-.|.-|+|.|||-.--..-=|||++-  .+|++. |--
T Consensus        32 ~~~fy~~~~~~~~~~fg~~~~tp~GPAaGPhtQlaQNiv~syl~G~Rf~ElKTvQ~~d~~ei~kPCI~--a~de~y-N~E  108 (1032)
T PRK09853         32 EQQFYSPVKGKTISLFGETCATPVGPAAGPHTQLAQNIVTSYLTGGRFIELKTVQILDRLELEKPCID--AEDECF-NTE  108 (1032)
T ss_pred             HHHCEECCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCCCC--CCCCEE-EEE
T ss_conf             77632079996550001237888887889548999999999974561578776776144436777636--566234-102


Q ss_pred             C-----CCCCCHHHHH-----HHHHHH---H---HCCCCCCEEECCCCC--HHHHHHHHHHHHHHC--------------
Q ss_conf             2-----4777778899-----987641---0---001210001104542--467887765554206--------------
Q gi|254780434|r  114 G-----FNNAGYHTVF-----SRLSKI---Q---PTSPIGINLGANKDS--KDFILDYVSGIRLFF--------------  161 (362)
Q Consensus       114 G-----l~N~G~~~~~-----~~l~~~---~---~~~pi~vsI~~~~~s--~~~~~dy~~~~~~~~--------------  161 (362)
                      +     ++----||++     .-|.+.   .   .+...-.|+|++-+.  ...+++|.+.|+...              
T Consensus       109 WStEl~v~~a~~EYikaw~~l~~l~~~~~~~~~~~~f~fnmSVGYdl~GIks~kv~~fi~~m~das~~~~~~~~~~~l~~  188 (1032)
T PRK09853        109 WSTEFTLLKAYDEYLKAWFALHLLEKEFQPSDEGKSFIFNMSVGYDLEGIKSPPMQQFIDNMMDASDHPIFAEYRDTLNK  188 (1032)
T ss_pred             CCCEECHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHH
T ss_conf             13001207889999999999999999848888787459974312074545766689999986633147799999999998


Q ss_pred             ------CC-CCEEEE----------ECCCC--CCCCCCCCCC--HHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC--
Q ss_conf             ------75-526983----------03336--5322110000--2343211112244455655312688517865057--
Q gi|254780434|r  162 ------TI-ASYFTI----------NISSP--NTPGLRSLQK--KKNLERLLIHVMQTREEEKIKTGKFVPIFLKISP--  218 (362)
Q Consensus       162 ------~~-aD~iEi----------NiSCP--Nt~g~~~~~~--~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsP--  218 (362)
                            .. ..++|-          -||.-  |+--+..||.  ++.++.+..-+.+         .+++-.|+|+-|  
T Consensus       189 ~~~~f~~~~~~~~~~~~~~~~~~~~~i~~~i~~~~TlST~HGCpp~EIe~I~~yll~---------ek~l~tfiK~NpTl  259 (1032)
T PRK09853        189 LLDDFAFLAREGLQEKRESLQALPARISPSMCHSVTLSTMHGCPPHEIEAICRYMLE---------EKGLNTFVKLNPTL  259 (1032)
T ss_pred             HHHHHHHCCHHHHHHHHHHHCCCCCCCCCHHCCCEEEHHCCCCCHHHHHHHHHHHHH---------CCCCCEEEEECCCC
T ss_conf             877776422666433322100223467902217465320369898999999999985---------05776688517420


Q ss_pred             ---------------------------CCCHHHHHHHH----HHHHHCCC-CEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             ---------------------------77748889999----98764498-29998066555323457754463221135
Q gi|254780434|r  219 ---------------------------DLSEEELDDIA----VEVLSHKV-EGIIVSNTTLSRKGVQCSDNHEQDGGLSG  266 (362)
Q Consensus       219 ---------------------------d~~~~~i~~ia----~~a~~~g~-dGiv~~NT~~~~~~~~~~~~~~~~GGlSG  266 (362)
                                                 |++.++...+.    +.+.+.|. -|+-++||..-.  ......+.+.==|||
T Consensus       260 LGy~~~r~~ld~~G~dyi~~~~~~F~~Dlq~~~a~~ml~rL~~la~~~~l~fGvKltNT~~v~--~~~~~lP~~eMYmSG  337 (1032)
T PRK09853        260 LGYKRVREILDVCGFDYIGLKEESFDHDLQLTDAVEMLERLMALAKEKSLGFGVKLTNTLGTI--NNKGELPGEEMYMSG  337 (1032)
T ss_pred             CCHHHHHHHHHHCCCCEEECCHHHCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCEEEE--ECCCCCCCCCCCCCC
T ss_conf             058999999986098437417565333343567999999999999972965658870430056--126879963320358


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC-CCHHHHHHHHHHHHHHHH
Q ss_conf             6454246899999997408974899967889999999999839997545278770-697899999999999999
Q gi|254780434|r  267 SPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY-EGISLPKRIIQGLSDFLN  339 (362)
Q Consensus       267 ~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~-~Gp~~~~~I~~~L~~~l~  339 (362)
                      ++|+|++..+..++++..++++||.=+||+.- ....+-+.+|-.-|-++|-+.- -|+.-...+.++|...+.
T Consensus       338 r~L~plsi~~a~~l~~~f~g~l~iSysgGad~-~Ni~~i~~~gi~piT~at~lLkpgGy~r~~q~a~~l~~~~~  410 (1032)
T PRK09853        338 RALFPLSINLAAKLSRAFDGKLPISYSGGASQ-FNIRDIFDTGIRPITMATDLLKPGGYLRLSQCARELEGSDA  410 (1032)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEECCCCH-HHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             85620158999999997099751366467542-25999997298500331021687627999999999874023


No 56 
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase. IMPDH catalyzes the NAD-dependent oxidation of inosine 5'-monophosphate (IMP) to xanthosine 5' monophosphate (XMP). It is a rate-limiting step in the de novo synthesis of the guanine nucleotides. There is often a CBS domain inserted in the middle of this domain, which is proposed to play a regulatory role. IMPDH is a key enzyme in the regulation of cell proliferation and differentiation. It has been identified as an attractive target for developing chemotherapeutic agents.
Probab=99.18  E-value=3.4e-08  Score=75.07  Aligned_cols=243  Identities=19%  Similarity=0.276  Sum_probs=141.1

Q ss_pred             CCCCCCCEEEECC-EECCCCEEECCCCCC--CHHHHHHHHHCC-CCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECC
Q ss_conf             7889631168887-335997485346888--677988874036-752410200136878998862688425554100002
Q gi|254780434|r   39 VHSDPRLNTKVAG-ISLSNPLGMAAGYDK--NAEVPIELLKLG-FGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLG  114 (362)
Q Consensus        39 ~~~~~~L~~~~~G-l~~~nPiglAaG~dk--~~~~~~~l~~~G-~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~G  114 (362)
                      .+++.+|++++.. ++|.-|| +||-.|+  +.++...+...| +|.+                  +|            
T Consensus        17 ~r~~Vdl~~~~~~~~~l~iPI-issnMDtV~~~~mA~~la~~Gglgvl------------------hr------------   65 (325)
T cd00381          17 LPSEVDLSTKLTKNITLNIPL-VSAPMDTVTESEMAIAMARLGGIGVI------------------HR------------   65 (325)
T ss_pred             CHHHCEEEEEECCCCCCCCCE-EECCCCCCCCHHHHHHHHHCCCEEEE------------------EC------------
T ss_conf             888926768841881448988-86788875889999999977996899------------------43------------


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             47777788999876410001210001104542467887765554206755269830333653221100002343211112
Q gi|254780434|r  115 FNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIH  194 (362)
Q Consensus       115 l~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~  194 (362)
                        +.-++...+.+++.+....++++|+.+   ++..+....   .+...+|++.|.++  |.       ..+.+.+.+..
T Consensus        66 --~~~~e~~~~~v~~vk~~~~v~aaig~~---~~~~~r~~~---l~~ag~d~i~IDvA--hG-------~~~~~~~~ik~  128 (325)
T cd00381          66 --NMSIEEQAEEVRKVKGRLLVGAAVGTR---EDDKERAEA---LVEAGVDVIVIDSA--HG-------HSVYVIEMIKF  128 (325)
T ss_pred             --CCCHHHHHHHHHHHHCCEEEEEEECCC---HHHHHHHHH---HHHCCCCEEEEECH--HC-------CCHHHHHHHHH
T ss_conf             --588899999999750476999997668---628999999---99769989998700--03-------45889999999


Q ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             24445565531268851786505777748889999987644982999806655532345775446322113564542468
Q gi|254780434|r  195 VMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKST  274 (362)
Q Consensus       195 v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al  274 (362)
                      ++        +...++||++-   |..+   .+.++.+.++|+|+|-+.=-..+   .++-....+.    |.|- ..++
T Consensus       129 ir--------~~~p~~~IiaG---NV~T---~e~a~~L~~~GaD~vkVGiG~GS---~CtTr~~tGv----G~Pq-~sai  186 (325)
T cd00381         129 IK--------KKYPNVDVIAG---NVVT---AEAARDLIDAGADGVKVGIGPGS---ICTTRIVTGV----GVPQ-ATAV  186 (325)
T ss_pred             HH--------HHCCCCCEEEC---CCCC---HHHHHHHHHCCCCEEEECCCCCC---CCCCCCCCCC----CCCH-HHHH
T ss_conf             99--------76899756864---5668---99999998669989997575777---7666010178----8745-8899


Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC-------------------CC------------
Q ss_conf             99999997408974899967889999999999839997545278770-------------------69------------
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY-------------------EG------------  323 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~-------------------~G------------  323 (362)
                      .-.+..++.+  .+|||+-|||.+.-|+.+-|.+|||+|++++-|.-                   .|            
T Consensus       187 ~~~a~~~~~~--~v~iiaDGGi~~~Gdi~KAla~GAd~VMlG~~lAg~~EsPG~~~~~~g~~~k~y~Gm~S~~a~~~~~~  264 (325)
T cd00381         187 ADVAAAARDY--GVPVIADGGIRTSGDIVKALAAGADAVMLGSLLAGTDESPGEYIEINGKRYKEYRGMGSLGAMKKGGG  264 (325)
T ss_pred             HHHHHHHHCC--CCCEEECCCCCCHHHHHHHHHCCCCEEEECCHHCCCCCCCCCEEEECCCEEEEEECCCCHHHHCCCCC
T ss_conf             9999976344--98589448733107888887528878984621046666896158763827889978765433165776


Q ss_pred             --------------------------HHHHHHHHHHHHHHHHHCCCCCHHHHHCCC
Q ss_conf             --------------------------789999999999999983899778961697
Q gi|254780434|r  324 --------------------------ISLPKRIIQGLSDFLNKENEVNFENIRGSY  353 (362)
Q Consensus       324 --------------------------p~~~~~I~~~L~~~l~~~G~~si~e~iG~~  353 (362)
                                                ...+.++..+|+.-|..-|..+|.|+.-..
T Consensus       265 ~~~~~~~~~~~~~eG~~~~v~~~g~v~~~~~~l~gglrs~m~y~Ga~~l~e~~~~~  320 (325)
T cd00381         265 DRYFGEEAKKLVPEGVEGIVPYKGSVKDVLPQLVGGLRSSMGYCGAKSLKELQEKA  320 (325)
T ss_pred             CCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHCC
T ss_conf             54345555101489638998678867889999999998987325867399997578


No 57 
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDP is a member of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.
Probab=99.17  E-value=4.2e-09  Score=81.16  Aligned_cols=185  Identities=15%  Similarity=0.248  Sum_probs=114.3

Q ss_pred             CCCEEECCCCC--CCHHHHHHHHHCC-CCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH
Q ss_conf             99748534688--8677988874036-75241020013687899886268842555410000247777788999876410
Q gi|254780434|r   55 SNPLGMAAGYD--KNAEVPIELLKLG-FGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ  131 (362)
Q Consensus        55 ~nPiglAaG~d--k~~~~~~~l~~~G-~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~  131 (362)
                      +-||+ .++.+  .+.++..+..++| +|++-.+..                               -.|.+.+.+++.+
T Consensus         2 ~~PIi-~a~M~~vs~~~LaaAvs~aGglG~l~~~~~-------------------------------~~~~l~~~i~~~~   49 (236)
T cd04730           2 RYPII-QAPMAGVSTPELAAAVSNAGGLGFIGAGYL-------------------------------TPEALRAEIRKIR   49 (236)
T ss_pred             CCCEE-CCCCCCCCCHHHHHHHHHCCCEEEECCCCC-------------------------------CHHHHHHHHHHHH
T ss_conf             74868-788778786999999996898558578889-------------------------------9999999999999


Q ss_pred             H--CCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             0--01210001104542467887765554206755269830333653221100002343211112244455655312688
Q gi|254780434|r  132 P--TSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKF  209 (362)
Q Consensus       132 ~--~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~  209 (362)
                      .  +.|+++|+...... ...+++.+.+.+.  .++++++-..           .+.   ++++.++.          ..
T Consensus        50 ~~~~~pfgvnl~~~~~~-~~~~~~~~~~~~~--~v~~v~~~~g-----------~p~---~~v~~l~~----------~g  102 (236)
T cd04730          50 ALTDKPFGVNLLVPSSN-PDFEALLEVALEE--GVPVVSFSFG-----------PPA---EVVERLKA----------AG  102 (236)
T ss_pred             HHCCCCEEECCCCCCCC-CCHHHHHHHHHHC--CCCEEEECCC-----------CCH---HHHHHHHH----------CC
T ss_conf             74699724433246776-3689999999976--9999998798-----------978---99999998----------29


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             51786505777748889999987644982999806655532345775446322113564542468999999974089748
Q gi|254780434|r  210 VPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIA  289 (362)
Q Consensus       210 ~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~  289 (362)
                      +.++.+.+   +    .+.++.+.+.|+|+|++-..              +.||.-|... ...+.++.++++.+  ++|
T Consensus       103 ~~v~~~v~---s----~~~A~~a~~~GaD~iv~qG~--------------eAGGH~g~~~-~~~~~lv~~v~~~~--~ip  158 (236)
T cd04730         103 IKVIPTVT---S----VEEARKAEAAGADALVAQGA--------------EAGGHRGTFD-IGTFALVPEVRDAV--DIP  158 (236)
T ss_pred             CEEEEECC---C----HHHHHHHHHCCCCEEEEECC--------------CCCCCCCCCC-CCHHHHHHHHHHHH--CCC
T ss_conf             98999589---8----99999999818998999777--------------7777889875-55677999999982--986


Q ss_pred             EEEECCCCCHHHHHHHHHCCCCEEEECHHHHCC
Q ss_conf             999678899999999998399975452787706
Q gi|254780434|r  290 IIGTGGISSTKDALDKIMAGANLIQLYSAMIYE  322 (362)
Q Consensus       290 IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~  322 (362)
                      ||+.|||.+++|+...+.+||+.||++|.|+.-
T Consensus       159 viaAGGI~~g~~i~aal~lGA~gV~~GTrfl~t  191 (236)
T cd04730         159 VIAAGGIADGRGIAAALALGADGVQMGTRFLAT  191 (236)
T ss_pred             EEEECCCCCHHHHHHHHHHCCCEEEECCHHHHC
T ss_conf             896546277899999998089799955385708


No 58 
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II. This oxidoreductase of the 2-nitropropane dioxygenase family (pfam03060) is commonly found in apparent operons with genes involved in fatty acid biosynthesis. Furthermore, this genomic context generally includes the fabG 3-oxoacyl-[ACP] reductase and lacks the fabI enoyl-[ACP] reductase.
Probab=99.14  E-value=3.8e-09  Score=81.45  Aligned_cols=186  Identities=17%  Similarity=0.309  Sum_probs=114.1

Q ss_pred             EECCEECCCCEEECCCC--CCCHHHHHHHHHCC-CCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHH
Q ss_conf             88873359974853468--88677988874036-7524102001368789988626884255541000024777778899
Q gi|254780434|r   48 KVAGISLSNPLGMAAGY--DKNAEVPIELLKLG-FGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVF  124 (362)
Q Consensus        48 ~~~Gl~~~nPiglAaG~--dk~~~~~~~l~~~G-~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~  124 (362)
                      +.+|+  +.||+. ++.  -.+.++..+..++| +|++-.+..                               ..|.+.
T Consensus         6 ~~lgi--~~PIiq-apM~~vs~~~La~AVs~aGglG~l~~~~~-------------------------------~~e~l~   51 (307)
T TIGR03151         6 DLLGI--EYPIFQ-GGMAWVATGSLAAAVSNAGGLGIIGAGNA-------------------------------PPDVVR   51 (307)
T ss_pred             HHHCC--CCCEEC-CCCCCCCCHHHHHHHHHCCCEEEECCCCC-------------------------------CHHHHH
T ss_conf             97689--949787-88777787899999980898416678889-------------------------------999999


Q ss_pred             HHHHHHH--HCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             9876410--00121000110454246788776555420675526983033365322110000234321111224445565
Q gi|254780434|r  125 SRLSKIQ--PTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEE  202 (362)
Q Consensus       125 ~~l~~~~--~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~  202 (362)
                      +.+++.+  -+.|++||+....+.   .++..+.+  +...++++...+..|.              +++..+.+     
T Consensus        52 ~~i~~~~~~td~P~gvnl~~~~~~---~~~~~~~~--~e~~v~vv~~~~G~p~--------------~~~~~~~~-----  107 (307)
T TIGR03151        52 KEIRKVKELTDKPFGVNIMLLSPF---VDELVDLV--IEEKVPVVTTGAGNPG--------------KYIPRLKE-----  107 (307)
T ss_pred             HHHHHHHHHCCCCCEEEEEECCCC---HHHHHHHH--HHHCCCCEEECCCCCH--------------HHHHHHHH-----
T ss_conf             999999985279860433323888---99999999--8608982472799968--------------99999998-----


Q ss_pred             HHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             53126885178650577774888999998764498299980665553234577544632211356454246899999997
Q gi|254780434|r  203 KIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQ  282 (362)
Q Consensus       203 ~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~  282 (362)
                           ..++++...+   +    ...++.+++.|+|+|++-.+              +.||--|. +  ....++.+++.
T Consensus       108 -----~g~~v~~~v~---s----~~~A~~a~~~G~D~iV~qG~--------------EAGGH~G~-~--~~~~Lvp~v~d  158 (307)
T TIGR03151       108 -----NGVKVIPVVA---S----VALAKRMEKAGADAVIAEGM--------------ESGGHIGE-L--TTMALVPQVVD  158 (307)
T ss_pred             -----CCCEEEEEEC---C----HHHHHHHHHCCCCEEEEECC--------------CCCCCCCC-C--CHHHHHHHHHH
T ss_conf             -----5997999818---9----99999999649999997455--------------44687786-4--37877999985


Q ss_pred             HCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCC
Q ss_conf             4089748999678899999999998399975452787706
Q gi|254780434|r  283 RVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYE  322 (362)
Q Consensus       283 ~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~  322 (362)
                      .+  ++|+|+.|||.+++++...+.+||+.||++|.|+--
T Consensus       159 ~~--~iPViAAGGI~dgr~iaaalalGA~gV~mGTrFlat  196 (307)
T TIGR03151       159 AV--SIPVIAAGGIADGRGMAAAFALGAEAVQMGTRFLCA  196 (307)
T ss_pred             HC--CCCEEEECCCCCCHHHHHHHHCCCCEEEECHHHHCC
T ss_conf             04--686576411336588999997188478744197718


No 59 
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5.  Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.
Probab=99.12  E-value=1.1e-08  Score=78.32  Aligned_cols=254  Identities=17%  Similarity=0.207  Sum_probs=138.5

Q ss_pred             EEEECCEECCCCEEECCC---C-------CCCHHHHHHHHHCCCCEEECCCCCCC-CCCCCCCCCEEEEECCCCCEEECC
Q ss_conf             168887335997485346---8-------88677988874036752410200136-878998862688425554100002
Q gi|254780434|r   46 NTKVAGISLSNPLGMAAG---Y-------DKNAEVPIELLKLGFGFVEIGTVTPH-PQAGNPRPRVFRLTKDRAIINKLG  114 (362)
Q Consensus        46 ~~~~~Gl~~~nPiglAaG---~-------dk~~~~~~~l~~~G~G~v~~ktit~~-p~~GNp~PR~~r~~~~~~iiN~~G  114 (362)
                      +.++.+++++|.|+.|+=   +       |...++......-|+|.++++.+... |..+. .|+...+..++ .+    
T Consensus         4 Pi~Ig~~~lkNRiv~apm~~~~~~~G~~t~~~~~yy~~rA~GG~Gliite~~~V~~~~~~~-~~~~~~~~~d~-~i----   77 (361)
T cd04747           4 PFTLKGLTLPNRIVMAPMTRSFSPGGVPGQDVAAYYRRRAAGGVGLIITEGTAVDHPAASG-DPNVPRFHGED-AL----   77 (361)
T ss_pred             CEEECCEEECCCCEECCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCC-CCCCCCCCCHH-HH----
T ss_conf             8358999988852887748783889989999999999997689610797067105621358-99877758999-99----


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCCCEE--------------------ECC-----------CCC----HHHHHHHHHHHHH
Q ss_conf             47777788999876410001210001--------------------104-----------542----4678877655542
Q gi|254780434|r  115 FNNAGYHTVFSRLSKIQPTSPIGINL--------------------GAN-----------KDS----KDFILDYVSGIRL  159 (362)
Q Consensus       115 l~N~G~~~~~~~l~~~~~~~pi~vsI--------------------~~~-----------~~s----~~~~~dy~~~~~~  159 (362)
                         +|+..+.+.+.+.  +..+++.|                    ..+           .-|    ++.+++|...++.
T Consensus        78 ---~~~r~la~avH~~--G~~~~~QL~H~G~~~~~~~~~~~~~~~~~ps~~~~~~~~~~~~mt~eeI~~ii~~f~~AA~r  152 (361)
T cd04747          78 ---AGWKKVVDEVHAA--GGKIAPQLWHVGAMRKLGTPPFPDVPPLSPSGLVGPGKPVGREMTEADIDDVIAAFARAAAD  152 (361)
T ss_pred             ---HHHHHHHHHHHHC--CCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             ---9999999999976--99798700035666666678888988668756667889888879999999999999999999


Q ss_pred             HC-CCCCEEEE---------ECCCCCC--CCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCC--------
Q ss_conf             06-75526983---------0333653--2211000023432111122444556553126885178650577--------
Q gi|254780434|r  160 FF-TIASYFTI---------NISSPNT--PGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPD--------  219 (362)
Q Consensus       160 ~~-~~aD~iEi---------NiSCPNt--~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd--------  219 (362)
                      +. .+.|.+||         .+-||.+  ..-+...+.++=.+++..+.+....   ....+.||.+|+|+.        
T Consensus       153 A~~AGfDGVEIH~ahGyLl~qFLSp~~N~RtDeYGGSlENR~Rf~~Eii~aVr~---~vg~df~vg~Ris~~~~~~~~~~  229 (361)
T cd04747         153 ARRLGFDGIELHGAHGYLIDQFFWAGTNRRADGYGGSLAARSRFAAEVVKAIRA---AVGPDFPIILRFSQWKQQDYTAR  229 (361)
T ss_pred             HHHCCCCEEEECCCCCHHHHHHCCCCCCCCCCCCCCCHHHHCCHHHHHHHHHHH---HHCCCCEEEEEECCCCCCCCCCC
T ss_conf             998399989951044658998358743889887899879847369999999999---72998759999677657676655


Q ss_pred             --CCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCC-
Q ss_conf             --77488899999876449829998066555323457754463221135645424689999999740897489996788-
Q gi|254780434|r  220 --LSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGI-  296 (362)
Q Consensus       220 --~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI-  296 (362)
                        .+.+++..+++.+++.|+|.+-++....     ..+.       ..|..+     ....++++..  .+|.|.+|++ 
T Consensus       230 ~~~~~ee~~~~~~~l~~~GvD~i~~s~~~~-----~~p~-------~~~~~~-----~~~~~~k~~~--~~p~~~~g~~~  290 (361)
T cd04747         230 LADTPDELEALLAPLVDAGVDIFHCSTRRF-----WEPE-------FEGSEL-----NLAGWTKKLT--GLPTITVGSVG  290 (361)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEECCCC-----CCCC-------CCCCCC-----CHHHHHHHHC--CCCEEEECCCH
T ss_conf             679999999999999977999898413445-----6765-------677744-----4889988862--89758644410


Q ss_pred             -----------------CCHHHHHHHHHCC-CCEEEECHHHHCCCHHHHHHHHHH
Q ss_conf             -----------------9999999999839-997545278770697899999999
Q gi|254780434|r  297 -----------------SSTKDALDKIMAG-ANLIQLYSAMIYEGISLPKRIIQG  333 (362)
Q Consensus       297 -----------------~s~~Da~e~l~aG-As~VQi~Tali~~Gp~~~~~I~~~  333 (362)
                                       .+.+++.+.|..| ||+|.++.+++-+ |.+++++.+|
T Consensus       291 ~~~~~~~~~~~~~~~~~~~~e~ae~~l~~G~~D~V~~gR~llaD-P~~v~K~~~G  344 (361)
T cd04747         291 LDGDFIGAFAGDEGASPASLDRLLERLERGEFDLVAVGRALLSD-PAWVAKVREG  344 (361)
T ss_pred             HHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHH-HHHHHHHHCC
T ss_conf             35677777512454477799999999986994138975999975-4499999859


No 60 
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed
Probab=99.08  E-value=1.2e-06  Score=64.49  Aligned_cols=254  Identities=18%  Similarity=0.160  Sum_probs=137.3

Q ss_pred             EEEECCEECCCCEEECC--------CCCCC--HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCC
Q ss_conf             16888733599748534--------68886--779888740367524102001368789988626884255541000024
Q gi|254780434|r   46 NTKVAGISLSNPLGMAA--------GYDKN--AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGF  115 (362)
Q Consensus        46 ~~~~~Gl~~~nPiglAa--------G~dk~--~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl  115 (362)
                      +.++-|++|+|.|++|-        |+..+  ...+-....-|+|.|.+-.....|. |    |+  .+      +..|+
T Consensus       407 P~~lr~ltL~NRIvvSPMcqYsa~dG~ptd~Hl~Hyg~rA~gGaGLIi~EaTaVsp~-G----Ri--tp------~~~GL  473 (770)
T PRK08255        407 PFRLRGLTLKNRIVVSPMAMYSAVDGVPGDFHLVHLGARALGGAGLVMTEMTCVSPE-G----RI--TP------GCPGL  473 (770)
T ss_pred             CEEECCEEEECCEEECCHHHCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEEEEECCC-C----CC--CC------CCCCC
T ss_conf             875666752065675236535278998980899999999707878799876775676-5----78--99------88775


Q ss_pred             CCCCH----HHHHHHHHHH-------------H----------HCCC--------CCCEEECCC---C-----C----HH
Q ss_conf             77777----8899987641-------------0----------0012--------100011045---4-----2----46
Q gi|254780434|r  116 NNAGY----HTVFSRLSKI-------------Q----------PTSP--------IGINLGANK---D-----S----KD  148 (362)
Q Consensus       116 ~N~G~----~~~~~~l~~~-------------~----------~~~p--------i~vsI~~~~---~-----s----~~  148 (362)
                      =|+.-    ..+.+-+...             +          .+.|        +..|--...   .     +    .+
T Consensus       474 w~d~q~~~~krivd~vH~~~~a~i~iQL~HaGRKast~~~w~g~~~P~~~g~W~~vapS~ip~~~~~~~Pr~mt~~eI~~  553 (770)
T PRK08255        474 YNDEQEAAWKRIVDFVHANSDAKIGIQLGHAGRKGSTRLGWEGIDQPLEEGNWPLISASPLPYLPGSQVPREMTRADMDR  553 (770)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             59899999999999999636984798722378786555787778887876898724898887589998875689999999


Q ss_pred             HHHHHHHHHHHH-CCCCCEEEE---------ECCCCC--CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             788776555420-675526983---------033365--32211000023432111122444556553126885178650
Q gi|254780434|r  149 FILDYVSGIRLF-FTIASYFTI---------NISSPN--TPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKI  216 (362)
Q Consensus       149 ~~~dy~~~~~~~-~~~aD~iEi---------NiSCPN--t~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKL  216 (362)
                      -+++|...++.. ..+-|.+||         .+-||-  ...-+...+-++--+++..+.++...   .-...+|++|.|
T Consensus       554 vv~~F~~AA~rA~~AGFD~IEiH~AHGYLl~qFLSPlsN~RtDeYGGsleNR~Rf~lEV~~aVR~---~~p~~~Pl~vRi  630 (770)
T PRK08255        554 VRDQFVAATRRAAEAGFDWLELHCAHGYLLSSFISPLTNQRTDEYGGSLENRLRYPLEVFRAVRA---VWPADKPMSVRI  630 (770)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH---HCCCCCCEEEEE
T ss_conf             99999999999998399989995234555887538644677543578888777889999999998---678988669998


Q ss_pred             CCC------CCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             577------77488899999876449829998066555323457754463221135645424689999999740897489
Q gi|254780434|r  217 SPD------LSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAI  290 (362)
Q Consensus       217 sPd------~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~I  290 (362)
                      |..      .+.++-.++++.+++.|+|-|-++-.-.      .+.....+    |+. +.  +-.-..+|+..  ++|+
T Consensus       631 SatDw~~gG~t~edsv~la~~l~~~GvD~IdvSsGg~------~~~~~p~~----g~~-yQ--vpfA~~Ir~e~--~i~t  695 (770)
T PRK08255        631 SAHDWVEGGNTPDDAVEIARAFKAAGADMIDVSSGQV------SKDEKPVY----GRM-YQ--TPFADRIRNEA--GIAT  695 (770)
T ss_pred             ECCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCC------CCCCCCCC----CCC-CC--HHHHHHHHHHC--CCCE
T ss_conf             5102568999999999999999974998999578888------86677888----876-56--69999999875--9978


Q ss_pred             EEECCCCCHHHHHHHHHCC-CCEEEECHHHHCCCHHHHHHHH
Q ss_conf             9967889999999999839-9975452787706978999999
Q gi|254780434|r  291 IGTGGISSTKDALDKIMAG-ANLIQLYSAMIYEGISLPKRII  331 (362)
Q Consensus       291 Ig~GGI~s~~Da~e~l~aG-As~VQi~Tali~~Gp~~~~~I~  331 (362)
                      |+||.|.++++|-+-+.+| ||+|.++.++++. |.-.-+-.
T Consensus       696 ~AVG~I~~p~~Ae~Il~~GrADlValgR~~L~d-P~W~l~aA  736 (770)
T PRK08255        696 IAVGAISEADHVNSIIAAGRADLCALARPHLAD-PAWTLHEA  736 (770)
T ss_pred             EEECCCCCHHHHHHHHHCCCCCEEEECHHHHCC-CCHHHHHH
T ss_conf             996188999999999976998875247776519-95099999


No 61 
>PRK10605 N-ethylmaleimide reductase; Provisional
Probab=99.07  E-value=7.8e-08  Score=72.62  Aligned_cols=160  Identities=20%  Similarity=0.177  Sum_probs=97.1

Q ss_pred             HHHHHHHHHHHHHC-CCCCEEEEE---------CCCCCC--CCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             67887765554206-755269830---------333653--221100002343211112244455655312688517865
Q gi|254780434|r  148 DFILDYVSGIRLFF-TIASYFTIN---------ISSPNT--PGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLK  215 (362)
Q Consensus       148 ~~~~dy~~~~~~~~-~~aD~iEiN---------iSCPNt--~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vK  215 (362)
                      +.+++|.+.++.+. .+.|.+||.         +-||.+  ..-+...+-++=-+++..+.+.....    ...-+|.+|
T Consensus       156 ~ii~~f~~AA~rA~~AGfDgVEIH~aHGYLl~qFLSp~tN~RtDeYGGSleNR~Rf~~Eii~aVr~a----vg~d~v~vR  231 (362)
T PRK10605        156 GIVNDFRQAIANAREAGFDLVELHSAHGYLLHQFLSPSSNHRTDQYGGSVENRARLVLEVVDAGIAE----WGADRIGIR  231 (362)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH----HCCCCEEEE
T ss_conf             9999999999999983999899702473699973897667898878997899988999999999997----398737999


Q ss_pred             CCCCC----------CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             05777----------74888999998764498299980665553234577544632211356454246899999997408
Q gi|254780434|r  216 ISPDL----------SEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVG  285 (362)
Q Consensus       216 LsPd~----------~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~  285 (362)
                      ++|..          ..++...+++.+.+.|+|-+.++..          .      ...|.+.   ....-+.+++.+ 
T Consensus       232 is~~~~~~~~~~g~~~~~~~~~~~~~l~~~gv~~l~~s~p----------~------~~~~~~~---~~~~~~~ik~~v-  291 (362)
T PRK10605        232 ISPLGTFNNVDNGPNEEADALYLIEQLGKRGIAYLHMSEP----------D------WAGGEPY---SDAFREKVRARF-  291 (362)
T ss_pred             ECCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCC----------C------CCCCCCC---CHHHHHHHHHHC-
T ss_conf             7266565666578876899999999998629749997268----------5------5689875---199999999876-


Q ss_pred             CCEEEEEECCCCCHHHHHHHHHCC-CCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             974899967889999999999839-9975452787706978999999999
Q gi|254780434|r  286 PKIAIIGTGGISSTKDALDKIMAG-ANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       286 ~~i~IIg~GGI~s~~Da~e~l~aG-As~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                       ++|+|++|++ |.+.|.+.|..| ||+|.++.+++-. |.+++++.++.
T Consensus       292 -~~PVi~~G~~-tpe~Ae~~l~~G~aDlV~~gR~llAD-Pd~~~K~~~g~  338 (362)
T PRK10605        292 -HGPIIGAGAY-TAEKAETLIGKGLIDAVAFGRDYIAN-PDLVARLQRKA  338 (362)
T ss_pred             -CCCEEECCCC-CHHHHHHHHHCCCCCEEEEHHHHHHC-CCHHHHHHCCC
T ss_conf             -9978976899-99999999988998798100687759-45899985799


No 62 
>pfam00478 IMPDH IMP dehydrogenase / GMP reductase domain. This family is involved in biosynthesis of guanosine nucleotide. Members of this family contain a TIM barrel structure. In the inosine monophosphate dehydrogenases 2 CBS domains pfam00571 are inserted in the TIM barrel. This family is a member of the common phosphate binding site TIM barrel family.
Probab=99.06  E-value=1.6e-07  Score=70.43  Aligned_cols=128  Identities=17%  Similarity=0.255  Sum_probs=71.5

Q ss_pred             HHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             20675526983033365322110000234321111224445565531268851786505777748889999987644982
Q gi|254780434|r  159 LFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVE  238 (362)
Q Consensus       159 ~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~d  238 (362)
                      .+..++|++.|..+-=|         ...+-   +.++..+     +...++||++-   |..+   .+-++.+.++|+|
T Consensus       231 Lv~aGvDvivIDtAhGh---------s~~vi---~~ik~ik-----~~~p~~~iIaG---NVaT---~e~a~~Li~aGAD  287 (467)
T pfam00478       231 LVEAGVDVIVIDSAHGH---------SEYVL---EMIKWIK-----KKYPDLDVIAG---NVVT---AEAARELIDAGAD  287 (467)
T ss_pred             HHHCCCCEEEEECCCCC---------CHHHH---HHHHHHH-----HCCCCCCEEEE---EECC---HHHHHHHHHHCCC
T ss_conf             98769988997344544---------18899---9999987-----40787737851---0058---9999999970777


Q ss_pred             EEEEECCCCCCCC-CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECH
Q ss_conf             9998066555323-457754463221135645424689999999740897489996788999999999983999754527
Q gi|254780434|r  239 GIIVSNTTLSRKG-VQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYS  317 (362)
Q Consensus       239 Giv~~NT~~~~~~-~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~T  317 (362)
                      +|-+.=-    ++ +++.....   |. |.| .-.|..-+++.++.+  .+|||+-|||.+.-|+.+-|.||||+|++++
T Consensus       288 ~vKVGiG----pGSiCTTR~v~---Gv-G~P-Q~tAv~~~a~~a~~~--~vpiIADGGi~~sGDi~KAlaaGAd~VMlGs  356 (467)
T pfam00478       288 AVKVGIG----PGSICTTREVA---GV-GRP-QLTAVYEVADAARKL--GVPVIADGGIRYSGDIAKALAAGASAVMLGS  356 (467)
T ss_pred             EEEECCC----CCCCCCCCCCC---CC-CCC-HHHHHHHHHHHHHHC--CCEEEECCCCCCHHHHHHHHHCCCCEEEECH
T ss_conf             5775566----88656564203---66-775-087999999998656--9879944762330489999872898898772


Q ss_pred             HHH
Q ss_conf             877
Q gi|254780434|r  318 AMI  320 (362)
Q Consensus       318 ali  320 (362)
                      -|.
T Consensus       357 llA  359 (467)
T pfam00478       357 LLA  359 (467)
T ss_pred             HHC
T ss_conf             225


No 63 
>KOG2333 consensus
Probab=98.98  E-value=2.9e-08  Score=75.52  Aligned_cols=202  Identities=15%  Similarity=0.197  Sum_probs=122.3

Q ss_pred             HHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCC-----CCCCC-CCCCHHHHHHHHHHHHHHHH
Q ss_conf             7641000121000110454246788776555420675526983033365-----32211-00002343211112244455
Q gi|254780434|r  127 LSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPN-----TPGLR-SLQKKKNLERLLIHVMQTRE  200 (362)
Q Consensus       127 l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPN-----t~g~~-~~~~~~~l~~~l~~v~~~~~  200 (362)
                      ++++......||.+.+++.  +.+..-++++.+-.+ +|++.||+.||=     -.++. .+..+..+...+.+....  
T Consensus       313 lkRH~sEdiFGVQlag~~p--dt~~kaaq~i~e~~~-VDFIDlN~GCPIDlvy~qG~GsALl~rp~rl~~~l~~m~~v--  387 (614)
T KOG2333         313 LKRHQSEDIFGVQLAGSKP--DTAAKAAQVIAETCD-VDFIDLNMGCPIDLVYRQGGGSALLNRPARLIRILRAMNAV--  387 (614)
T ss_pred             HHHCCCCCCEEEEECCCCH--HHHHHHHHHHHHHCC-EEEEECCCCCCHHEEECCCCCCHHHCCCHHHHHHHHHHHHH--
T ss_conf             6405766532367426886--889999999986166-00463268997110220677505423818999999999876--


Q ss_pred             HHHHHCCCCCEEEEECCCCC--CHHHHHHHHHHHH-HCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             65531268851786505777--7488899999876-44982999806655532345775446322113564542468999
Q gi|254780434|r  201 EEKIKTGKFVPIFLKISPDL--SEEELDDIAVEVL-SHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIAL  277 (362)
Q Consensus       201 ~~~~~~~~~~Pi~vKLsPd~--~~~~i~~ia~~a~-~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i  277 (362)
                            ...+||-||+---.  ...-.++++..+. +.|++++|+-.    |..-.   .      +|    +..--..|
T Consensus       388 ------s~~iPiTVKiRTG~keg~~~a~~Li~~i~newg~savTlHG----RSRqQ---R------YT----K~AnWdYi  444 (614)
T KOG2333         388 ------SGDIPITVKIRTGTKEGHPVAHELIPRIVNEWGASAVTLHG----RSRQQ---R------YT----KSANWDYI  444 (614)
T ss_pred             ------CCCCCEEEEEECCCCCCCHHHHHHHHHHHHCCCCCEEEECC----CHHHH---H------HH----CCCCHHHH
T ss_conf             ------05787489984044367613889999986424753377527----20655---3------10----23682789


Q ss_pred             HHHHHHCCCCEEEEEECCCCCHHHHHHHHHCC--CCEEEECHHHHCCCHHHHHHHHHHHHHHH--HHCCCCCHHHHHCCC
Q ss_conf             99997408974899967889999999999839--99754527877069789999999999999--983899778961697
Q gi|254780434|r  278 AKIRQRVGPKIAIIGTGGISSTKDALDKIMAG--ANLIQLYSAMIYEGISLPKRIIQGLSDFL--NKENEVNFENIRGSY  353 (362)
Q Consensus       278 ~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aG--As~VQi~Tali~~Gp~~~~~I~~~L~~~l--~~~G~~si~e~iG~~  353 (362)
                      .++.+....-+|+||.|-|.|++|-++++.-+  -+-|+|+.+...+ |++|.+|.+.= .|=  ...-++=+.+++--.
T Consensus       445 ~e~a~~ak~~l~liGNGDi~S~eDw~~~~~~~p~v~svMIaRGALIK-PWIFtEIkeqq-~wD~sSteRldiL~df~nyG  522 (614)
T KOG2333         445 EECADKAKSALPLIGNGDILSWEDWYERLNQNPNVDSVMIARGALIK-PWIFTEIKEQQ-HWDISSTERLDILKDFCNYG  522 (614)
T ss_pred             HHHHHHCCCCCEEEECCCCCCHHHHHHHHHCCCCCCEEEEECCCCCC-CHHHHHHHHHH-CCCCCCHHHHHHHHHHHHHH
T ss_conf             99997445675267657506489998875359975447861453013-25766566653-27865058999999998622


Q ss_pred             CHHHH
Q ss_conf             52664
Q gi|254780434|r  354 TEYWA  358 (362)
Q Consensus       354 ~~~~~  358 (362)
                      ++||-
T Consensus       523 LeHWG  527 (614)
T KOG2333         523 LEHWG  527 (614)
T ss_pred             HHHCC
T ss_conf             33107


No 64 
>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism]
Probab=98.89  E-value=6.5e-08  Score=73.16  Aligned_cols=180  Identities=15%  Similarity=0.173  Sum_probs=112.4

Q ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             78877655542067552698303336532211000023432111122444556553126885178650577774888999
Q gi|254780434|r  149 FILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDI  228 (362)
Q Consensus       149 ~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~i  228 (362)
                      .+.++....+..-++.|.+     ||+--  -+..+.+.|..++..+++..        ...||.|||..   ..-+..+
T Consensus       258 KV~~~IA~~R~~~pG~~~I-----SP~pH--HDiysieDLaqlI~dLk~~~--------~~~~I~VKlva---~~~v~~i  319 (485)
T COG0069         258 KVTPEIAKTRGSPPGVGLI-----SPPPH--HDIYSIEDLAQLIKDLKEAN--------PWAKISVKLVA---EHGVGTI  319 (485)
T ss_pred             CCCHHHHHHCCCCCCCCCC-----CCCCC--CCCCCHHHHHHHHHHHHHCC--------CCCEEEEEEEC---CCCHHHH
T ss_conf             5798899761899887775-----89974--66569889999999999618--------89706999925---6556778


Q ss_pred             HHHHHHCCCCEEEEECC---CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH--HCCCCEEEEEECCCCCHHHHH
Q ss_conf             99876449829998066---5553234577544632211356454246899999997--408974899967889999999
Q gi|254780434|r  229 AVEVLSHKVEGIIVSNT---TLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQ--RVGPKIAIIGTGGISSTKDAL  303 (362)
Q Consensus       229 a~~a~~~g~dGiv~~NT---~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~--~~~~~i~IIg~GGI~s~~Da~  303 (362)
                      +..+.++++|.|++..-   |+.-+....        -..|-|+ ..++..+.+.-.  -+..++.|+..||+.|+.|+.
T Consensus       320 aagvakA~AD~I~IdG~~GGTGAsP~~~~--------~~~GiP~-e~glae~~q~L~~~glRd~v~l~~~Ggl~Tg~DVa  390 (485)
T COG0069         320 AAGVAKAGADVITIDGADGGTGASPLTSI--------DHAGIPW-ELGLAETHQTLVLNGLRDKVKLIADGGLRTGADVA  390 (485)
T ss_pred             HHHHHHCCCCEEEECCCCCCCCCCCHHHH--------HCCCCHH-HHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHH
T ss_conf             76664046988997589986787856576--------3687079-98899999999975986416999428706789999


Q ss_pred             HHHHCCCCEEEECHHHHC-CC--------------------HH----------------HHHHHHHHHHHHHHHCCCCCH
Q ss_conf             999839997545278770-69--------------------78----------------999999999999998389977
Q gi|254780434|r  304 DKIMAGANLIQLYSAMIY-EG--------------------IS----------------LPKRIIQGLSDFLNKENEVNF  346 (362)
Q Consensus       304 e~l~aGAs~VQi~Tali~-~G--------------------p~----------------~~~~I~~~L~~~l~~~G~~si  346 (362)
                      .-++.|||.|-++|+.+. .|                    |.                ++.-+.+|+.++|...|++++
T Consensus       391 ka~aLGAd~v~~gTa~lia~GCim~r~CH~~tCp~GIaTqdp~Lrkrl~~~~~~~~v~N~~~~~a~e~rella~lG~~~l  470 (485)
T COG0069         391 KAAALGADAVGFGTAALVALGCIMCRVCHTGTCPVGIATQDPELRKRLDVEGKPERVINYFTFVAEELRELLAALGKRSL  470 (485)
T ss_pred             HHHHHCCCHHHHCHHHHHHHHHHHHHHCCCCCCCCEEEECCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCH
T ss_conf             99970864552021999985338664415899975034058888763374410899999999999999999998678999


Q ss_pred             HHHHCCCCH
Q ss_conf             896169752
Q gi|254780434|r  347 ENIRGSYTE  355 (362)
Q Consensus       347 ~e~iG~~~~  355 (362)
                      +|++|..-.
T Consensus       471 ~el~g~~d~  479 (485)
T COG0069         471 SELIGRTDL  479 (485)
T ss_pred             HHHHCCHHH
T ss_conf             997454676


No 65 
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain.  GltS is a complex iron-sulfur flavoprotein that catalyzes the reductive synthesis of L-glutamate from 2-oxoglutarate and L-glutamine via intramolecular channelling of ammonia, a reaction in the plant, yeast and bacterial pathway for ammonia assimilation. It is a multifunctional enzyme that functions through three distinct active centers, carrying out  L-glutamine hydrolysis, conversion of 2-oxoglutarate into L-glutamate, and electron uptake from an electron donor.
Probab=98.84  E-value=2e-07  Score=69.85  Aligned_cols=169  Identities=17%  Similarity=0.199  Sum_probs=103.3

Q ss_pred             HHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             65554206755269830333653221100002343211112244455655312688517865057777488899999876
Q gi|254780434|r  154 VSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVL  233 (362)
Q Consensus       154 ~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~  233 (362)
                      ...++.+.++.|.+     ||+.  -.++++++.|.+++..+++.        ...+||.+|+.-.-   ...+++..+.
T Consensus       174 IA~~R~~~~G~d~i-----SP~~--h~~i~s~edl~~~I~~LR~~--------~~~kpVgvKl~~g~---~~~~l~~~~~  235 (392)
T cd02808         174 IAKIRGIPPGVDLI-----SPPP--HHDIYSIEDLAQLIEDLREA--------TGGKPIGVKLVAGH---GEGDIAAGVA  235 (392)
T ss_pred             HHHHCCCCCCCCCC-----CCCC--CCCCCCHHHHHHHHHHHHHH--------CCCCCEEEEECCCC---CHHHHHHHHH
T ss_conf             99880899998877-----9976--56669999999999999972--------89980799968889---8899999999


Q ss_pred             HCCCCEEEEECC---CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH--HCCCCEEEEEECCCCCHHHHHHHHHC
Q ss_conf             449829998066---5553234577544632211356454246899999997--40897489996788999999999983
Q gi|254780434|r  234 SHKVEGIIVSNT---TLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQ--RVGPKIAIIGTGGISSTKDALDKIMA  308 (362)
Q Consensus       234 ~~g~dGiv~~NT---~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~--~~~~~i~IIg~GGI~s~~Da~e~l~a  308 (362)
                      ..++|.|++--.   |..-+..    ..    ---|-|+.. ++..+.+.-.  -+.+++.||++||+.++.|++..+..
T Consensus       236 ~~~~DfItIDG~eGGTGAaP~~----~~----d~~GlP~~~-~l~~~~~~L~~~glr~~i~liasGgl~t~~di~kalaL  306 (392)
T cd02808         236 AAGADFITIDGAEGGTGAAPLT----FI----DHVGLPTEL-GLARAHQALVKNGLRDRVSLIASGGLRTGADVAKALAL  306 (392)
T ss_pred             HCCCCEEEEECCCCCCCCCHHH----HH----HCCCCCHHH-HHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHH
T ss_conf             6479999960799875414299----99----749973899-99999999997699676379963885747899999986


Q ss_pred             CCCEEEECHHHHCC-C--------------------H----------------HHHHHHHHHHHHHHHHCCCCCHHHH
Q ss_conf             99975452787706-9--------------------7----------------8999999999999998389977896
Q gi|254780434|r  309 GANLIQLYSAMIYE-G--------------------I----------------SLPKRIIQGLSDFLNKENEVNFENI  349 (362)
Q Consensus       309 GAs~VQi~Tali~~-G--------------------p----------------~~~~~I~~~L~~~l~~~G~~si~e~  349 (362)
                      |||+|-++|++|+- |                    |                ..++.+.+||.++|..-|++|++++
T Consensus       307 GAD~v~~a~~~m~alGCiq~~~C~~~~CP~GiaTqd~~l~~~l~~~~~a~rv~ny~~~~~~el~~~~~a~G~~~~~~l  384 (392)
T cd02808         307 GADAVGIGTAALIALGCIQARKCHTNTCPVGVATQDPELRRRLDVEGKAERVANYLKSLAEELRELAAALGKRSLELL  384 (392)
T ss_pred             CCCHHHHCHHHHHHHHCHHHHHHCCCCCCCCCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHC
T ss_conf             756451056999987479976505998996111379888414686546999999999999999999998579994788


No 66 
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only]
Probab=98.82  E-value=6.3e-08  Score=73.23  Aligned_cols=90  Identities=17%  Similarity=0.312  Sum_probs=70.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCC-CCCHHHHHHHHHHHHHCCCCE
Q ss_conf             5178650577774888999998764498299980665553234577544632211356-454246899999997408974
Q gi|254780434|r  210 VPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGS-PLFLKSTIALAKIRQRVGPKI  288 (362)
Q Consensus       210 ~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~-~i~~~al~~i~~i~~~~~~~i  288 (362)
                      ..++.+++   +    ...+..+++.|+|++++--              .+.||--|. ...+-...+|.++++.+.. +
T Consensus       128 ~~v~~~v~---~----~~~A~~~~~~G~d~vI~~g--------------~eAGGH~g~~~~~~~t~~Lv~ev~~~~~~-i  185 (336)
T COG2070         128 IKVIHSVI---T----VREALKAERAGADAVIAQG--------------AEAGGHRGGVDLEVSTFALVPEVVDAVDG-I  185 (336)
T ss_pred             CEEEEEEC---C----HHHHHHHHHCCCCEEEECC--------------CCCCCCCCCCCCCCCHHHHHHHHHHHHCC-C
T ss_conf             85898508---8----9999999817998899437--------------76778689988773188899999998548-9


Q ss_pred             EEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             899967889999999999839997545278770
Q gi|254780434|r  289 AIIGTGGISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       289 ~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      |+|+.|||.+++++...+..||+.||++|.|+.
T Consensus       186 PViAAGGI~dg~~i~AAlalGA~gVq~GT~Fl~  218 (336)
T COG2070         186 PVIAAGGIADGRGIAAALALGADGVQMGTRFLA  218 (336)
T ss_pred             CEEEECCCCCHHHHHHHHHHCCHHHHHHHHHHC
T ss_conf             789876868869999999844168554125421


No 67 
>pfam01645 Glu_synthase Conserved region in glutamate synthase. This family represents a region of the glutamate synthase protein. This region is expressed as a separate subunit in the glutamate synthase alpha subunit from archaebacteria, or part of a large multidomain enzyme in other organisms. The aligned region of these proteins contains a putative FMN binding site and Fe-S cluster.
Probab=98.81  E-value=1.9e-07  Score=69.96  Aligned_cols=147  Identities=16%  Similarity=0.218  Sum_probs=86.3

Q ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             78877655542067552698303336532211000023432111122444556553126885178650577774888999
Q gi|254780434|r  149 FILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDI  228 (362)
Q Consensus       149 ~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~i  228 (362)
                      .+.+....++.+.++.|.+     ||+.  -.++.+++.|..++..+++.        ...+||.+||.--   .....+
T Consensus       157 KVt~eIA~~R~~~~G~d~i-----SP~~--h~di~s~edL~~~I~~Lr~~--------~~~~PVgvKl~~~---~~~~~i  218 (367)
T pfam01645       157 KVSPEIARIRGSPPGVGLI-----SPPP--HHDIYSIEDLAQLIYDLKEI--------NPKAPISVKLVSG---HGVGTI  218 (367)
T ss_pred             HCCHHHHHHCCCCCCCCCC-----CCCC--CCCCCCHHHHHHHHHHHHHC--------CCCCCEEEEEECC---CCHHHH
T ss_conf             4489999680899998767-----8633--47889999999999999841--------7899459998147---768999


Q ss_pred             HHHHHHCCCCEEEEECC---CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH-HH-HHCCCCEEEEEECCCCCHHHHH
Q ss_conf             99876449829998066---5553234577544632211356454246899999-99-7408974899967889999999
Q gi|254780434|r  229 AVEVLSHKVEGIIVSNT---TLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAK-IR-QRVGPKIAIIGTGGISSTKDAL  303 (362)
Q Consensus       229 a~~a~~~g~dGiv~~NT---~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~-i~-~~~~~~i~IIg~GGI~s~~Da~  303 (362)
                      +..+.++++|.|++.-.   |..-+....+        --|-|+. .++..+.+ +. .-+.+++.||+.||+.++.|++
T Consensus       219 a~~~aka~~D~I~IdG~eGGTGAaP~~~~d--------~~GlP~~-~~L~~~~~~L~~~glR~~V~liasGgl~t~~Dv~  289 (367)
T pfam01645       219 AAGVAKAGADIILIDGHDGGTGASPKTSIK--------HAGLPWE-LALAEVHQTLVENGLRDRVSLIADGGLRTGADVA  289 (367)
T ss_pred             HHHHHCCCCCEEEECCCCCCCCCCCHHHHH--------HCCCHHH-HHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHH
T ss_conf             998753678889971789867755488997--------4424699-9999999999870675764999769978889999


Q ss_pred             HHHHCCCCEEEECHHHHCC
Q ss_conf             9998399975452787706
Q gi|254780434|r  304 DKIMAGANLIQLYSAMIYE  322 (362)
Q Consensus       304 e~l~aGAs~VQi~Tali~~  322 (362)
                      ..+..|||+|.++|++|+-
T Consensus       290 ka~aLGAD~v~~gt~~m~A  308 (367)
T pfam01645       290 KAAALGADAVYIGTAALIA  308 (367)
T ss_pred             HHHHHCCCHHHHHHHHHHH
T ss_conf             9998565354234799998


No 68 
>PRK13597 imidazole glycerol phosphate synthase subunit HisF; Provisional
Probab=98.80  E-value=3.8e-07  Score=67.98  Aligned_cols=226  Identities=15%  Similarity=0.182  Sum_probs=127.8

Q ss_pred             CCEECCCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHH
Q ss_conf             87335997485346888677988874036752410200136878998862688425554100002477777889998764
Q gi|254780434|r   50 AGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSK  129 (362)
Q Consensus        50 ~Gl~~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~  129 (362)
                      -|..|.+....  | | -.+..+.|.+.|+-.+.+=-+                  +.+.        .|-....+-+++
T Consensus        20 kg~~~~~~~~~--g-d-P~~~a~~~~~~Gad~lhlvDl------------------d~a~--------~~~~~n~~~I~~   69 (252)
T PRK13597         20 KGVNFVNLRDA--G-D-PVEAARAYDEAGADELVFLDI------------------SATH--------EERAILLDVVAR   69 (252)
T ss_pred             ECCCCCCCEEC--C-C-HHHHHHHHHHCCCCEEEEEEC------------------CCCC--------CCCHHHHHHHHH
T ss_conf             78777786788--8-9-999999999869999999956------------------4666--------686637999999


Q ss_pred             HHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH--CC
Q ss_conf             1000121000110454246788776555420675526983033365322110000234321111224445565531--26
Q gi|254780434|r  130 IQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIK--TG  207 (362)
Q Consensus       130 ~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~--~~  207 (362)
                      .....-+-+.+|+.--+.+.++      +.+..+||-+.||=..        +.+++.+.++....-.........  ..
T Consensus        70 i~~~~~vpiqvGGGIrs~e~~~------~ll~~GadkViigS~a--------~~np~~i~~~~~~fG~q~Iv~~iD~~~~  135 (252)
T PRK13597         70 VAERVFIPLTVGGGVRSLEDAR------KLLLSGADKVSVNSAA--------VRRPELIRELADHFGAQAVVLAIDARWR  135 (252)
T ss_pred             HHHHCCCCEEEECCCCCHHHHH------HHHHCCCCEEEECHHH--------HHCCHHHHHHHHHCCCCCEEEEEEEEEC
T ss_conf             9862698289847713089999------9985698779832666--------7493789999987499652999988861


Q ss_pred             CCCE-EEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             8851-786505777748889999987644982999806655532345775446322113564542468999999974089
Q gi|254780434|r  208 KFVP-IFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGP  286 (362)
Q Consensus       208 ~~~P-i~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~  286 (362)
                      ...+ ++++-.-..+.-...+.+....+.|+..+++++  ++|+++           +.|+-     +++++++++.+  
T Consensus       136 ~~~~~v~~~~~~~~~~~~~~d~~~~~~~~G~geil~td--I~rDGt-----------~~G~d-----~~l~~~i~~~~--  195 (252)
T PRK13597        136 GDFPEVHVAGGRVPTGLHAVEWAVKGVELGAGEILLTS--MDRDGT-----------KEGYD-----LRLTRMVAEAV--  195 (252)
T ss_pred             CCCCEEEECCCEEECCCCHHHHHHHHHHHCCCEEEEEE--ECCCCC-----------CCCCC-----HHHHHHHHHCC--
T ss_conf             89741675387275697699999999964899999975--737684-----------44769-----59999998507--


Q ss_pred             CEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             7489996788999999999983999754527877069789999999999999983899
Q gi|254780434|r  287 KIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEV  344 (362)
Q Consensus       287 ~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~  344 (362)
                      ++|+|++|||.+.+|..+...+|++.|-++++|.+....     ..+++++|..+|+.
T Consensus       196 ~~pvIasGGv~s~~dl~~l~~~g~~gvi~G~al~~~~~s-----~~e~k~~L~~~~i~  248 (252)
T PRK13597        196 GVPVIASGGAGRMEHFLEAFQAGAEAALAASVFHFGEIP-----IPELKRYLAEKGVH  248 (252)
T ss_pred             CCCEEEECCCCCHHHHHHHHHCCCCEEEEHHHHHCCCCC-----HHHHHHHHHHCCCC
T ss_conf             998999789899999999987899699871276779999-----99999999987895


No 69 
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional
Probab=98.78  E-value=4.4e-06  Score=60.82  Aligned_cols=242  Identities=15%  Similarity=0.161  Sum_probs=134.5

Q ss_pred             CCCCCCCCEEEECCEECCCCEEECCCCCC--CHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCC
Q ss_conf             67889631168887335997485346888--6779888740367524102001368789988626884255541000024
Q gi|254780434|r   38 PVHSDPRLNTKVAGISLSNPLGMAAGYDK--NAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGF  115 (362)
Q Consensus        38 ~~~~~~~L~~~~~Gl~~~nPiglAaG~dk--~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl  115 (362)
                      ..+++.++++++...+|+=|| +||-.|.  +.++...+.++|.=.+                 ++|+.           
T Consensus        20 ~SRseVd~s~~~~~~~~~iPI-iaAnMDTV~~~~mA~~l~k~Gglgv-----------------LHR~~-----------   70 (326)
T PRK05458         20 NSRSECDTSVTLGPRTFKLPV-VPANMQTIIDEKIAEWLAENGYFYI-----------------MHRFD-----------   70 (326)
T ss_pred             CCHHHCEEEEEECCCCCCCCE-EECCCCCCCCHHHHHHHHHCCCEEE-----------------EEECC-----------
T ss_conf             887884367985685227888-8589897488899999997898689-----------------98558-----------


Q ss_pred             CCCCHHHHHHHHHHHHH-CCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             77777889998764100-01210001104542467887765554206755269830333653221100002343211112
Q gi|254780434|r  116 NNAGYHTVFSRLSKIQP-TSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIH  194 (362)
Q Consensus       116 ~N~G~~~~~~~l~~~~~-~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~  194 (362)
                          .+...+.+++.+. +....+|+|.+   ++.++....+. .....+|++.+-+.  |.       ....+.+.+..
T Consensus        71 ----~e~~~~~~~~~~~~~~~~~iSvGi~---~~~~~~i~~l~-~~~~~~~~i~iDvA--hG-------~~~~~~~~i~~  133 (326)
T PRK05458         71 ----PEARIPFIKDMHERGLIASISVGVK---DDEYDFIDQLA-AEGLTPEYITIDIA--HG-------HSDSVINMIKH  133 (326)
T ss_pred             ----HHHHHHHHHHCCCCCCEEEEEECCC---HHHHHHHHHHH-HCCCCCCEEEEECC--CC-------CHHHHHHHHHH
T ss_conf             ----8999999985232372799994799---89999999998-56999777999805--64-------42899999999


Q ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             24445565531268851786505777748889999987644982999806655532345775446322113564542468
Q gi|254780434|r  195 VMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKST  274 (362)
Q Consensus       195 v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al  274 (362)
                      +   +.     ...+++|++-   |...   .+.++.+.++|+|+|-+.=--++   .++-....   |. |.|-  .-+
T Consensus       134 i---k~-----~~~~~~iiaG---NVaT---~e~~~~L~~~Gad~VkVGIG~Gs---~CTTR~~t---Gv-G~p~--~q~  190 (326)
T PRK05458        134 I---KK-----HLPETFVIAG---NVGT---PEAVRELENAGADATKVGIGPGK---VCITKIKT---GF-GTGG--WQL  190 (326)
T ss_pred             H---HH-----HCCCCCEEEC---CCCC---HHHHHHHHHCCCCEEEECCCCCC---CCCCCCCC---CC-CCCH--HHH
T ss_conf             9---98-----7899839965---4318---99999999749999996777987---52035013---54-7758--999


Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC--CCH----------------------------
Q ss_conf             99999997408974899967889999999999839997545278770--697----------------------------
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY--EGI----------------------------  324 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~--~Gp----------------------------  324 (362)
                      ..|.+..+..  +.|||+-|||.+.-|+.+.|.+|||+|++++-|.-  |-|                            
T Consensus       191 sai~~ca~~~--~~~iiaDGGi~~~GDi~KAla~GAd~VM~G~~~Ag~~EspG~~~~~~g~~~k~y~Gmas~~~~~~~~~  268 (326)
T PRK05458        191 AALRWCAKAA--RKPIIADGGIRTHGDIAKSIRFGATMVMIGSLFAGHEESPGETVEIDGKLYKEYFGSASEFQKGEYKN  268 (326)
T ss_pred             HHHHHHHHHH--CCCEEEECCCCCCCHHHHHHHCCCCEEEECCHHCCCCCCCCCEEEECCEEEEEEECCCCHHHCCCCCC
T ss_conf             9999999972--79779736858747899998648988986712237777997179789979999874677534788457


Q ss_pred             ---------------HHHHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             ---------------89999999999999983899778961
Q gi|254780434|r  325 ---------------SLPKRIIQGLSDFLNKENEVNFENIR  350 (362)
Q Consensus       325 ---------------~~~~~I~~~L~~~l~~~G~~si~e~i  350 (362)
                                     .++.+|..+|+.-|.--|.++|.|+.
T Consensus       269 ~EG~~~~vp~kG~v~~~~~~l~gglrS~m~Y~Ga~~i~el~  309 (326)
T PRK05458        269 VEGKKILVPHKGSLKDTLTEMQQDLQSSISYAGGKDLDAIR  309 (326)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHC
T ss_conf             88748987368888999999988877633375888688961


No 70 
>PRK06843 inositol-5-monophosphate dehydrogenase; Validated
Probab=98.75  E-value=1.5e-06  Score=63.97  Aligned_cols=235  Identities=17%  Similarity=0.267  Sum_probs=113.3

Q ss_pred             CCCCCCEEEEC-CEECCCCEEECCCCCC--CHHHHHHHHHCC-CCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECC-
Q ss_conf             88963116888-7335997485346888--677988874036-752410200136878998862688425554100002-
Q gi|254780434|r   40 HSDPRLNTKVA-GISLSNPLGMAAGYDK--NAEVPIELLKLG-FGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLG-  114 (362)
Q Consensus        40 ~~~~~L~~~~~-Gl~~~nPiglAaG~dk--~~~~~~~l~~~G-~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~G-  114 (362)
                      .++.+|++++. +++|.-|| +||-.|+  +.++--.+..+| .|.+ -+-.+.+.|.-..+ ++.++. -...+|... 
T Consensus        26 p~dVdlst~lt~~i~l~iPi-vSs~MDTVte~~mAiama~~GGlGVi-Hrn~~ie~q~~~v~-~Vk~~~-~~~~~~~~~d  101 (404)
T PRK06843         26 PSEVSLKTQLTKNISLNIPF-LSSAMDTVTESQMAIAIAKEGGIGII-HKNMSIEAQKKEIE-KVKTYK-FQKTINTNKD  101 (404)
T ss_pred             HHHCEEEEEEECCEECCCCE-EECCCCCCCCHHHHHHHHHCCCEEEE-CCCCCHHHHHHHHH-HHHHCC-CCCEEECCCC
T ss_conf             66706768972881659987-84688777889999999988988999-18899999999998-874112-4641202654


Q ss_pred             --------------CCCCCHHHHHHHHHH-------HHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCC
Q ss_conf             --------------477777889998764-------10001210001104542467887765554206755269830333
Q gi|254780434|r  115 --------------FNNAGYHTVFSRLSK-------IQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISS  173 (362)
Q Consensus       115 --------------l~N~G~~~~~~~l~~-------~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSC  173 (362)
                                    +...-.....++.+.       ......+++.|+..   .+..+....   .+..++|+|.|..+-
T Consensus       102 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~p~a~~d~~~rl~VgAAVg~~---~d~~era~~---Lv~AGvD~lvID~Ah  175 (404)
T PRK06843        102 TNEQKTKMLTAKQHLEESKIYKNAEHKEDFPNACKDLNSKLRVGAAVSID---IDTIERVEE---LVKAHVDILVIDSAH  175 (404)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEECCC---HHHHHHHHH---HHHCCCCEEEEECCC
T ss_conf             32024566658765223244441676644134455432467689995468---528999999---997699999996887


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCC-C
Q ss_conf             653221100002343211112244455655312688517865057777488899999876449829998066555323-4
Q gi|254780434|r  174 PNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKG-V  252 (362)
Q Consensus       174 PNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~-~  252 (362)
                      -|         ...+.+.+..++.        ....+||++-   |..+   .+-+..+.++|+|||.+.=-    ++ .
T Consensus       176 Gh---------s~~~~e~ik~ik~--------~~p~v~VIaG---NVaT---~~~a~~Li~aGAD~VkVGiG----pGsi  228 (404)
T PRK06843        176 GH---------STRIIELVKTIKN--------KYPNLDLIAG---NIVT---KEAALDLINVGADCLKVGIG----PGSI  228 (404)
T ss_pred             CC---------HHHHHHHHHHHHH--------HCCCCCEEEC---CCCC---HHHHHHHHHHCCCEEEECCC----CCCC
T ss_conf             52---------1789999999997--------6799616630---3057---99999999819899995654----7877


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH-CCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHH
Q ss_conf             5775446322113564542468999999974-089748999678899999999998399975452787
Q gi|254780434|r  253 QCSDNHEQDGGLSGSPLFLKSTIALAKIRQR-VGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAM  319 (362)
Q Consensus       253 ~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~-~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tal  319 (362)
                      ++.....   |. |.|   . +-.|.++++. -+..+|||+-|||.+.-|+.+-|.+|||+|++++.|
T Consensus       229 CTTr~v~---Gv-GvP---q-~tAi~d~~~~a~~~~v~IIADGGI~~sGDi~KAlA~GAdaVMlGs~l  288 (404)
T PRK06843        229 CTTRIVA---GV-GVP---Q-ITAICDVYEVCKNTNICIIADGGIRFSGDVVKAIAAGADSVMIGNLF  288 (404)
T ss_pred             CCCCCCC---CC-CCC---H-HHHHHHHHHHHHCCCCCEEECCCCCCCCHHHHHHHCCCCEEEECCHH
T ss_conf             2566545---86-874---8-99999999996057997883687465327999997189888867131


No 71 
>PRK05567 inositol-5'-monophosphate dehydrogenase; Reviewed
Probab=98.74  E-value=5e-06  Score=60.43  Aligned_cols=128  Identities=18%  Similarity=0.234  Sum_probs=70.3

Q ss_pred             HHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             20675526983033365322110000234321111224445565531268851786505777748889999987644982
Q gi|254780434|r  159 LFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVE  238 (362)
Q Consensus       159 ~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~d  238 (362)
                      .+..++|++.|..+-=|        . +..   ++.+...+     +....+||++-=   ..+   .+.++.+.++|+|
T Consensus       236 Lv~AGvDvivIDtAhGh--------s-~~v---i~~ik~ik-----~~~~~v~viaGN---v~T---~~~a~~L~~aGaD  292 (486)
T PRK05567        236 LVKAGVDVLVVDTAHGH--------S-EGV---LDRVREIK-----AKYPDVQIIAGN---VAT---AEAARALIEAGAD  292 (486)
T ss_pred             HHHCCCCEEEEECCCCC--------H-HHH---HHHHHHHH-----HCCCCCCEEEEE---ECH---HHHHHHHHHCCCC
T ss_conf             99769988995044521--------5-778---99999997-----407877368751---201---9999999972987


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHH
Q ss_conf             99980665553234577544632211356454246899999997408974899967889999999999839997545278
Q gi|254780434|r  239 GIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSA  318 (362)
Q Consensus       239 Giv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Ta  318 (362)
                      +|-+.=-.++   +++...   .-|. |.|- -.+...++...+..  .+|||+-|||.+.-|+.+-|.+|||+|++++.
T Consensus       293 ~vkVGiG~Gs---iCtTr~---v~Gv-GvPq-~tAv~~~a~~a~~~--~v~iIADGGi~~sGdi~KAla~GAd~VMlGs~  362 (486)
T PRK05567        293 AVKVGIGPGS---ICTTRI---VAGV-GVPQ-ITAIADAAEAAKKT--GIPVIADGGIRYSGDIAKALAAGASAVMLGSM  362 (486)
T ss_pred             EEEECCCCCC---CCCCCC---CCCC-CCCH-HHHHHHHHHHHHHC--CCEEEECCCCCCCCHHHHHHHCCCCEEEECCH
T ss_conf             6996566886---651343---2477-8646-99999999999865--97799648835435799998658988986612


Q ss_pred             H
Q ss_conf             7
Q gi|254780434|r  319 M  319 (362)
Q Consensus       319 l  319 (362)
                      |
T Consensus       363 l  363 (486)
T PRK05567        363 L  363 (486)
T ss_pred             H
T ss_conf             1


No 72 
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional
Probab=98.73  E-value=8.7e-06  Score=58.81  Aligned_cols=160  Identities=17%  Similarity=0.248  Sum_probs=90.1

Q ss_pred             HCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             06755269830333653221100002343211112244455655312688517865057777488899999876449829
Q gi|254780434|r  160 FFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEG  239 (362)
Q Consensus       160 ~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dG  239 (362)
                      +..++|++.|..+--|..         ...   +.++..+     +....+||++-   |..+   .+-++.+.++|+||
T Consensus       247 v~aGvDvlvIDtAhGhs~---------~v~---~~ik~ik-----~~~p~v~vIaG---NVaT---~~~a~~Li~aGAD~  303 (499)
T PTZ00314        247 IDAGVDVLVLDSSQGNSI---------YQI---DFIKWIK-----STYPHLEVIAG---NVVT---QDQAKNLIDAGADG  303 (499)
T ss_pred             HHCCCCEEEEECCCCCCH---------HHH---HHHHHHH-----HHCCCCCEEEE---EECH---HHHHHHHHHCCCCE
T ss_conf             986998999816887727---------899---9999988-----52798846764---3310---99999999749987


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHH
Q ss_conf             99806655532345775446322113564542468999999974089748999678899999999998399975452787
Q gi|254780434|r  240 IIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAM  319 (362)
Q Consensus       240 iv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tal  319 (362)
                      |-+.=-.++   +++...-.   |. |.|- -.+...++...+.  ..+|||+-|||.+.-|+.+-|.+|||+|+++|-|
T Consensus       304 vkVGiGpGS---iCTTR~v~---Gv-GvPq-~tAv~~~a~~a~~--~gvpiIADGGIr~sGDi~KAlAaGAd~VMlGsll  373 (499)
T PTZ00314        304 IRIGMGSGS---ICTTQEVC---AV-GRPQ-ATAVYKVARYAHS--RGVPCIADGGIRSSGDIVKALALGASCVMLGSML  373 (499)
T ss_pred             EEECCCCCC---CCCCCCCC---CC-CCCH-HHHHHHHHHHHCC--CCCEEEECCCCCCHHHHHHHHHCCCCEEEECCCC
T ss_conf             997535885---51046434---66-7860-5679999998644--9985991478464318999987289878608410


Q ss_pred             H-------------------CCCH----------------------------------------HHHHHHHHHHHHHHHH
Q ss_conf             7-------------------0697----------------------------------------8999999999999998
Q gi|254780434|r  320 I-------------------YEGI----------------------------------------SLPKRIIQGLSDFLNK  340 (362)
Q Consensus       320 i-------------------~~Gp----------------------------------------~~~~~I~~~L~~~l~~  340 (362)
                      .                   |+|.                                        .++..+..+|+.-|.-
T Consensus       374 AGt~EsPGe~~~~~G~~yK~YRGMgS~~Am~~~~gs~~ry~~~~~~~~v~EGveg~vp~kG~v~~~l~ql~gGlrs~m~Y  453 (499)
T PTZ00314        374 AGTEETPGEYFFKNGVRLKKYRGMGSLEAMSQGKGSGSRYLSEEEKIQVAQGVSGSVVDKGSVLKLIPYLTKGVKHGAQD  453 (499)
T ss_pred             CCCCCCCCCEEEECCEEEEEEEECCHHHHHHHCCCCCCHHHHHHCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             47677997289999999999971043999974446630011210367477767798666887899999998587640417


Q ss_pred             CCCCCHHHHHCC
Q ss_conf             389977896169
Q gi|254780434|r  341 ENEVNFENIRGS  352 (362)
Q Consensus       341 ~G~~si~e~iG~  352 (362)
                      -|-.||+|+.-+
T Consensus       454 ~Ga~~i~el~~k  465 (499)
T PTZ00314        454 IGEISIDALREK  465 (499)
T ss_pred             CCCCCHHHHHHH
T ss_conf             687869999864


No 73 
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative; InterPro: IPR005270    The function of this family is unknown, but it may include TIM-barrel proteins..
Probab=98.71  E-value=1.5e-07  Score=70.60  Aligned_cols=218  Identities=18%  Similarity=0.214  Sum_probs=144.8

Q ss_pred             CCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCE--EEEECCCCCEEECCCCCCCHHHHHHHHHHHHH-CCCCCC
Q ss_conf             468886779888740367524102001368789988626--88425554100002477777889998764100-012100
Q gi|254780434|r   62 AGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRV--FRLTKDRAIINKLGFNNAGYHTVFSRLSKIQP-TSPIGI  138 (362)
Q Consensus        62 aG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~--~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~-~~pi~v  138 (362)
                      ||. .|+|...++-+.||.-|++|..-..-++ ...-|.  -|-. .+..+|--+|++    ++.+..++.+. +.-+.|
T Consensus         2 AGi-~daeFCrK~k~y~f~~V~lGGyNaDr~t-~~A~r~i~kRGR-kEF~f~~~e~~s----~I~~~~~~~~Esr~~v~V   74 (234)
T TIGR00736         2 AGI-SDAEFCRKLKDYLFALVTLGGYNADRET-LKAARKIEKRGR-KEFSFDLEELES----IIKKEAKKIKESRAKVAV   74 (234)
T ss_pred             CCC-CCHHHHHHHHHHHCEEEEECCCCHHHHH-HHHHHHHHHCCC-CCCCCCCCHHHH----HHHHHHHHHHHCCCEEEE
T ss_conf             988-5245554443411003122563033899-998999985589-400125322457----888766764220352578


Q ss_pred             EEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCC---C---CCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             0110454246788776555420675526983033365---3---221100002343211112244455655312688517
Q gi|254780434|r  139 NLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPN---T---PGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPI  212 (362)
Q Consensus       139 sI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPN---t---~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi  212 (362)
                      |+-..     .++++.........++|.+|||=-|=-   |   -|-..|.+++.|.++++.+...         ...|+
T Consensus        75 nVr~~-----~le~~~~v~~~~ae~~diiEiNaHCRQPEiteiG~Gq~ll~n~e~L~ef~~k~~G~---------~~~p~  140 (234)
T TIGR00736        75 NVRIS-----DLEEELDVELLVAEFADIIEINAHCRQPEITEIGIGQELLKNKELLKEFVAKVKGK---------LRKPV  140 (234)
T ss_pred             EEEEE-----CCHHHHHHHHHHHHHCCEEEECCCCCCCCEEEECCCHHHHCCCHHHHHHHHHHCCC---------CCCCE
T ss_conf             86530-----00045677665421137378857588976155056535423802578887530343---------14723


Q ss_pred             EEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             86505777748889999987644982999806655532345775446322113564542468999999974089748999
Q gi|254780434|r  213 FLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIG  292 (362)
Q Consensus       213 ~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg  292 (362)
                      |||+--|...-+...++..+...|+|+|.+            +...++      .+-.  =+..|..+.+..++++ |||
T Consensus       141 fvKIRgN~~~ld~~~~a~~l~d~g~d~iHv------------Dam~PG------~~~a--D~~l~~~~se~~nD~I-~IG  199 (234)
T TIGR00736       141 FVKIRGNVIKLDELKVARKLVDAGVDAIHV------------DAMKPG------EDRA--DLDLVKLVSEVKNDKI-VIG  199 (234)
T ss_pred             EEEECCCCCCCCHHHHHHHHHHHCCCEEEE------------EEECCC------CCCC--CHHHHHHHHHHCCCEE-EEE
T ss_conf             789715787510357878988732355554------------322593------6936--7899999887618857-980


Q ss_pred             ECCCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             67889999999999839997545278770
Q gi|254780434|r  293 TGGISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       293 ~GGI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      ---|.+=|.|-++|++|||+|-+..+.+.
T Consensus       200 NNS~~dIE~a~~~l~aGad~vSvARa~l~  228 (234)
T TIGR00736       200 NNSVDDIESAKEMLKAGADAVSVARAVLK  228 (234)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             68710368899999840158999999861


No 74 
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional
Probab=98.70  E-value=2.3e-05  Score=55.95  Aligned_cols=243  Identities=15%  Similarity=0.189  Sum_probs=126.1

Q ss_pred             CCCCCCCEEEEC----CEEC-CCCEEECCCCCC--CHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEE
Q ss_conf             788963116888----7335-997485346888--677988874036752410200136878998862688425554100
Q gi|254780434|r   39 VHSDPRLNTKVA----GISL-SNPLGMAAGYDK--NAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIIN  111 (362)
Q Consensus        39 ~~~~~~L~~~~~----Gl~~-~nPiglAaG~dk--~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN  111 (362)
                      .+++.+|++++-    +..+ .=|| +||-.|+  +.++...+...|.  +.               .++|.-       
T Consensus        25 SRseV~l~~~~~f~~s~~~~~gIPI-IaAnMDTV~~~~MA~~L~k~Gg--l~---------------vLHR~~-------   79 (347)
T PRK05096         25 SRSEVELERQFTFKHSGQSWSGVPI-IAANMDTVGTFEMAKALASFDI--LT---------------AVHKHY-------   79 (347)
T ss_pred             CHHHEEEEEEEEECCCCCCCCCCCE-EECCCCCCCCHHHHHHHHHCCC--EE---------------EEECCC-------
T ss_conf             8302366788853357774468857-9678887285899999998798--58---------------984379-------


Q ss_pred             ECCCCCCCHHHHHHHHHHHHHC--CCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHH
Q ss_conf             0024777778899987641000--12100011045424678877655542067552698303336532211000023432
Q gi|254780434|r  112 KLGFNNAGYHTVFSRLSKIQPT--SPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLE  189 (362)
Q Consensus       112 ~~Gl~N~G~~~~~~~l~~~~~~--~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~  189 (362)
                             -.+.+.+.+++....  .-+.+++|-+   ++.++.... +.+..+.+|++.|.+.-=|         .+.+ 
T Consensus        80 -------~~ee~~~~~~~~~~~~~~~v~vsiGi~---~~d~~r~~~-i~~~~~~~~~i~iDvA~G~---------~~~~-  138 (347)
T PRK05096         80 -------SVEEWAAFINNSSADVLKHVMVSTGTS---DADFEKTKQ-ILALSPALNFICIDVANGY---------SEHF-  138 (347)
T ss_pred             -------CHHHHHHHHHHCCCCCCCEEEEEEECC---HHHHHHHHH-HHHCCCCCCEEEEECCCCC---------CHHH-
T ss_conf             -------899999998521434467389999178---789999999-9952899898999779862---------0889-


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCC-CCCCCCCCCCCCCCCCC
Q ss_conf             11112244455655312688517865057777488899999876449829998066555323-45775446322113564
Q gi|254780434|r  190 RLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKG-VQCSDNHEQDGGLSGSP  268 (362)
Q Consensus       190 ~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~-~~~~~~~~~~GGlSG~~  268 (362)
                        ++.+...+.     .....+|++-   |...   .+-++.+.++|+|+|-+.=-    ++ .+......+.    |.|
T Consensus       139 --~~~i~~ik~-----~~~~~~iiaG---NvaT---~e~~~~L~~~GaD~vkVGIG----~Gs~CtTR~~tGv----G~P  197 (347)
T PRK05096        139 --VQFVAKARE-----AWPDKTICAG---NVVT---GEMVEELILSGADIVKVGIG----PGSVCTTRVKTGV----GYP  197 (347)
T ss_pred             --HHHHHHHHH-----HCCCCEEECC---CHHH---HHHHHHHHHCCCCEEEECCC----CCCCCCCCCCCCC----CCH
T ss_conf             --999999998-----7899808814---3123---99999999737889997677----8754304522356----730


Q ss_pred             CCHHHHHHHHHHHHHC-CCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC--CCH---------------------
Q ss_conf             5424689999999740-8974899967889999999999839997545278770--697---------------------
Q gi|254780434|r  269 LFLKSTIALAKIRQRV-GPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY--EGI---------------------  324 (362)
Q Consensus       269 i~~~al~~i~~i~~~~-~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~--~Gp---------------------  324 (362)
                      -    +..|.+.++.. +-..+||+-|||.+.-|+.+-+.||||+|++++-|.=  |-|                     
T Consensus       198 q----~sai~~c~~~~~~~~~~iiaDGGi~~~gDi~KAla~GAd~VM~G~~lAg~~EspG~~~~~~g~~~k~y~Gm~S~~  273 (347)
T PRK05096        198 Q----LSAVIECADAAHGLGGMIVSDGGCTVPGDVAKAFGGGADFVMLGGMLAGHEESGGEVVEENGEKFMLFYGMSSES  273 (347)
T ss_pred             H----HHHHHHHHHHHHCCCCCEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEEECCEEEEEEECCCHHH
T ss_conf             3----789999999860579948956884750479999873898898673103777799618958997999995767198


Q ss_pred             -----------------------------HHHHHHHHHHHHHHHHCCCCCHHHHHCC
Q ss_conf             -----------------------------8999999999999998389977896169
Q gi|254780434|r  325 -----------------------------SLPKRIIQGLSDFLNKENEVNFENIRGS  352 (362)
Q Consensus       325 -----------------------------~~~~~I~~~L~~~l~~~G~~si~e~iG~  352 (362)
                                                   .++.++..+|+.-|.--|..+|.|+.-.
T Consensus       274 a~~~~~g~~~~~~~~EG~~~~vp~kG~v~~~l~~l~gglrS~m~Y~Ga~~l~el~~~  330 (347)
T PRK05096        274 AMDRHVGGVAEYRAAEGKTVKLPLRGPVENTARDILGGLRSACTYVGASRLKELTKR  330 (347)
T ss_pred             HHHHHCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHC
T ss_conf             887643887754268850899727889899999999898773327587759999758


No 75 
>PRK03220 consensus
Probab=98.68  E-value=1.2e-06  Score=64.72  Aligned_cols=226  Identities=14%  Similarity=0.129  Sum_probs=124.5

Q ss_pred             CCEECCCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHH
Q ss_conf             87335997485346888677988874036752410200136878998862688425554100002477777889998764
Q gi|254780434|r   50 AGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSK  129 (362)
Q Consensus        50 ~Gl~~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~  129 (362)
                      -|..|.+..-.  | | -.++.+.+.+.|+..+.+=-+  ..                +.-        |.....+-+++
T Consensus        20 kg~~~~~~~~~--g-d-P~~~a~~~~~~G~d~lhivDl--d~----------------a~~--------g~~~n~~~I~~   69 (257)
T PRK03220         20 KGVNFENLRDA--G-D-PVELAAVYDAEGADELTFLDV--TA----------------SSS--------GRATMLDVVRR   69 (257)
T ss_pred             ECCCCCCCEEC--C-C-HHHHHHHHHHCCCCEEEEEEC--CC----------------CCC--------CCHHHHHHHHH
T ss_conf             57777786788--8-9-999999999869998999908--88----------------756--------76307999999


Q ss_pred             HHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCC--
Q ss_conf             100012100011045424678877655542067552698303336532211000023432111122444556553126--
Q gi|254780434|r  130 IQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTG--  207 (362)
Q Consensus       130 ~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~--  207 (362)
                      .....-+-+.+|+.--+.+.++.      .+..+||-+.+|=.        .+.+++.+.++.+..-...........  
T Consensus        70 i~~~~~~pi~vGGGIrs~e~~~~------ll~~GadkVvigs~--------a~~~p~~~~~~~~~fG~q~Iv~siD~k~~  135 (257)
T PRK03220         70 TAEQVFIPLTVGGGVRTVEDVDS------LLRAGADKVSVNTA--------AIARPELLAELARRFGSQCIVLSVDARRV  135 (257)
T ss_pred             HHHCCCCCEEEECCCCCHHHHHH------HHHCCCCEEECHHH--------HHHCCHHHHHHHHHCCCEEEEEEEEEEEC
T ss_conf             98506964898478587999999------99819750872066--------77594777899987098669999998862


Q ss_pred             --------CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             --------885178650577774888999998764498299980665553234577544632211356454246899999
Q gi|254780434|r  208 --------KFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAK  279 (362)
Q Consensus       208 --------~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~  279 (362)
                              ....++.+=.-..+.-++.+.++.+++.|+..+++++  ++++++           ++|+-     ++.+++
T Consensus       136 ~~~~~~~~~g~~v~~~g~~~~t~~~~~~~i~~~~~~g~geil~td--I~rDGt-----------~~G~d-----~~l~~~  197 (257)
T PRK03220        136 PVGSAPTPSGFEVTTHGGRRGTGIDAVEWAARGAELGVGEILLNS--MDADGT-----------KAGFD-----LEMLRA  197 (257)
T ss_pred             CCCCCCCCCCEEEEECCCEEECCCCHHHHHHHHHHCCCCEEEEEE--ECCCCC-----------CCCCC-----HHHHHH
T ss_conf             567743468749997288260287599999998626988899998--868660-----------23789-----699999


Q ss_pred             HHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99740897489996788999999999983999754527877069789999999999999983899
Q gi|254780434|r  280 IRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEV  344 (362)
Q Consensus       280 i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~  344 (362)
                      +++.+  ++|+|++|||.+.+|..+.+..|+++|-++++|.+. -.-+    .+++++|+..||.
T Consensus       198 i~~~~--~~piIasGGv~s~~di~~l~~~g~~gv~~g~a~~~~-~~s~----~~~k~~l~~~~i~  255 (257)
T PRK03220        198 VRAAV--TVPVIASGGAGAVEHFAPAVAAGADAVLAASVFHFG-ELTI----GQVKAALAAAGIT  255 (257)
T ss_pred             HHHHC--CCCEEEECCCCCHHHHHHHHHCCCCEEEEHHHHHCC-CCCH----HHHHHHHHHCCCC
T ss_conf             99748--999899878999999999997899799874687889-9889----9999999987597


No 76 
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS). NPD is part of the nitroalkaneoxidizing enzyme family, that catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDPs are members of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative  electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.
Probab=98.66  E-value=1.4e-06  Score=64.07  Aligned_cols=155  Identities=17%  Similarity=0.199  Sum_probs=91.8

Q ss_pred             CHHHHHHHHHHHHH---CCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             77889998764100---012100011045424678877655542067552698303336532211000023432111122
Q gi|254780434|r  119 GYHTVFSRLSKIQP---TSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHV  195 (362)
Q Consensus       119 G~~~~~~~l~~~~~---~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v  195 (362)
                      ..|.+.+.+++.+.   +.|.+|||....+.. ..++..+.+.+..  .+++.+--..|           .....    +
T Consensus        38 ~~e~lr~eI~k~r~~ltdkPFGVNi~~~~p~~-~~~~~~~vi~e~k--v~vv~~agG~P-----------~~~~~----L   99 (320)
T cd04743          38 RGEQVKALLEETAELLGDKPWGVGILGFVDTE-LRAAQLAVVRAIK--PTFALIAGGRP-----------DQARA----L   99 (320)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCEEEEEEECCCC-CHHHHHHHHHCCC--CCEEEECCCCC-----------HHHHH----H
T ss_conf             98999999999999825998445575138872-2578888886169--98999568890-----------78799----9


Q ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC----CCCCH
Q ss_conf             44455655312688517865057777488899999876449829998066555323457754463221135----64542
Q gi|254780434|r  196 MQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSG----SPLFL  271 (362)
Q Consensus       196 ~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG----~~i~~  271 (362)
                      .          ...+.++..++   +    ..+++.+++.|+|+|++-.+              +.||--|    -+|-|
T Consensus       100 k----------~aGikvi~~V~---S----v~lAk~~~~~GaDavIaEG~--------------EaGGHiG~~~Tm~Lvp  148 (320)
T cd04743         100 E----------AIGISTYLHVP---S----PGLLKQFLENGARKFIFEGR--------------ECGGHVGPRSSFVLWE  148 (320)
T ss_pred             H----------HCCCEEEEECC---C----HHHHHHHHHCCCCEEEEECC--------------CCCCCCCCCCHHHHHH
T ss_conf             9----------86997999779---9----99999999849999999574--------------5767767530134059


Q ss_pred             HHHHHHHHHH-HHCCCCEEEEEECCCCCHHHHHHHHHCCCC--------EEEECHHHHCC
Q ss_conf             4689999999-740897489996788999999999983999--------75452787706
Q gi|254780434|r  272 KSTIALAKIR-QRVGPKIAIIGTGGISSTKDALDKIMAGAN--------LIQLYSAMIYE  322 (362)
Q Consensus       272 ~al~~i~~i~-~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs--------~VQi~Tali~~  322 (362)
                      ..++.+...- ..-..++|+|+.|||.+++.+...+..||.        -||++|.|++-
T Consensus       149 qvvdav~~~~~~~~~~~IPViaAGGI~DGRg~aaa~aLgA~~a~~g~~~GVqmGTrfl~t  208 (320)
T cd04743         149 SAIDALLAANGPDKAGKIHLLFAGGIHDERSAAMVSALAAPLAERGAKVGVLMGTAYLFT  208 (320)
T ss_pred             HHHHHHHCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHCCCHHHCCCCCEEEEECHHHCC
T ss_conf             898898603566556787489976745618999999838842231562227860441101


No 77 
>PRK08649 inositol-5-monophosphate dehydrogenase; Validated
Probab=98.66  E-value=1.7e-06  Score=63.54  Aligned_cols=269  Identities=18%  Similarity=0.252  Sum_probs=134.0

Q ss_pred             CCCCCCEEEECCEECCCCEEECCCCCC--CHHHHHHHHHC-CCCEEECC-CCCCCCCCCCCCCCEEE---EECCCCC--E
Q ss_conf             889631168887335997485346888--67798887403-67524102-00136878998862688---4255541--0
Q gi|254780434|r   40 HSDPRLNTKVAGISLSNPLGMAAGYDK--NAEVPIELLKL-GFGFVEIG-TVTPHPQAGNPRPRVFR---LTKDRAI--I  110 (362)
Q Consensus        40 ~~~~~L~~~~~Gl~~~nPiglAaG~dk--~~~~~~~l~~~-G~G~v~~k-tit~~p~~GNp~PR~~r---~~~~~~i--i  110 (362)
                      +.+.++++++.+++|.=|+ ++|-.|+  +.++--.+... |.|.+-.- .+|   |.-+|.+.+-+   .+..++.  +
T Consensus        31 p~dvd~st~l~~i~L~iPi-vSAaMDTVTE~~MAIamA~~GGiGVIH~~~i~~---R~~~~~~~~~~i~~~~~~~~~~~~  106 (368)
T PRK08649         31 PEDVSTAWQIDAYRFEIPI-IASPMDAVVSPETAIELGRLGGLGVLNLEGLWT---RYEDPEPVLDEIASVGKDAATRLM  106 (368)
T ss_pred             HHHCEEEEEECCEEECCCE-ECCCCCCCCCHHHHHHHHHCCCCEEEECCCCEE---ECCCHHHHHHHHHCCCHHHHHHHH
T ss_conf             7566221887688878857-768876667899999999879968993221231---028878888988703288889999


Q ss_pred             EE-CCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEE---CCCCCCCCCCCCCCHH
Q ss_conf             00-0247777788999876410001210001104542467887765554206755269830---3336532211000023
Q gi|254780434|r  111 NK-LGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTIN---ISSPNTPGLRSLQKKK  186 (362)
Q Consensus       111 N~-~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiN---iSCPNt~g~~~~~~~~  186 (362)
                      .. +..| .-.+.+.+++++.+....+ +.+..   +.....++.+.+  ...++|.+.+-   +++=|..      ...
T Consensus       107 ~~i~~~p-i~~~li~~ri~~~k~~g~~-~a~~~---~~~~~~~~~~~L--v~aGvDvlvId~~vvd~aH~~------~~~  173 (368)
T PRK08649        107 QELYAEP-IKPELIGKRIAEIRDAGVI-AAVSL---SPQNAQKLGPTV--VEAGADLFVIQGTVVSAEHVS------EGG  173 (368)
T ss_pred             HHHHHCC-CCHHHHHHHHHHHHHCCCE-EEEEE---CCHHHHHHHHHH--HHCCCCEEEEEEEEEEEHHHC------CCC
T ss_conf             9987546-7288999899987642857-99996---246389999999--974998899841475402220------320


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCC-CCCCCCCCCCCCCC
Q ss_conf             43211112244455655312688517865057777488899999876449829998066555323-45775446322113
Q gi|254780434|r  187 NLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKG-VQCSDNHEQDGGLS  265 (362)
Q Consensus       187 ~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~-~~~~~~~~~~GGlS  265 (362)
                      .   .+ .+.+.      ....++||++-   |..+   .+-++.+.++|+|+|-+.=-    ++ +++-....   |.-
T Consensus       174 ~---~l-~~~~~------~~~~~v~vIaG---NVaT---~e~a~~Li~aGADaVKVGIG----pGSICTTRvVa---GvG  230 (368)
T PRK08649        174 E---PL-NLKEF------IYELDVPVVVG---GCVT---YTTALHLMRTGAAGVLVGIG----PGAACTSRGVL---GIG  230 (368)
T ss_pred             H---HH-HHHHH------HCCCCCCEEEE---CCCC---HHHHHHHHHCCCCEEEECCC----CCCCCCCCCEE---CCC
T ss_conf             3---56-56643------12379878973---4469---99999999779989994566----88775663401---257


Q ss_pred             CCCCCHHHHHHHHHHHHH----C-CCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHH---------------------
Q ss_conf             564542468999999974----0-89748999678899999999998399975452787---------------------
Q gi|254780434|r  266 GSPLFLKSTIALAKIRQR----V-GPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAM---------------------  319 (362)
Q Consensus       266 G~~i~~~al~~i~~i~~~----~-~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tal---------------------  319 (362)
                      =|.+.  |...++..++.    . +..+|||+-|||...-|+.+-|.||||+|+++|-|                     
T Consensus       231 vPQlt--AI~~~a~a~~~y~~~~~g~~VpvIADGGIr~sGDi~KAlaaGA~~VMlGsllAGt~EsPG~~~~~gm~~~~~~  308 (368)
T PRK08649        231 VPMAT--AIADCAAARRDYLDETGGRYVHVIADGGIVTSGDICKAIACGADAVMLGSPLARAAEAPGRGFHWGMAAPHPV  308 (368)
T ss_pred             CHHHH--HHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             21699--9999999988655652685464895688586418999987289989877310476668987644333467766


Q ss_pred             HCCC---------H--HH----------HHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             7069---------7--89----------999999999999983899778961
Q gi|254780434|r  320 IYEG---------I--SL----------PKRIIQGLSDFLNKENEVNFENIR  350 (362)
Q Consensus       320 i~~G---------p--~~----------~~~I~~~L~~~l~~~G~~si~e~i  350 (362)
                      +.+|         +  .+          +.++.-+|+.-|---|.++|+|+.
T Consensus       309 ~peG~~~~v~~~g~~~~vi~g~~~~~d~v~qlvGGLrs~MgY~Ga~~i~elq  360 (368)
T PRK08649        309 LPRGTRIQVGTTGSLEQILFGPADLPDGTHNLLGALRRSMATLGYSDLKEFQ  360 (368)
T ss_pred             CCCCEEEECCCCCCHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHH
T ss_conf             8996388557665065612477767533888677998863023747088873


No 78 
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional
Probab=98.65  E-value=1.9e-06  Score=63.33  Aligned_cols=225  Identities=16%  Similarity=0.180  Sum_probs=125.2

Q ss_pred             CCEECCCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCH-HHHHHHHH
Q ss_conf             87335997485346888677988874036752410200136878998862688425554100002477777-88999876
Q gi|254780434|r   50 AGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGY-HTVFSRLS  128 (362)
Q Consensus        50 ~Gl~~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~-~~~~~~l~  128 (362)
                      -|..|++..-+  | | -.+..+.+.+.|+-.+.+=-+                  +.+.      .|.+. ..+++++.
T Consensus        19 k~~~~~~~~~~--g-d-P~~~a~~~~~~gadel~ivDl------------------d~s~------~~~~~~~~~I~~i~   70 (253)
T PRK02083         19 KGVNFVNLRDA--G-D-PVELAKRYDEEGADELVFLDI------------------TASS------EGRDTMKDVVERVA   70 (253)
T ss_pred             ECCCCCCCEEC--C-C-HHHHHHHHHHCCCCEEEEEEC------------------CCCC------CCCHHHHHHHHHHH
T ss_conf             78776452688--8-9-999999999879998999956------------------2664------57741799999999


Q ss_pred             HHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH--C
Q ss_conf             41000121000110454246788776555420675526983033365322110000234321111224445565531--2
Q gi|254780434|r  129 KIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIK--T  206 (362)
Q Consensus       129 ~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~--~  206 (362)
                      +. -..|  +.+|+.-.+.+.++      +.+..+||-+.||=..        +.+++.+.++....-.........  .
T Consensus        71 ~~-~~~p--i~vGGGIrs~e~~~------~ll~~GadkVvigs~a--------~~~p~~i~~~~~~~G~q~Iv~siD~~~  133 (253)
T PRK02083         71 EQ-VFIP--LTVGGGIRSVEDAR------RLLRAGADKVSINSAA--------VADPELITELADRFGSQCIVVAIDAKR  133 (253)
T ss_pred             HH-CCCC--EEEECCCCCHHHHH------HHHHCCCCEEEECCHH--------HHCCCHHHHHHHHCCCEEEEEEEEEEE
T ss_conf             86-3987--78517621389876------8987798789999846--------538535578897469835999999887


Q ss_pred             ---CCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             ---68851786505777748889999987644982999806655532345775446322113564542468999999974
Q gi|254780434|r  207 ---GKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQR  283 (362)
Q Consensus       207 ---~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~  283 (362)
                         ....-++.+=.-..+.-++.+.++.+.+.|+..|++++  ++++++           +.|+-     ++.+.++++.
T Consensus       134 ~~~~~~~~v~~~~~~~~~~~~~~~~i~~~~~~g~geil~td--I~rDG~-----------~~G~d-----~~l~~~i~~~  195 (253)
T PRK02083        134 DGEPGRWEVFTHGGRKPTGIDAVEWAKEVQELGAGEILLTS--MDQDGT-----------KNGYD-----LELTRAVRDA  195 (253)
T ss_pred             CCCCCEEEEEECCCCCCCCCCHHHHHHHHHHCCCCEEEEEE--ECCCCC-----------CCCCC-----HHHHHHHHHH
T ss_conf             37687189998078412552399999998756987899998--855586-----------67889-----9999999975


Q ss_pred             CCCCEEEEEECCCCCHHHHHHHH-HCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             08974899967889999999999-83999754527877069789999999999999983899
Q gi|254780434|r  284 VGPKIAIIGTGGISSTKDALDKI-MAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEV  344 (362)
Q Consensus       284 ~~~~i~IIg~GGI~s~~Da~e~l-~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~  344 (362)
                      +  ++|||++|||.+.+|..+.+ ..|.++|-++++|.|....     ..+++++|..+|+.
T Consensus       196 ~--~iPiI~sGGv~s~~di~~~l~~~~i~gv~~G~~~~~~~~s-----l~~~k~~L~~~~i~  250 (253)
T PRK02083        196 V--SVPVIASGGAGNLEHFAEAFTEGGADAALAASVFHFGEIT-----IGELKAYLAEQGIE  250 (253)
T ss_pred             C--CCCEEEECCCCCHHHHHHHHHHCCCEEEEEHHHHHCCCCC-----HHHHHHHHHHCCCC
T ss_conf             7--9999998899999999999986798099871277769999-----99999999987896


No 79 
>PRK13129 consensus
Probab=98.62  E-value=1.7e-05  Score=56.78  Aligned_cols=228  Identities=21%  Similarity=0.237  Sum_probs=114.8

Q ss_pred             ECCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHH--CC
Q ss_conf             5346-88--8677988874036752410200136878998862688425554100002477777889998764100--01
Q gi|254780434|r   60 MAAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQP--TS  134 (362)
Q Consensus        60 lAaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~--~~  134 (362)
                      +-|| +|  .+.+.++.+.+.|...+|+|==...|..-  .|-+. ....+++-|-+     ..+.+++-+++.+.  +.
T Consensus        25 itaG~P~~e~s~~~~~~l~~~GaDiiEiGiPfSDP~AD--GpvIq-~A~~~AL~~G~-----~~~~~~~~~~~~r~~~~~   96 (267)
T PRK13129         25 LMAGDPDLETTAEALLILQENGADLIELGIPYSDPLAD--GPVIQ-AAATRALQSGT-----TLEKVLEMLESLKGKLTI   96 (267)
T ss_pred             EECCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHCCC-----CHHHHHHHHHHHHCCCCC
T ss_conf             70718998999999999997799999979988887765--89999-99999997698-----789999999985434788


Q ss_pred             CCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             21000110454246788776555420675526983033365322110000234321111224445565531268851786
Q gi|254780434|r  135 PIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFL  214 (362)
Q Consensus       135 pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~v  214 (362)
                      |+++=--.|.--.-.+++|.+.+++.+  +|.+-+    |.-|       .+...++.....          ...+..+-
T Consensus        97 PivlM~Y~N~i~~~G~e~F~~~~~~~G--vdGvIi----pDLP-------~eE~~~~~~~~~----------~~gl~~I~  153 (267)
T PRK13129         97 PIILFTYYNPLLNRGMERFCEQAAAAG--VAGLVV----PDLP-------LEEAEKLSPIAA----------ERGIDLIL  153 (267)
T ss_pred             CEEEEEEHHHHHHHHHHHHHHHHHHCC--CCEEEC----CCCC-------HHHHHHHHHHHH----------HCCCEEEE
T ss_conf             889986107898855999999998669--875767----8999-------899999999998----------53981689


Q ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             50577774888999998764498299980665553234577544632211356454246899999997408974899967
Q gi|254780434|r  215 KISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTG  294 (362)
Q Consensus       215 KLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~G  294 (362)
                      =++|..+++.+..+++.     ..|++=.=+   +.++        +|.-  ..+.+.-...++.+++.+  ++|+ ++|
T Consensus       154 lvaPtt~~~Ri~~i~~~-----~~gFiY~vs---~~Gv--------TG~~--~~~~~~~~~~i~~ik~~t--~~Pv-~vG  212 (267)
T PRK13129        154 LVAPTTPAERMKRIAQQ-----SRGFTYLVS---VTGV--------TGER--SQMENRVESLLQQLRQVT--SKPI-AVG  212 (267)
T ss_pred             EECCCCCHHHHHHHHHC-----CCCEEEEEE---CCCC--------CCCC--CCCCHHHHHHHHHHHHHC--CCCE-EEE
T ss_conf             94899968999999816-----898089873---4665--------6765--445088999999999834--8981-788


Q ss_pred             -CCCCHHHHHHHHHCCCCEEEECHHHHCC--------CHHHHHHHHHHHHHHHH
Q ss_conf             -8899999999998399975452787706--------97899999999999999
Q gi|254780434|r  295 -GISSTKDALDKIMAGANLIQLYSAMIYE--------GISLPKRIIQGLSDFLN  339 (362)
Q Consensus       295 -GI~s~~Da~e~l~aGAs~VQi~Tali~~--------Gp~~~~~I~~~L~~~l~  339 (362)
                       ||.+++||.+....|||.|=|+|+++-.        +..-+.+..++|++-|+
T Consensus       213 FGIs~~e~v~~~~~~~ADGvIVGSaiV~~i~e~~~~~~~~~v~~fvk~lk~ald  266 (267)
T PRK13129        213 FGISGPEQARQVREWGADGAIVGSAFVKRLAEASPGEGLQEAGEFCRELRAAAD  266 (267)
T ss_pred             ECCCCHHHHHHHHHCCCCEEEECHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             447999999999854999999878999999865917579999999999999866


No 80 
>PRK13115 consensus
Probab=98.60  E-value=1.4e-05  Score=57.48  Aligned_cols=220  Identities=15%  Similarity=0.193  Sum_probs=110.8

Q ss_pred             CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH-HCCCCCCEEECCC
Q ss_conf             867798887403675241020013687899886268842555410000247777788999876410-0012100011045
Q gi|254780434|r   66 KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ-PTSPIGINLGANK  144 (362)
Q Consensus        66 k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~-~~~pi~vsI~~~~  144 (362)
                      .+.+.++.+.+.|...+|+|==-..|..-  .|-+. ...++++-|-+     ..+.+++-+++.+ .+.|+++ .++.+
T Consensus        39 ~t~~~i~~l~~~GaDiiElGiPFSDP~AD--GPvIQ-~A~~rAL~~G~-----~~~~~f~~v~~~~~~~~Pivl-M~Y~N  109 (269)
T PRK13115         39 TSIAAMTALVESGCDIVEVGLPYSDPVMD--GPVIQ-AATEAALRGGV-----RVRDVFRAVEAISAAGGRALV-MTYWN  109 (269)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHCCC-----CHHHHHHHHHHHCCCCCCEEE-HHHHH
T ss_conf             99999999996699999979998885666--89999-99999997799-----599999999984157998885-47548


Q ss_pred             C-CHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHH
Q ss_conf             4-246788776555420675526983033365322110000234321111224445565531268851786505777748
Q gi|254780434|r  145 D-SKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEE  223 (362)
Q Consensus       145 ~-s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~  223 (362)
                      . -.-.+++|.+.+++.+  +|.+-+    |.-|       .+...++.....          ...+.++-=++|..+++
T Consensus       110 ~i~~yG~e~F~~~~~~~G--vdGvIi----pDLP-------~eE~~~~~~~~~----------~~gi~~I~LvaPtt~~e  166 (269)
T PRK13115        110 PVLRYGVDRFARDLAAAG--GAGLIT----PDLI-------PDEAGEWLAASE----------RHGLDRIFLVAPSSTPE  166 (269)
T ss_pred             HHHHHCHHHHHHHHHHCC--CCEEEC----CCCC-------HHHHHHHHHHHH----------HCCEEEEEEECCCCCHH
T ss_conf             998736999999999739--980764----7899-------789999999998----------65812899858999889


Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC--CCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHH
Q ss_conf             8899999876449829998066555323457754463221135--64542468999999974089748999678899999
Q gi|254780434|r  224 ELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSG--SPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKD  301 (362)
Q Consensus       224 ~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG--~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~D  301 (362)
                      .+..+++.+     .|++=+=+.   .            |..|  ..+.......++.+++.+  ++|+.-.=||++++|
T Consensus       167 Ri~~i~~~a-----~GFIY~Vs~---~------------GvTG~~~~~~~~~~~~i~~ik~~t--~~Pv~vGFGIs~~e~  224 (269)
T PRK13115        167 RLAETVEAS-----RGFVYAAST---M------------GVTGARDAVSSAAPELVARVRAAS--DIPVCVGLGVSSAAQ  224 (269)
T ss_pred             HHHHHHHCC-----CCCEEEEEC---C------------CCCCCCCCCCHHHHHHHHHHHHHC--CCCCEEECCCCCHHH
T ss_conf             999998448-----880899754---5------------456776444177999999999717--998179727899999


Q ss_pred             HHHHHHCCCCEEEECHHHHC----CCHHHHHHHHHHHHHHHHH
Q ss_conf             99999839997545278770----6978999999999999998
Q gi|254780434|r  302 ALDKIMAGANLIQLYSAMIY----EGISLPKRIIQGLSDFLNK  340 (362)
Q Consensus       302 a~e~l~aGAs~VQi~Tali~----~Gp~~~~~I~~~L~~~l~~  340 (362)
                      |.+ +...||.|=++|+++-    .|..-+....++|++-+++
T Consensus       225 ~~~-~~~~aDGvIVGSa~V~~i~~~g~~~v~~~~~el~~~~k~  266 (269)
T PRK13115        225 AAE-IAGYADGVIVGSALVSALLDGGLPAVRALTEELAAGVRR  266 (269)
T ss_pred             HHH-HHHHCCEEEECHHHHHHHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             999-980299999868999999975979999999999999998


No 81 
>PRK02145 consensus
Probab=98.57  E-value=2.9e-06  Score=61.97  Aligned_cols=226  Identities=14%  Similarity=0.170  Sum_probs=125.1

Q ss_pred             CCEECCCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHH
Q ss_conf             87335997485346888677988874036752410200136878998862688425554100002477777889998764
Q gi|254780434|r   50 AGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSK  129 (362)
Q Consensus        50 ~Gl~~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~  129 (362)
                      -|..|.+..-..   | =.++.+.|.+.|+..+.+=-+                  +.+.        .|.+...+-+++
T Consensus        20 kg~~~~~~~~~g---d-P~~~a~~~~~~GadelhivDl------------------d~a~--------~~~~~~~~~I~~   69 (257)
T PRK02145         20 KGVNFVELRDAG---D-PVEIARRYDEQGADELTFLDI------------------TATS--------DGRDLILPIIEA   69 (257)
T ss_pred             ECCCCCCEEECC---C-HHHHHHHHHHCCCCEEEEEEC------------------CCCC--------CCCHHHHHHHHH
T ss_conf             577777738888---9-999999999879998999978------------------8876--------675408999999


Q ss_pred             HHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCC--
Q ss_conf             100012100011045424678877655542067552698303336532211000023432111122444556553126--
Q gi|254780434|r  130 IQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTG--  207 (362)
Q Consensus       130 ~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~--  207 (362)
                      ......+-+.+|+.--+.+.++      +.+..+||-+.+|=..        +.+++.+.++.+..-...........  
T Consensus        70 i~~~~~iPi~vGGGIrs~e~~~------~ll~~GadkVii~s~a--------~~np~~v~~~~~~fG~q~Iv~siD~k~~  135 (257)
T PRK02145         70 VASQVFIPLTVGGGVRAVEDVR------RLLNAGADKVSMNSSA--------VANPQLVRDAADKYGSQCIVVAIDAKRV  135 (257)
T ss_pred             HHHHCCCCEEEECCCCCHHHHH------HHHHCCCCEEEEHHHH--------HHCCCHHHHHHHHCCCCCEEEEEEEEEC
T ss_conf             9965687489627730468899------9998199889841556--------6593022457876698344999998733


Q ss_pred             ------CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             ------88517865057777488899999876449829998066555323457754463221135645424689999999
Q gi|254780434|r  208 ------KFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIR  281 (362)
Q Consensus       208 ------~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~  281 (362)
                            .+.-++.+-.-..+.-++.+.++.+.+.|+..+++++  ++++++           +.|+-     ++.+++++
T Consensus       136 ~~~~~~~~~~v~~~~~~~~t~~~~~~~~~~~~~~G~geil~td--I~rDG~-----------~~G~d-----l~l~~~i~  197 (257)
T PRK02145        136 SADGEPPRWEVFTHGGRKATGLDAVEWARKMAELGAGEILLTS--MDRDGT-----------KSGFD-----LALTRAVS  197 (257)
T ss_pred             CCCCCCCEEEEEECCCEECCCCCHHHHHHHHHHCCCCEEEEEE--ECCCCC-----------CCCCC-----HHHHHHHH
T ss_conf             6777775089997787143677455765688761878689999--847787-----------78889-----79999998


Q ss_pred             HHCCCCEEEEEECCCCCHHHHHHHHHCC-CCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             7408974899967889999999999839-99754527877069789999999999999983899
Q gi|254780434|r  282 QRVGPKIAIIGTGGISSTKDALDKIMAG-ANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEV  344 (362)
Q Consensus       282 ~~~~~~i~IIg~GGI~s~~Da~e~l~aG-As~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~  344 (362)
                      +.+  ++|+|++|||.+.+|..+.+..| +++|-.++.|.|.-..     ..+++++|..+|+.
T Consensus       198 ~~~--~ipvIasGGi~s~~di~~~~~~~~~~av~~g~~~~~~~~~-----i~e~k~~l~~~~~~  254 (257)
T PRK02145        198 DAV--PVPVIASGGVGSLQHLADGITEGHADAVLAASIFHYGEHT-----VGEAKRFMAERGIA  254 (257)
T ss_pred             HCC--CCCEEEECCCCCHHHHHHHHHHCCCCEEEEHHHHHCCCCC-----HHHHHHHHHHCCCC
T ss_conf             626--9989998689999999999980898487653267779989-----99999999987796


No 82 
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional
Probab=98.57  E-value=5.2e-06  Score=60.32  Aligned_cols=229  Identities=17%  Similarity=0.203  Sum_probs=121.8

Q ss_pred             ECCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             5346-88--86779888740367524102001368789988626884255541000024777778899987641000121
Q gi|254780434|r   60 MAAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPI  136 (362)
Q Consensus        60 lAaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi  136 (362)
                      +-|| +|  .+.+.++.+.+. ...+|+|==-..|..-  .|-+. -..++++-|  |   .....+++.+++ +.+.|+
T Consensus        11 itaG~P~~e~s~~~l~~l~~~-aDiiElGiPfSDPvAD--GpvIq-~A~~~Al~~--g---~~~~~i~~~~r~-~~~~pi   80 (247)
T PRK13125         11 LTAGWPNAETFLEAIDGLVGL-VDFLELGIPPKNPKYD--GPVIR-KAHREVSYW--G---LDYWSLLEEVRK-KVGVPT   80 (247)
T ss_pred             EECCCCCHHHHHHHHHHHHHC-CCEEEECCCCCCCCCC--HHHHH-HHHHHHHHC--C---CCHHHHHHHHCC-CCCCCE
T ss_conf             718379989999999998647-9999979988987666--09999-999999876--9---989999998505-689988


Q ss_pred             CCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             00011045424678877655542067552698303336532211000023432111122444556553126885178650
Q gi|254780434|r  137 GINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKI  216 (362)
Q Consensus       137 ~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKL  216 (362)
                      ++=-=.| +=....++|.+.+++.+  +|-+-+ .-.|       +..++....++.....          ..+..+.=+
T Consensus        81 vlM~Y~N-~~~~g~e~F~~~~~~~G--vdGvIi-pDLP-------~e~~ee~~~~~~~~~~----------~gl~~I~lv  139 (247)
T PRK13125         81 YIMTYLE-DYVGSLDDLLNTAKEVG--ARGVLF-PDLL-------IDFPDELEKYVELIRR----------YGLAPVFFT  139 (247)
T ss_pred             EEHHHHH-HHHHHHHHHHHHHHHCC--CCEEEE-CCCC-------CCCHHHHHHHHHHHHH----------CCCCEEEEE
T ss_conf             9729889-99976999999999859--975883-3888-------7546789999999997----------698469995


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC-C
Q ss_conf             577774888999998764498299980665553234577544632211356454246899999997408974899967-8
Q gi|254780434|r  217 SPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTG-G  295 (362)
Q Consensus       217 sPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~G-G  295 (362)
                      +|..+++.+..+++.+     .|++-.-. .   +            ..|..+..-..+.+.++++... +.|| .+| |
T Consensus       140 sPtt~~~ri~~i~~~s-----~gFvY~~~-~---g------------vTG~~~~~~~~~~i~~ik~~~~-~~Pv-~vGFG  196 (247)
T PRK13125        140 SPKFPDRLIRRLSKLS-----PLFIYLGL-Y---P------------ATGVELPVYVERNIKRVRELVG-DVYL-VAGFA  196 (247)
T ss_pred             CCCCCHHHHHHHHHHC-----CCEEEEEE-E---C------------CCCCCCCCCHHHHHHHHHHHCC-CCCE-EEECC
T ss_conf             7998199999999868-----97799994-4---3------------6788773259999999998569-9985-88328


Q ss_pred             CCCHHHHHHHHHCCCCEEEECHHHHC----CCHHHHHHHHHHHHHHHHHCC
Q ss_conf             89999999999839997545278770----697899999999999999838
Q gi|254780434|r  296 ISSTKDALDKIMAGANLIQLYSAMIY----EGISLPKRIIQGLSDFLNKEN  342 (362)
Q Consensus       296 I~s~~Da~e~l~aGAs~VQi~Tali~----~Gp~~~~~I~~~L~~~l~~~G  342 (362)
                      |.+++|+.+.+..|||.|=|+|+++-    +|..-+.+..++|++-|++.|
T Consensus       197 I~t~e~v~~~~~~~aDGvIVGSaiVk~i~~~~~~~~~~~v~~l~~al~e~~  247 (247)
T PRK13125        197 IDSPEDAAKALSAGADGVVVGTAFIRRLERNGVEEALSLLKEIRGALDEYG  247 (247)
T ss_pred             CCCHHHHHHHHHCCCCEEEECHHHHHHHHHCCHHHHHHHHHHHHHHHHHCC
T ss_conf             799999999985589999987899999997698999999999999985259


No 83 
>PRK13117 consensus
Probab=98.57  E-value=1.6e-05  Score=56.97  Aligned_cols=210  Identities=23%  Similarity=0.214  Sum_probs=107.8

Q ss_pred             ECCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH---HC
Q ss_conf             5346-88--867798887403675241020013687899886268842555410000247777788999876410---00
Q gi|254780434|r   60 MAAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ---PT  133 (362)
Q Consensus        60 lAaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~---~~  133 (362)
                      +-|| +|  .+.+.+..+.+.|...+|+|==-..|-.  -.|-+. ....+++-|-     -..+.+++.+++.+   .+
T Consensus        23 itaG~P~~~~t~~~~~~l~~~GaDiiElGiPfSDP~A--DGpvIq-~A~~rAL~~G-----~~~~~~~~~~~~ir~~~~~   94 (268)
T PRK13117         23 VTLGDPSPELSLKIIDTLIEAGADALELGIPFSDPLA--DGPTIQ-NANLRALAAG-----VTPAQCFELLAKIRAKYPT   94 (268)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCC--CCHHHH-HHHHHHHHCC-----CCHHHHHHHHHHHHCCCCC
T ss_conf             7270899799999999999669998997899888565--579999-9999998459-----9699999999885004789


Q ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             12100011045424678877655542067552698303336532211000023432111122444556553126885178
Q gi|254780434|r  134 SPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIF  213 (362)
Q Consensus       134 ~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~  213 (362)
                      .|+++=--.|.--...++.|.+.+.+.+  +|.+-+ .-+|+          +.-.++.....        +... -|| 
T Consensus        95 ~pivlM~Y~N~i~~~G~e~F~~~~~~aG--vdGvIi-pDLP~----------eE~~~~~~~~~--------~~gl-~~I-  151 (268)
T PRK13117         95 IPIGLLLYANLVFANGIDNFYARCAEAG--VDSVLI-ADVPV----------EESAPFRQAAK--------KHGI-API-  151 (268)
T ss_pred             CCEEEEECCCHHHHCCHHHHHHHHHHCC--CCEEEE-CCCCH----------HHHHHHHHHHH--------HCCC-CEE-
T ss_conf             8779973262898717999999999769--877985-79997----------88589999998--------6798-379-


Q ss_pred             EECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             65057777488899999876449829998066555323457754463221135645424689999999740897489996
Q gi|254780434|r  214 LKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGT  293 (362)
Q Consensus       214 vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~  293 (362)
                      -=++|..+++.+..+++.     ++|++=.=+   +.++...          ...+.+.-.+.+..+|+.+  ++|| ++
T Consensus       152 ~lv~Ptt~~~Ri~~i~~~-----a~GFiY~vs---~~GvTG~----------~~~~~~~~~~~i~~ik~~t--~~Pv-~v  210 (268)
T PRK13117        152 FICPPNADDDTLRQIASL-----GRGYTYLLS---RAGVTGA----------ENKAAAPLNHLVEKLKEYN--APPP-LQ  210 (268)
T ss_pred             EEECCCCCHHHHHHHHHH-----CCCEEEEEE---CCCCCCC----------CCCCCHHHHHHHHHHHHCC--CCCE-EE
T ss_conf             984799999999999974-----798599983---6777889----------8666277999999999647--9986-99


Q ss_pred             C-CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             7-889999999999839997545278770
Q gi|254780434|r  294 G-GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       294 G-GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      | ||.+.+|+.+.+..|||.|=|+|+++-
T Consensus       211 GFGIs~~e~v~~~~~~~aDGvIVGSaiV~  239 (268)
T PRK13117        211 GFGISEPEQVKAAIKAGAAGAISGSAIVK  239 (268)
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECHHHHH
T ss_conf             83789999999998638998998789999


No 84 
>PRK02621 consensus
Probab=98.57  E-value=5.5e-06  Score=60.14  Aligned_cols=225  Identities=14%  Similarity=0.125  Sum_probs=121.9

Q ss_pred             CEECCCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHH
Q ss_conf             73359974853468886779888740367524102001368789988626884255541000024777778899987641
Q gi|254780434|r   51 GISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKI  130 (362)
Q Consensus        51 Gl~~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~  130 (362)
                      |..|.+..-.  | | =.++.+.+.+.|+-.+.+=-+                  +.+.-        |-....+-+++.
T Consensus        20 ~~~~~~~~~~--g-d-P~~~ak~~~~~gad~lhivDl------------------d~a~~--------~~~~~~~~I~~i   69 (254)
T PRK02621         20 GVNFVGLRDA--G-D-PVELACRYSQAGADELVFLDI------------------TATHE--------GRATLIDVVYRT   69 (254)
T ss_pred             CCCCCCCEEC--C-C-HHHHHHHHHHCCCCEEEEEEC------------------CCCCC--------CCHHHHHHHHHH
T ss_conf             8577784788--8-9-999999999859999999826------------------67656--------754289999999


Q ss_pred             HHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHC----
Q ss_conf             0001210001104542467887765554206755269830333653221100002343211112244455655312----
Q gi|254780434|r  131 QPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKT----  206 (362)
Q Consensus       131 ~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~----  206 (362)
                      ....-+-+.+|+.--+.+.++.      .+..+||-+.||=.        .+.+++.+.++....-..........    
T Consensus        70 ~~~~~ipi~vGGGIrs~e~~~~------ll~~GadkVii~s~--------a~~np~~~~~~~~~fG~q~Iv~siD~k~~~  135 (254)
T PRK02621         70 AEQVFIPLTVGGGISSLEGIKE------LLRAGADKVSLNSA--------AVRDPDLVRQASDRFGSQCIVVAIDARRRK  135 (254)
T ss_pred             HHHCCCCEEEECCEEEHHHHHH------HHHCCCCEEEECCH--------HHHCCCHHHHHHHHCCCCCEEEEEEEECCC
T ss_conf             9867985899633535799999------99749998999886--------764735445568756984339999955353


Q ss_pred             -CCCCE-EEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             -68851-7865057777488899999876449829998066555323457754463221135645424689999999740
Q gi|254780434|r  207 -GKFVP-IFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRV  284 (362)
Q Consensus       207 -~~~~P-i~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~  284 (362)
                       .+.-+ ++++=.-..+.-++.+.++.+.+.|+..|++++  ++++++           +.|+-     +..++++++.+
T Consensus       136 ~~~~gw~~~~~~~~~~~~~~~~~~~~~~~~~g~geil~td--I~~DGt-----------~~G~d-----~~l~~~i~~~~  197 (254)
T PRK02621        136 PDNPGWDVYVRGGRENTGLDAVEWAEEVAERGAGEILLTS--MDGDGT-----------QAGYD-----LELTRAIAEAV  197 (254)
T ss_pred             CCCCCEEEEECCCCCCCCCCHHHHHHHHHHHCCCEEEEEE--ECCCCC-----------CCCCC-----HHHHHHHHHHC
T ss_conf             4788628996688455776799999887762889699988--804797-----------57688-----69999999717


Q ss_pred             CCCEEEEEECCCCCHHHHHHHHH-CCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             89748999678899999999998-3999754527877069789999999999999983899
Q gi|254780434|r  285 GPKIAIIGTGGISSTKDALDKIM-AGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEV  344 (362)
Q Consensus       285 ~~~i~IIg~GGI~s~~Da~e~l~-aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~  344 (362)
                        ++|+|++|||.+.+|..+.+. .|++.|-+++++.+. -.-+    .+++++|..+|+.
T Consensus       198 --~iPvi~sGGi~s~edi~~~l~~~~v~gvivG~al~~~-~~~l----~e~K~~l~~~~i~  251 (254)
T PRK02621        198 --EIPVIASGGAGCCDHIAEALTEGKAEAALLASLLHYG-QLTI----AEIKADLLARGLP  251 (254)
T ss_pred             --CCCEEEECCCCCHHHHHHHHHHCCCEEEEEHHHHHCC-CCCH----HHHHHHHHHCCCC
T ss_conf             --9979997799999999999985898198775787889-9999----9999999977799


No 85 
>PRK01659 consensus
Probab=98.55  E-value=3.9e-06  Score=61.12  Aligned_cols=225  Identities=15%  Similarity=0.140  Sum_probs=121.8

Q ss_pred             CEECCCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHH
Q ss_conf             73359974853468886779888740367524102001368789988626884255541000024777778899987641
Q gi|254780434|r   51 GISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKI  130 (362)
Q Consensus        51 Gl~~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~  130 (362)
                      |..|.+..-+  | | =.++.+.+.+.|+-.+.+=-+                  +.+.      .  |-....+-+++.
T Consensus        20 g~~~~~~~~~--g-D-P~~~ak~~~~~Gad~ihivDl------------------d~a~------~--g~~~n~~~I~~i   69 (252)
T PRK01659         20 GVNFVGLQDV--G-D-PVEIAAAYNEAGADELVFLDI------------------TATH------E--GRKTMVDVVEKV   69 (252)
T ss_pred             CCCCCCCEEC--C-C-HHHHHHHHHHCCCCEEEEEEC------------------CCCC------C--CCHHHHHHHHHH
T ss_conf             9577784687--8-9-999999999879999999946------------------7665------6--886489999999


Q ss_pred             HHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHC----
Q ss_conf             0001210001104542467887765554206755269830333653221100002343211112244455655312----
Q gi|254780434|r  131 QPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKT----  206 (362)
Q Consensus       131 ~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~----  206 (362)
                      ....-+-+.+|+.--+.+.++.      .+..+||-+.+|=..        +.+++.+.++....-..........    
T Consensus        70 ~~~~~ipi~vGGGIrs~e~~~~------~l~~GadkViigs~a--------~~n~~~i~~~~~~~G~q~IvvsiD~k~~~  135 (252)
T PRK01659         70 AAKVFIPLTVGGGISSVKDMKR------LLRAGADKVSINSAA--------VLRPELITEGADHFGSQCIVVAIDAKYDA  135 (252)
T ss_pred             HHHCCCCEEEECCEECHHHHHH------HHHCCCCEEEECHHH--------HHCHHHHHHHHHHCCCEEEEEEEEEEEEC
T ss_conf             9756974799633200688889------874488559831777--------52915321467646863269999989705


Q ss_pred             -CCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             -6885178650577774888999998764498299980665553234577544632211356454246899999997408
Q gi|254780434|r  207 -GKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVG  285 (362)
Q Consensus       207 -~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~  285 (362)
                       ...--++.+=.-..+.-++.+.++.+.+.|+..+++++  ++++++           ++|+-     ++.+.++++.+ 
T Consensus       136 ~~~~~~i~~~g~~~~~~~~~~~~i~~~~~~g~geil~td--I~rDG~-----------~~G~d-----l~l~~~i~~~~-  196 (252)
T PRK01659        136 EAGKWNVYTHGGRVDTGLDAIAWAKEAVRLGAGEILLTS--MDADGT-----------KNGFD-----LRLTKAISEAV-  196 (252)
T ss_pred             CCCCEEEEECCCCCCCCCCHHHHHHHHHHCCCCEEEEEE--ECCCCC-----------CCCCC-----HHHHHHHHHHC-
T ss_conf             688689996899576777799999999976997799998--814585-----------47689-----89999999868-


Q ss_pred             CCEEEEEECCCCCHHHHHHHHHC-CCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             97489996788999999999983-999754527877069789999999999999983899
Q gi|254780434|r  286 PKIAIIGTGGISSTKDALDKIMA-GANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEV  344 (362)
Q Consensus       286 ~~i~IIg~GGI~s~~Da~e~l~a-GAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~  344 (362)
                       ++|+|++|||.+.+|..+.+.. ++++|-++++|.|....     ..+++++|...||.
T Consensus       197 -~~PiIasGGi~~~~di~~l~~~~~v~gv~~g~~~~~~~~s-----l~e~k~~L~~~~~~  250 (252)
T PRK01659        197 -SVPVIASGGAGNADHMVEVFQKTTADAALAASIFHYGETS-----IKEVKAKLREAGVN  250 (252)
T ss_pred             -CCCEEEEECCCCHHHHHHHHHHCCCCEEEEHHHHHCCCCC-----HHHHHHHHHHCCCC
T ss_conf             -9999999179999999999974898265575477779999-----99999999987498


No 86 
>PRK00830 consensus
Probab=98.55  E-value=3.4e-06  Score=61.57  Aligned_cols=227  Identities=14%  Similarity=0.163  Sum_probs=126.4

Q ss_pred             ECCEECCCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHH
Q ss_conf             88733599748534688867798887403675241020013687899886268842555410000247777788999876
Q gi|254780434|r   49 VAGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLS  128 (362)
Q Consensus        49 ~~Gl~~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~  128 (362)
                      +-|..|++...+..=    .++.+.+.+.|+-.+.+=-+... ..|                         .....+-++
T Consensus        22 vKg~~f~~~~y~gdP----~~~ak~~~~~gadelhivDld~a-~~g-------------------------~~~~~~~I~   71 (273)
T PRK00830         22 VKGVEFVQLRYAGDP----VELAKRYYEDGADELVFLDITAS-HEG-------------------------RATMIDVIE   71 (273)
T ss_pred             EECCCCCCCEECCCH----HHHHHHHHHCCCCEEEEEEEECC-CCC-------------------------CCCHHHHHH
T ss_conf             858677687578899----99999999879998999953246-468-------------------------842799999


Q ss_pred             HHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH---
Q ss_conf             41000121000110454246788776555420675526983033365322110000234321111224445565531---
Q gi|254780434|r  129 KIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIK---  205 (362)
Q Consensus       129 ~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~---  205 (362)
                      +.....-+-+.+|+.--+.+.++.      .+..+||-+.||=.        .+.+++.+.++....-.........   
T Consensus        72 ~i~~~~~~pi~vGGGIrs~e~~~~------ll~~GadkVvIgS~--------a~~np~~v~~~~~~fGsq~IvvsiD~k~  137 (273)
T PRK00830         72 RTAEEVFIPLTVGGGIRSIEDIRQ------ILRAGADKVSVNTA--------AVKNPEFIREASDIFGSQCIVVAIDCKR  137 (273)
T ss_pred             HHHHHCCCCEEEECCEEECCCHHH------HHHCCCCEEECHHH--------HHHCCHHHHHHHHHCCCCEEEEEEEEEC
T ss_conf             999866995896088437732899------99769863983798--------9859077899998769905999998433


Q ss_pred             --------------CCCCCEEEEECC----CCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             --------------268851786505----77774888999998764498299980665553234577544632211356
Q gi|254780434|r  206 --------------TGKFVPIFLKIS----PDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGS  267 (362)
Q Consensus       206 --------------~~~~~Pi~vKLs----Pd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~  267 (362)
                                    .....|-|.+++    -..+.-++.++++.+++.|+..|++++  ++|+++           +.|+
T Consensus       138 ~~~~~~~~~~~~~~~~~g~~~w~~v~~~g~~~~t~~~~~~~~~~~~~~G~geil~td--I~rDGt-----------~~G~  204 (273)
T PRK00830        138 NYNPKDNPDKTIVELEDGTCAWYEVVIYGGREFTGIDAVQWAKKVEELGAGEILLTS--MDRDGT-----------KDGY  204 (273)
T ss_pred             CCCCCCCCCCEEEECCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHHCCCCEEEEEE--ECCCCC-----------CCCC
T ss_conf             766545676214540478742289997078033786799999999864988688878--757796-----------5688


Q ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHC-CCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             45424689999999740897489996788999999999983-999754527877069789999999999999983899
Q gi|254780434|r  268 PLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMA-GANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEV  344 (362)
Q Consensus       268 ~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~a-GAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~  344 (362)
                      -     ++++.++.+.+  ++|||++|||.+.+|..+.+.. ++++|-++++|.|....     ..+++++|..+||.
T Consensus       205 d-----~~l~~~i~~~~--~iPvIasGGv~~~~di~~~~~~~~~~~v~~gs~f~~~~~s-----i~e~k~~L~~~~i~  270 (273)
T PRK00830        205 D-----IPITKKISEEV--DIPVIASGGVGNPEHIYEGFSDGKADAALAASIFHFNEYS-----IREVKEYLRERGIP  270 (273)
T ss_pred             C-----HHHHHHHHHCC--CCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHCCCCC-----HHHHHHHHHHCCCC
T ss_conf             9-----69999998637--9988998899999999999983898688770056669979-----99999999987796


No 87 
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional
Probab=98.54  E-value=1.5e-06  Score=63.97  Aligned_cols=198  Identities=16%  Similarity=0.154  Sum_probs=112.6

Q ss_pred             HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCH
Q ss_conf             77988874036752410200136878998862688425554100002477777889998764100012100011045424
Q gi|254780434|r   68 AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSK  147 (362)
Q Consensus        68 ~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~  147 (362)
                      .+..+.+.+.|+-.+.+=-+... +.|.+                   .|   ..+++++.+   ..-+-+.+|+.--+.
T Consensus        33 ~~~ak~f~~~GadelhivDld~a-~~g~~-------------------~n---~~~I~~I~~---~~~ipi~vGGGIrs~   86 (253)
T PRK01033         33 INAVRIFNEKEADELIVLDIDAS-RKGRE-------------------PN---YELIENLAS---ECFMPLCYGGGIKTV   86 (253)
T ss_pred             HHHHHHHHHCCCCEEEEEECCCC-CCCCC-------------------CH---HHHHHHHHH---HCCCCEEEECCCCCH
T ss_conf             99999999879998999947454-24880-------------------16---999999998---769988986881216


Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCC----CCCEEEEECCCCCCHH
Q ss_conf             678877655542067552698303336532211000023432111122444556553126----8851786505777748
Q gi|254780434|r  148 DFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTG----KFVPIFLKISPDLSEE  223 (362)
Q Consensus       148 ~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~----~~~Pi~vKLsPd~~~~  223 (362)
                      +.++      +.+..+||-+.+|=.        .+.+++.+.++.+..-...........    ...-++..=.-..+.-
T Consensus        87 e~~~------~ll~~GadkViigs~--------a~~~p~~i~~~~~~fG~q~IvvsiD~k~~~~~~~~v~~~g~~~~t~~  152 (253)
T PRK01033         87 EQAK------RIFSLGVEKVSISTA--------ALEDPKLITEAAEIYGSQSVVVSIDVKKRLFGRYDVYTHNGTKKTGL  152 (253)
T ss_pred             HHHH------HHHHCCCCEEEECCH--------HHHCCHHHHHHHHHCCCCCEEEEEEEECCCCCCEEEEEECCCCCCCC
T ss_conf             8889------998679866999987--------86374165789987799769999998248778347898679536785


Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHH
Q ss_conf             88999998764498299980665553234577544632211356454246899999997408974899967889999999
Q gi|254780434|r  224 ELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDAL  303 (362)
Q Consensus       224 ~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~  303 (362)
                      .+.++++.+.+.|+..+++++  +++++           -++|+-     ++.++++++.+  ++|+|++|||.+.+|..
T Consensus       153 ~~~~~~~~~~~~g~geil~Td--I~rDG-----------t~~G~d-----~~l~~~i~~~~--~ipiIasGGi~s~~di~  212 (253)
T PRK01033        153 DPVEFAKQAEELGAGEIVLNS--IDRDG-----------VMKGYD-----LELIKKISSAV--KIPVTALGGAGSLDDIA  212 (253)
T ss_pred             CHHHHHHHHHHCCCCEEEEEE--ECCCC-----------CCCCCC-----HHHHHHHHHHC--CCCEEEECCCCCHHHHH
T ss_conf             589999998746977999987--84889-----------766879-----99999999878--99999978989999999


Q ss_pred             HHH-HCCCCEEEECHHHHCCCHH
Q ss_conf             999-8399975452787706978
Q gi|254780434|r  304 DKI-MAGANLIQLYSAMIYEGIS  325 (362)
Q Consensus       304 e~l-~aGAs~VQi~Tali~~Gp~  325 (362)
                      +.+ ..|+++|-++|.|.|.|+.
T Consensus       213 ~l~~~~~v~gv~~gs~F~f~g~~  235 (253)
T PRK01033        213 DLIQEAGASAAAAGSLFVFKGPH  235 (253)
T ss_pred             HHHHHCCCEEEEEEEEEEECCCC
T ss_conf             99986797399783168984798


No 88 
>PRK04281 consensus
Probab=98.52  E-value=8.8e-06  Score=58.77  Aligned_cols=226  Identities=14%  Similarity=0.179  Sum_probs=124.1

Q ss_pred             CCEECCCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHH
Q ss_conf             87335997485346888677988874036752410200136878998862688425554100002477777889998764
Q gi|254780434|r   50 AGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSK  129 (362)
Q Consensus        50 ~Gl~~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~  129 (362)
                      -|..|.++.-.  | | -.++.+.|.+.|+-.+.+=-+                  +.+.        .|.....+-+++
T Consensus        19 kg~~~~~~~~~--g-d-P~~~ak~~~~~GadelhivDl------------------d~a~--------~~~~~~~~~I~~   68 (254)
T PRK04281         19 KGVNFIGLRDA--G-D-PVEAAKRYNGEGADELTFLDI------------------TASS--------DNRDTILHIIEE   68 (254)
T ss_pred             ECCCCCCCEEC--C-C-HHHHHHHHHHCCCCEEEEEEC------------------CCCC--------CCCHHHHHHHHH
T ss_conf             68577785788--8-9-999999999869999999968------------------8987--------775308999999


Q ss_pred             HHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHC---
Q ss_conf             10001210001104542467887765554206755269830333653221100002343211112244455655312---
Q gi|254780434|r  130 IQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKT---  206 (362)
Q Consensus       130 ~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~---  206 (362)
                      .....-+-+.+|+.--+.+.++      +.+..+||-+.+|=..        +.+++.+.++....-..........   
T Consensus        69 i~~~~~vpi~vGGGIrs~e~~~------~ll~~GadkViigs~a--------~~np~~l~~~~~~fG~q~Iv~siD~k~~  134 (254)
T PRK04281         69 VAGQVFIPLTVGGGVRTVADIR------RLLNAGADKVSINTAA--------VTRPDLIDEAAGFFGSQAIVAAVDAKAV  134 (254)
T ss_pred             HHHHCCCCEEEECCEEECHHHH------HHHHCCCCEEEECHHH--------HHCCHHHHHHHHHCCCEEEEEEEEEEEE
T ss_conf             9850796289977754518899------9997699889977767--------6492676767875598217999988850


Q ss_pred             --CCC-CEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             --688-51786505777748889999987644982999806655532345775446322113564542468999999974
Q gi|254780434|r  207 --GKF-VPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQR  283 (362)
Q Consensus       207 --~~~-~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~  283 (362)
                        ... .-++.+=.-..+.-++.+++..+.+.|+..+++++  ++++++           +.|+-     +..++++++.
T Consensus       135 ~~~~~~~~i~~~g~~~~t~~~~~~~~~~~~~~g~geil~td--I~rDGt-----------~~G~d-----~~l~~~i~~~  196 (254)
T PRK04281        135 NPENTRWEIFTHGGRNPTGLDAVEWAVEMQKRGAGEILLTG--MDRDGT-----------KQGFN-----LPLTRAVAEA  196 (254)
T ss_pred             CCCCCCEEEEECCCCCCCCCCHHHHHHHHHHCCCCEEEEEE--ECCCCC-----------CCCCC-----HHHHHHHHHH
T ss_conf             24688459997588647754499999998752998999988--857887-----------68768-----6999999861


Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHCC-CCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             08974899967889999999999839-99754527877069789999999999999983899
Q gi|254780434|r  284 VGPKIAIIGTGGISSTKDALDKIMAG-ANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEV  344 (362)
Q Consensus       284 ~~~~i~IIg~GGI~s~~Da~e~l~aG-As~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~  344 (362)
                      +  ++|||++|||.+.+|..+.+..| +++|-++++|.|.-.. +    .+++++|+..|+.
T Consensus       197 ~--~iPvIasGGv~~~~di~~~~~~~~~~~v~~g~~~~~~~~s-l----~eak~~l~~~~i~  251 (254)
T PRK04281        197 V--DIPVIASGGVGNVRHLIEGITEGKADAVLAAGIFHFGEIA-I----REAKRAMREAGIE  251 (254)
T ss_pred             C--CCCEEEECCCCCHHHHHHHHHHCCCCEEEEHHHHHCCCCC-H----HHHHHHHHHCCCC
T ss_conf             6--9989997898999999999980898889764377779989-9----9999999986797


No 89 
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF). Imidazole glycerol phosphate synthase (IGPS) catalyzes the fifth step of histidine biosynthesis, the formation of the imidazole ring. IGPS converts N1-(5'-phosphoribulosyl)-formimino-5-aminoimidazole-4-carboxamide ribonucleotide (PRFAR) to imidazole glycerol phosphate (ImGP) and 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR). This conversion involves two tightly coupled reactions in distinct active sites of IGPS. The two catalytic domains can be fused, like in fungi and plants, or peformed by a heterodimer (HisH-glutaminase and HisF-cyclase), like in bacteria.
Probab=98.51  E-value=6.3e-06  Score=59.76  Aligned_cols=176  Identities=16%  Similarity=0.195  Sum_probs=99.1

Q ss_pred             HHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99987641000121000110454246788776555420675526983033365322110000234321111224445565
Q gi|254780434|r  123 VFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEE  202 (362)
Q Consensus       123 ~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~  202 (362)
                      +++++.+   ..-+-+.+|+.-.+.+.++      +.+..+||-+.+|=..        +.+++.+.++....-......
T Consensus        62 ~i~~i~~---~~~~pi~vGGGIrs~~~~~------~~l~~GadkVvigs~~--------~~n~~~~~~~~~~~Gsq~Iv~  124 (243)
T cd04731          62 VVERVAE---EVFIPLTVGGGIRSLEDAR------RLLRAGADKVSINSAA--------VENPELIREIAKRFGSQCVVV  124 (243)
T ss_pred             HHHHHHH---HCCCCEEEEEEEEEHHHHH------HHHHCCCCEEEECCCC--------CCCCCHHHHHHHHCCCCCEEE
T ss_conf             9999998---6798689985066479999------9997799789989844--------237714357887569930999


Q ss_pred             HHHC----CCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             5312----688517865057777488899999876449829998066555323457754463221135645424689999
Q gi|254780434|r  203 KIKT----GKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALA  278 (362)
Q Consensus       203 ~~~~----~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~  278 (362)
                      ....    ...--++..-.-..+.-.+.++++.+.+.|+..+++++  +++++           -++|+-     +..++
T Consensus       125 siD~k~~~~~~~~v~~~~~~~~~~~~~~~~i~~~~~~G~geil~td--I~~DG-----------t~~G~d-----~~l~~  186 (243)
T cd04731         125 SIDAKRRGDGGYEVYTHGGRKPTGLDAVEWAKEVEELGAGEILLTS--MDRDG-----------TKKGYD-----LELIR  186 (243)
T ss_pred             EEEEEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEE--ECCCC-----------CCCCCC-----HHHHH
T ss_conf             9997653789628984698441267899999999846987899987--25768-----------566579-----99999


Q ss_pred             HHHHHCCCCEEEEEECCCCCHHHHHHHHH-CCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99974089748999678899999999998-399975452787706978999999999999998
Q gi|254780434|r  279 KIRQRVGPKIAIIGTGGISSTKDALDKIM-AGANLIQLYSAMIYEGISLPKRIIQGLSDFLNK  340 (362)
Q Consensus       279 ~i~~~~~~~i~IIg~GGI~s~~Da~e~l~-aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~  340 (362)
                      ++++.+  ++|||++|||.+.+|..+.+. .|++.|-++++|.|..-. +.    ++++||.+
T Consensus       187 ~i~~~~--~~piI~sGGi~~~~di~~~l~~~~~~gv~~g~~~~~~~~~-l~----~~k~~L~~  242 (243)
T cd04731         187 AVSSAV--NIPVIASGGAGKPEHFVEAFEEGGADAALAASIFHFGEYT-IA----ELKEYLAE  242 (243)
T ss_pred             HHHHHC--CCCEEEECCCCCHHHHHHHHHHCCCEEEEEHHHHHCCCCC-HH----HHHHHHHH
T ss_conf             999868--9999998899999999999987898299882276769989-99----99999861


No 90 
>PRK02747 consensus
Probab=98.51  E-value=6.4e-06  Score=59.71  Aligned_cols=226  Identities=13%  Similarity=0.143  Sum_probs=125.3

Q ss_pred             CCEECCCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHH
Q ss_conf             87335997485346888677988874036752410200136878998862688425554100002477777889998764
Q gi|254780434|r   50 AGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSK  129 (362)
Q Consensus        50 ~Gl~~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~  129 (362)
                      -|..|.+..-.  |  .-.++.+.+.+.|+-.+.+=-+                  +.+.        .|.....+-+++
T Consensus        19 kg~~~~~~~~~--g--dP~~~ak~~~~~Gadelh~vDl------------------~~a~--------~~~~~~~~lI~~   68 (257)
T PRK02747         19 KGVNFVDLRDA--G--DPVEAARAYDAAGADELCFLDI------------------TASH--------ENRGTMLDVVAR   68 (257)
T ss_pred             ECCCCCCEEEC--C--CHHHHHHHHHHCCCCEEEEEEC------------------CCCC--------CCCHHHHHHHHH
T ss_conf             58777770788--8--9999999999869998999947------------------6775--------675528999999


Q ss_pred             HHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCC--
Q ss_conf             100012100011045424678877655542067552698303336532211000023432111122444556553126--
Q gi|254780434|r  130 IQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTG--  207 (362)
Q Consensus       130 ~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~--  207 (362)
                      .....-+-+.+|+.--+.+.++      +.+..+||-+.+|=.        .+.+++.+.++.+..-...........  
T Consensus        69 i~~~~~ipi~vGGGIrs~e~~~------~ll~~GadkViigs~--------a~~np~l~~~~~~~fG~q~Iv~siD~k~~  134 (257)
T PRK02747         69 TAEQCFMPLTVGGGVRTVDDIR------KLLLAGADKVSINSA--------AVARPEFVAEAADKFGSQCIVVAIDAKRV  134 (257)
T ss_pred             HHHHCCCCEEEECCCCCHHHHH------HHHHCCCCEEEECHH--------HHHCCHHHHHHHHHCCCEEEEEEEEEEEC
T ss_conf             9986699889848820738878------998769968983444--------65483477778875596579999987751


Q ss_pred             -----CCCE-EEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             -----8851-7865057777488899999876449829998066555323457754463221135645424689999999
Q gi|254780434|r  208 -----KFVP-IFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIR  281 (362)
Q Consensus       208 -----~~~P-i~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~  281 (362)
                           ...+ ++.+=.-..+.-++.+.++.+.+.|+..+++++  ++++++           ++|+-     +..+++++
T Consensus       135 ~~~~~~~~~~i~~~~~~~~t~~~~~~~~~~~~~~G~geil~td--I~rDG~-----------~~G~d-----l~l~~~i~  196 (257)
T PRK02747        135 SPAGENDRWEIFTHGGRKPTGIDAVEFAQKVVSLGAGEILLTS--MDRDGT-----------KAGFD-----LPLTRAIA  196 (257)
T ss_pred             CCCCCCCCEEEEECCCCEECCCHHHHHHHHHHHCCCCEEEEEE--ECCCCC-----------CCCCC-----HHHHHHHH
T ss_conf             5767787389998898463430399999999970998899998--835573-----------26788-----69999998


Q ss_pred             HHCCCCEEEEEECCCCCHHHHHHHHHC-CCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             740897489996788999999999983-999754527877069789999999999999983899
Q gi|254780434|r  282 QRVGPKIAIIGTGGISSTKDALDKIMA-GANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEV  344 (362)
Q Consensus       282 ~~~~~~i~IIg~GGI~s~~Da~e~l~a-GAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~  344 (362)
                      +.+  ++|+|++|||.+.+|..+.+.. ++++|-++++|.|.-..     ..+++++|...||.
T Consensus       197 ~~~--~~pvIasGGv~~~~di~~~~~~~~~~av~~g~~~~~~~~~-----l~~ak~~L~~~~i~  253 (257)
T PRK02747        197 DAV--RVPVIASGGVGTLDHLVEGVRDGHATAVLAASIFHFGTYT-----IGEAKAHMAAAGIP  253 (257)
T ss_pred             HCC--CCCEEEECCCCCHHHHHHHHHHCCCCEEEEHHHHHCCCCC-----HHHHHHHHHHCCCC
T ss_conf             607--9989997799999999999983898499883267769989-----99999999987896


No 91 
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional
Probab=98.49  E-value=4.8e-05  Score=53.78  Aligned_cols=210  Identities=23%  Similarity=0.211  Sum_probs=110.4

Q ss_pred             ECCC-CCC--CHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHH--CC
Q ss_conf             5346-888--677988874036752410200136878998862688425554100002477777889998764100--01
Q gi|254780434|r   60 MAAG-YDK--NAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQP--TS  134 (362)
Q Consensus        60 lAaG-~dk--~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~--~~  134 (362)
                      +-+| +|.  +.+.++.+.+.|...+|+|==-..|..-  .|-+. -..++++-|-+     ..+.+++-+++.+.  +.
T Consensus        21 ~taG~P~~e~s~~~~~~l~~~GaDiiElGiPfSDP~AD--GpvIq-~A~~~AL~~G~-----~~~~~~~~v~~~r~~~~~   92 (263)
T CHL00200         21 ITAGDPDIVITKKALKILDKKGADIIELGIPYSDPLAD--GPIIQ-EASNRALKQGI-----NLNKILSILSEVNGEIKA   92 (263)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHCCC-----CHHHHHHHHHHHHHCCCC
T ss_conf             70738987899999999997699999978988886665--89999-99999997798-----777899999998606799


Q ss_pred             CCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             21000110454246788776555420675526983033365322110000234321111224445565531268851786
Q gi|254780434|r  135 PIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFL  214 (362)
Q Consensus       135 pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~v  214 (362)
                      |+.+=-=.|.--.-.+++|.+-+...+  +|.+-+    |--|       .+...++.....          ...+.++-
T Consensus        93 PivlMtY~N~i~~yG~e~F~~~~~~~G--vdGlIi----pDLP-------~eE~~~~~~~~~----------~~gl~~I~  149 (263)
T CHL00200         93 PIVIFTYYNPVLHYGINKFIKKISQAG--VKGLII----PDLP-------YEESDYLISVCN----------LYNIELIL  149 (263)
T ss_pred             CEEEEEEHHHHHHCCHHHHHHHHHHCC--CCEEEC----CCCC-------HHHHHHHHHHHH----------HCCCCEEE
T ss_conf             889986206888738899999999849--986874----7999-------788899999998----------55862166


Q ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             50577774888999998764498299980665553234577544632211356454246899999997408974899967
Q gi|254780434|r  215 KISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTG  294 (362)
Q Consensus       215 KLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~G  294 (362)
                      =++|..+++++..+++.+     +|++=.=+   +.++....          ..+...-.+.+..+|+.+  ++|+ .+|
T Consensus       150 lvaPtt~~~Ri~~i~~~a-----~GFiY~vs---~~GvTG~~----------~~~~~~l~~~i~~ik~~t--~~Pv-~vG  208 (263)
T CHL00200        150 LIAPTSSKSRIQKIARAA-----PGCIYLVS---TTGVTGLK----------TELDKKLKKLIETIKKMT--NKPI-ILG  208 (263)
T ss_pred             EECCCCCHHHHHHHHHHC-----CCCEEEEE---CCCCCCCC----------CCCHHHHHHHHHHHHHHC--CCCE-EEE
T ss_conf             647899699999999728-----98089853---36556875----------445187999999999736--9984-873


Q ss_pred             -CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             -889999999999839997545278770
Q gi|254780434|r  295 -GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       295 -GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                       ||.+.+|+.+....|||.|=|+|+++-
T Consensus       209 FGIs~~e~v~~~~~~~aDGvIVGSaiV~  236 (263)
T CHL00200        209 FGISTSEQIKQIKGWNINGIVIGSACVQ  236 (263)
T ss_pred             CCCCCHHHHHHHHHCCCCEEEECHHHHH
T ss_conf             5879999999997459999998789999


No 92 
>PRK05211 consensus
Probab=98.49  E-value=6.2e-06  Score=59.79  Aligned_cols=227  Identities=18%  Similarity=0.175  Sum_probs=126.8

Q ss_pred             ECCEECCCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHH
Q ss_conf             88733599748534688867798887403675241020013687899886268842555410000247777788999876
Q gi|254780434|r   49 VAGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLS  128 (362)
Q Consensus        49 ~~Gl~~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~  128 (362)
                      +-+.+|++.-.+  | | -.+..+.|.+.|+-.+.+=-++.. +.|.+                   .|   ..+++++.
T Consensus         9 Vk~~~f~~~~~~--g-D-P~~~ak~~~~~gadelhivDld~a-~~g~~-------------------~n---~~~I~~i~   61 (248)
T PRK05211          9 VKGVQFRNHEII--G-D-IVPLAKRYAEEGADELVFYDITAS-SDGRV-------------------VD---KSWVSRVA   61 (248)
T ss_pred             EECCCCCCCEEC--C-C-HHHHHHHHHHCCCCEEEEEECCCC-CCCCC-------------------CH---HHHHHHHH
T ss_conf             768576688677--8-9-999999999869998999978677-67872-------------------14---99999999


Q ss_pred             HHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH----
Q ss_conf             4100012100011045424678877655542067552698303336532211000023432111122444556553----
Q gi|254780434|r  129 KIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKI----  204 (362)
Q Consensus       129 ~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~----  204 (362)
                      +.- ..|  +.+|+.--+.+.++      +.+..+||-+.||=..        +.+|+.+.++....-........    
T Consensus        62 ~~~-~~P--l~vGGGIrs~~~i~------~ll~~GadkViigs~a--------~~np~li~~~~~~fG~q~IvvsiD~~~  124 (248)
T PRK05211         62 EVI-DIP--FCVAGGIKSVEDAR------EILSFGADKISINSPA--------LADPTLITRLADRFGVQCIVVGIDSWF  124 (248)
T ss_pred             HHC-CCC--EEEECCCCCHHHHH------HHHHCCCCEEEECCHH--------HHCCHHHHHHHHHCCCCEEEEEEEEEC
T ss_conf             767-985--89627801389999------9998799889989767--------619618999998579936999997102


Q ss_pred             -HCCCCCEEEEECC----CCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             -1268851786505----77774888999998764498299980665553234577544632211356454246899999
Q gi|254780434|r  205 -KTGKFVPIFLKIS----PDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAK  279 (362)
Q Consensus       205 -~~~~~~Pi~vKLs----Pd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~  279 (362)
                       .......++.--.    -..+.-++.++++.+++.|+--|++++  ++++++           +.|+-     ++.++.
T Consensus       125 ~~~~~~~~v~~~~g~~~~~~~t~~~~~d~i~~~~~~G~geIl~t~--IdrDG~-----------~~G~d-----l~l~~~  186 (248)
T PRK05211        125 DAETGKYQVYQYTGDESRTKATQWETLDWVKEVQKRGAGEIVLNM--MNQDGV-----------RNGYD-----LAQLKK  186 (248)
T ss_pred             CCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEE--ECCCCC-----------CCCCC-----HHHHHH
T ss_conf             555785799982586565304773699999999975986699989--878997-----------27889-----999999


Q ss_pred             HHHHCCCCEEEEEECCCCCHHHHHHHH-HCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             997408974899967889999999999-83999754527877069789999999999999983899
Q gi|254780434|r  280 IRQRVGPKIAIIGTGGISSTKDALDKI-MAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEV  344 (362)
Q Consensus       280 i~~~~~~~i~IIg~GGI~s~~Da~e~l-~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~  344 (362)
                      +++.+  ++|+|++||+.+.+|..+.+ .+|++.|-++++|.+.-..     ..+++++|..+|+.
T Consensus       187 i~~~~--~iPvIasGGv~s~~di~~~~~~~~~~gvi~gs~~~~~~i~-----l~e~k~~L~~~gi~  245 (248)
T PRK05211        187 VRAIC--HVPLIASGGAGTMEHFLEAFRDADVDGALAASVFHKQIIN-----IGELKQYLAAQGIE  245 (248)
T ss_pred             HHHHC--CCCEEEECCCCCHHHHHHHHHHCCCHHHHHHHHHHCCCCC-----HHHHHHHHHHCCCC
T ss_conf             99746--9999998888999999999986798413304888889999-----99999999987895


No 93 
>PRK13137 consensus
Probab=98.48  E-value=4.5e-05  Score=54.00  Aligned_cols=62  Identities=19%  Similarity=0.115  Sum_probs=44.0

Q ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC---CCHHHHHHHHHHHHHHHH
Q ss_conf             899999997408974899967889999999999839997545278770---697899999999999999
Q gi|254780434|r  274 TIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY---EGISLPKRIIQGLSDFLN  339 (362)
Q Consensus       274 l~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~---~Gp~~~~~I~~~L~~~l~  339 (362)
                      ...++.+++.+  ++|+...=||.+.+|+...... ||.|=++|+++-   +|-. +....+||++.++
T Consensus       201 ~~~i~~ik~~t--~~Pv~vGFGIs~~e~~~~~~~~-aDGvIVGSaiV~~i~e~~d-~~~~~~el~~~~r  265 (266)
T PRK13137        201 PDMLRLARQYA--ALPVAVGFGVKDKATAAQVAQV-ADGVVVGSAFINAVEEGRD-VAALAQEIAAGCR  265 (266)
T ss_pred             HHHHHHHHHCC--CCCEEEECCCCCHHHHHHHHHH-CCEEEEHHHHHHHHHHCCC-HHHHHHHHHHHHC
T ss_conf             99999998638--9987998266988999999831-9999980999999995898-9999999998744


No 94 
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism. ThiG catalyzes the formation of thiazole from 1-deoxy-D-xylulose 5-phosphate (DXP) and dehydroglycine, with the help of the sulfur carrier protein ThiS that carries the sulfur needed for thiazole assembly on its carboxy terminus (ThiS-COSH).
Probab=98.48  E-value=6.2e-05  Score=53.07  Aligned_cols=210  Identities=17%  Similarity=0.203  Sum_probs=120.2

Q ss_pred             EECCEECCCCEEECCCCCCCHH-HHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHH
Q ss_conf             8887335997485346888677-988874036752410200136878998862688425554100002477777889998
Q gi|254780434|r   48 KVAGISLSNPLGMAAGYDKNAE-VPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSR  126 (362)
Q Consensus        48 ~~~Gl~~~nPiglAaG~dk~~~-~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~  126 (362)
                      ++.|.+|++.+.+..|--++.+ +.+.+...|.--|   ||..+           |          +.+.+.+-+.+++.
T Consensus         2 ~Igg~~f~SRLilGTgky~s~~~~~~ai~aSgaeiv---TVAlR-----------R----------~~~~~~~~~~~l~~   57 (248)
T cd04728           2 TIGGKTFSSRLLLGTGKYPSPAIMKEAIEASGAEIV---TVALR-----------R----------VNIGDPGGESFLDL   57 (248)
T ss_pred             EECCEEEECCEEEECCCCCCHHHHHHHHHHHCCCEE---EEEEE-----------E----------CCCCCCCCHHHHHH
T ss_conf             789988774337864899999999999999689769---99986-----------3----------05788885268987


Q ss_pred             HHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEE-CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             76410001210001104542467887765554206755269830-33365322110000234321111224445565531
Q gi|254780434|r  127 LSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTIN-ISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIK  205 (362)
Q Consensus       127 l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiN-iSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~  205 (362)
                      ++..+  ..+--|-.+-.+.+|++. .+++.|++. ..|.+-|- +.-|+           .|........++-+....+
T Consensus        58 i~~~~--~~~LPNTAGc~ta~EAvr-~A~laRE~~-~t~~IKLEVi~D~~-----------~LlPD~~eTl~Aae~Lv~~  122 (248)
T cd04728          58 LDKSG--YTLLPNTAGCRTAEEAVR-TARLAREAL-GTDWIKLEVIGDDK-----------TLLPDPIETLKAAEILVKE  122 (248)
T ss_pred             HHHCC--CEECCCCCCCCCHHHHHH-HHHHHHHHH-CCCEEEEEEECCCC-----------CCCCCHHHHHHHHHHHHHC
T ss_conf             52338--668765401167999999-999999984-89869999817976-----------7798868999999999988


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             26885178650577774888999998764498299980665553234577544632211356454246899999997408
Q gi|254780434|r  206 TGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVG  285 (362)
Q Consensus       206 ~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~  285 (362)
                      .   .-|+    |+.+++  ..+++.+++.|+..+--         +-.+. .      ||..|..  ...++.++++. 
T Consensus       123 G---F~Vl----pY~~~D--~v~akrLe~~Gc~avMP---------lgsPI-G------Sg~Gl~n--~~~l~~i~e~~-  174 (248)
T cd04728         123 G---FTVL----PYCTDD--PVLAKRLEDAGCAAVMP---------LGSPI-G------SGQGLLN--PYNLRIIIERA-  174 (248)
T ss_pred             C---CEEE----EECCCC--HHHHHHHHHCCCEEEEE---------CCCCC-C------CCCCCCC--HHHHHHHHHHC-
T ss_conf             9---9897----867889--99999999749534520---------45643-4------7988799--99999999847-


Q ss_pred             CCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCC-CHH
Q ss_conf             9748999678899999999998399975452787706-978
Q gi|254780434|r  286 PKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYE-GIS  325 (362)
Q Consensus       286 ~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~-Gp~  325 (362)
                       ++|+|--.||-++.||.+-|..|||+|-+-||.... .|-
T Consensus       175 -~vPvIVDAGiG~pS~Aa~aMElG~daVL~NTAIA~A~dPv  214 (248)
T cd04728         175 -DVPVIVDAGIGTPSDAAQAMELGADAVLLNTAIAKAKDPV  214 (248)
T ss_pred             -CCCEEEECCCCCHHHHHHHHHCCCCEEEHHHHHHCCCCHH
T ss_conf             -9988984799975678999872655334546877169989


No 95 
>PRK13127 consensus
Probab=98.47  E-value=2.5e-05  Score=55.73  Aligned_cols=210  Identities=22%  Similarity=0.246  Sum_probs=110.2

Q ss_pred             ECCC-CCC--CHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH--HCC
Q ss_conf             5346-888--67798887403675241020013687899886268842555410000247777788999876410--001
Q gi|254780434|r   60 MAAG-YDK--NAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ--PTS  134 (362)
Q Consensus        60 lAaG-~dk--~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~--~~~  134 (362)
                      +-+| +|.  +.+.+..+.+.|...+|+|==...|..-  .|-+. ....+++-|-+     ..+.+++-+++.+  .+.
T Consensus        17 itaG~P~~e~t~~~l~~l~~~GaDiiElGiPfSDP~AD--GPvIq-~a~~rAL~~G~-----~~~~~~~~~~~~r~~~~~   88 (262)
T PRK13127         17 LVAGDPDPEATLEFVKALVKGGADVIELGIPFSDPVAD--GPTIQ-AADVRALSAGM-----KIDKYFELVKELRVDSSV   88 (262)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHCCC-----CHHHHHHHHHHHHCCCCC
T ss_conf             62708998999999999997699999978988887765--79999-99999997699-----799999999997456998


Q ss_pred             CCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             21000110454246788776555420675526983033365322110000234321111224445565531268851786
Q gi|254780434|r  135 PIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFL  214 (362)
Q Consensus       135 pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~v  214 (362)
                      |+.+=-=.|.--...+++|.+-++..+  +|.+-+    |-   +.    .+...++.....          ...+.++-
T Consensus        89 pivlM~Y~N~i~~~G~e~F~~~~~~~G--vdGlIi----pD---LP----~eE~~~~~~~~~----------~~gi~~I~  145 (262)
T PRK13127         89 PLVLMTYYNPVYRYGVEKFVKKAAEAG--VSGLII----PD---LP----VEEATDLREACK----------KHGLDLVF  145 (262)
T ss_pred             CEEEEECCHHHHHCCHHHHHHHHHHCC--CCEEEE----CC---CC----HHHHHHHHHHHH----------HCCCEEEE
T ss_conf             879996613887608999999998759--976996----69---99----789999999998----------55832799


Q ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             50577774888999998764498299980665553234577544632211356454246899999997408974899967
Q gi|254780434|r  215 KISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTG  294 (362)
Q Consensus       215 KLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~G  294 (362)
                      =++|..+++.+..+++.     +.|++=.=+   +.++        +|.-  ..+.......++++++.+  ++| +.+|
T Consensus       146 lvaPtt~~~Ri~~i~~~-----a~gFiY~vs---~~Gv--------TG~~--~~~~~~~~~~i~~ik~~t--~~P-v~vG  204 (262)
T PRK13127        146 LVAPTTPEERLKRIDEA-----SSGFVYLVS---RLGV--------TGAR--EDVEEATFDLLKRARTTC--KNK-IAVG  204 (262)
T ss_pred             EECCCCCHHHHHHHHHC-----CCCEEEEEE---CCCC--------CCCC--CCCHHHHHHHHHHHHHCC--CCC-EEEE
T ss_conf             85899989999999843-----898189984---3555--------6876--555288999999999617--998-4899


Q ss_pred             -CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             -889999999999839997545278770
Q gi|254780434|r  295 -GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       295 -GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                       ||.+.+|+.+....|||.|=|+|+++-
T Consensus       205 FGI~~~e~v~~~~~~~aDGvIVGSaiv~  232 (262)
T PRK13127        205 FGISKGEHAEELLDAGADGVIVGSALVD  232 (262)
T ss_pred             EEECCHHHHHHHHHCCCCEEEECHHHHH
T ss_conf             3348899999998649999998789999


No 96 
>PRK13126 consensus
Probab=98.47  E-value=1.7e-05  Score=56.87  Aligned_cols=108  Identities=18%  Similarity=0.211  Sum_probs=66.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             17865057777488899999876449829998066555323457754463221135645424689999999740897489
Q gi|254780434|r  211 PIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAI  290 (362)
Q Consensus       211 Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~I  290 (362)
                      +|++ ++|..+++.+..+++.     ..|++-..    +.           | ..|..+-....+.+..+++.. .++|+
T Consensus       126 ~I~l-v~ptt~~~ri~~i~~~-----s~gfiYvs----~~-----------g-vTG~~~~~~~~~~i~~ir~~~-~~~Pv  182 (237)
T PRK13126        126 PSFF-IPSKFPHRLLRRLASL-----EPDFIYLG----LY-----------A-ATGIELPVYVERNVKTIRGLA-GDVYL  182 (237)
T ss_pred             EEEE-ECCCCHHHHHHHHHHH-----CCCEEEEE----EE-----------C-CCCCCCHHHHHHHHHHHHHHC-CCCCE
T ss_conf             7997-3899839999999985-----89879998----65-----------2-667641567999999999857-89977


Q ss_pred             EEEC-CCCCHHHHHHHHHCCCCEEEECHHHHC---CCHHHHHHHHHHHHHHHHHCC
Q ss_conf             9967-889999999999839997545278770---697899999999999999838
Q gi|254780434|r  291 IGTG-GISSTKDALDKIMAGANLIQLYSAMIY---EGISLPKRIIQGLSDFLNKEN  342 (362)
Q Consensus       291 Ig~G-GI~s~~Da~e~l~aGAs~VQi~Tali~---~Gp~~~~~I~~~L~~~l~~~G  342 (362)
                       .+| ||.|++|+.+.+..|||-|=|+|+++-   ++..=..+..++|++.+++-|
T Consensus       183 -~vGFGI~t~e~~~~~~~~~aDGvIVGSaiV~~i~~~~~~~~~~v~~lr~al~el~  237 (237)
T PRK13126        183 -VAGFAIDSPEKAARLVKAGADGVVVGTAFMRRLSSSVEEALSFLKEIRGALSELG  237 (237)
T ss_pred             -EEEECCCCHHHHHHHHHCCCCEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             -9994539999999998648999998789999999755999999999999998559


No 97 
>PRK13118 consensus
Probab=98.46  E-value=3.4e-05  Score=54.78  Aligned_cols=227  Identities=19%  Similarity=0.223  Sum_probs=112.0

Q ss_pred             ECCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHH---HHC
Q ss_conf             5346-88--86779888740367524102001368789988626884255541000024777778899987641---000
Q gi|254780434|r   60 MAAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKI---QPT  133 (362)
Q Consensus        60 lAaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~---~~~  133 (362)
                      +-+| +|  .+.+.++.+.+.|+..+|+|==...|..-  .|-+. ...++++-|  |+   ..+.+.+-+++.   ..+
T Consensus        23 itaG~P~~e~t~~~~~~l~~~GaDiiElGiPfSDP~AD--GPvIq-~A~~rAL~~--G~---~~~~~~~~v~~~r~~~~~   94 (269)
T PRK13118         23 VTAGDPSPEASVPLLHGLVAAGADVIELGMPFSDPMAD--GPAIQ-LASERALAA--GQ---GLADVLQMVREFRQGDQT   94 (269)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHC--CC---CHHHHHHHHHHHHHCCCC
T ss_conf             71718998999999999997699999978988886665--79999-999999967--98---688999999998643899


Q ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             12100011045424678877655542067552698303336532211000023432111122444556553126885178
Q gi|254780434|r  134 SPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIF  213 (362)
Q Consensus       134 ~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~  213 (362)
                      .|+++=-=.|.--.-.+++|.+.+.+.+  +|.+-+    |   ++.    .+...++.....          ...+..+
T Consensus        95 ~PivlM~Y~N~i~~~G~e~F~~~~~~~G--vdGvIi----p---DLP----~ee~~~~~~~~~----------~~gl~~I  151 (269)
T PRK13118         95 TPVVLMGYLNPIEIYGYERFVAQAKEAG--VDGLIL----V---DLP----PEEADELRAPAQ----------AHGLDFI  151 (269)
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHHHHCC--CCEEEC----C---CCC----HHHHHHHHHHHH----------HCCCCHH
T ss_conf             9989974000787863999999999859--974645----8---999----789999999999----------7598464


Q ss_pred             EECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             65057777488899999876449829998066555323457754463221135645424689999999740897489996
Q gi|254780434|r  214 LKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGT  293 (362)
Q Consensus       214 vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~  293 (362)
                      -=++|..+++.+..+++.+     +|++-.=+   +.++        +|  +...+.+...+.+.++|+.+  ++|+ .+
T Consensus       152 ~lvaPtt~~~Ri~~i~~~a-----~gFiY~vs---~~Gv--------TG--~~~~~~~~~~~~i~~ik~~t--~~Pv-~v  210 (269)
T PRK13118        152 RLTSPTTSDERLPRVLEHA-----SGYLYYVS---LAGV--------TG--AAALDTEHVEEAVARLRRHT--DLPV-VV  210 (269)
T ss_pred             EEECCCCCHHHHHHHHHCC-----CCCEEEEE---CCCC--------CC--CCCCCHHHHHHHHHHHHHHC--CCCE-EE
T ss_conf             0369898789999998437-----88389985---4566--------78--77667198999999999625--8981-78


Q ss_pred             C-CCCCHHHHHHHHHCCCCEEEECHHHHCC---------CHHHHHHHHHHHHHHHH
Q ss_conf             7-8899999999998399975452787706---------97899999999999999
Q gi|254780434|r  294 G-GISSTKDALDKIMAGANLIQLYSAMIYE---------GISLPKRIIQGLSDFLN  339 (362)
Q Consensus       294 G-GI~s~~Da~e~l~aGAs~VQi~Tali~~---------Gp~~~~~I~~~L~~~l~  339 (362)
                      | ||.+.+||.+ +...||.|=|+|+++-.         +..-+.+..++|++-++
T Consensus       211 GFGIs~~e~~~~-v~~~aDGvIVGSa~Vk~i~~~~~~~~~~~~~~~~~k~lk~al~  265 (269)
T PRK13118        211 GFGIRDAESAAA-IARLADGVVVGSALVDAIAEAKDVDQAVERVLALLAELRQALD  265 (269)
T ss_pred             EECCCCHHHHHH-HHCCCCEEEECHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             716799999999-9800999998589999998567826799999999999999998


No 98 
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional
Probab=98.46  E-value=6.9e-06  Score=59.48  Aligned_cols=166  Identities=16%  Similarity=0.175  Sum_probs=97.3

Q ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             12100011045424678877655542067552698303336532211000023432111122444556553126885178
Q gi|254780434|r  134 SPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIF  213 (362)
Q Consensus       134 ~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~  213 (362)
                      ..+-+.+|+.-.+.+.++.+      +..+||.+.+|-.        .+.+++.+.++....-..+........... +.
T Consensus        74 ~~~pi~vGGGIrs~~~i~~~------l~~Ga~kvvigs~--------~~~~~~~~~~i~~~~G~~~ivvsiD~k~~~-v~  138 (240)
T PRK13585         74 TDVSIQLGGGIRSVEDAASL------LDLGVDRVILGTA--------AIENPELVRELSDEFGSERVMVSLDAKDGE-VV  138 (240)
T ss_pred             CCCCEEEECCCCCHHHHHHH------HHCCCCEEEECCC--------CHHCCHHHHHHHHHHCCCEEEEEEEEECCC-CC
T ss_conf             79778997885879999999------9769989993981--------131842889999873972179999930650-23


Q ss_pred             EECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             65057777488899999876449829998066555323457754463221135645424689999999740897489996
Q gi|254780434|r  214 LKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGT  293 (362)
Q Consensus       214 vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~  293 (362)
                      ++=--..+...+.++++.+.+.|+..+++++  ++++           |-++|+.     ++.++++++.+  ++|+|++
T Consensus       139 ~~gw~~~~~~~~~e~~~~~~~~g~~eii~td--I~~d-----------Gt~~G~d-----~~~~~~i~~~~--~~pvias  198 (240)
T PRK13585        139 IEGWTESTGKDPVEWAQRFEELGAGSILFTN--VDVE-----------GLLQGVN-----PEPVRELVDSV--DIPVIAS  198 (240)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHCCCCEEEEEE--ECCH-----------HHHCCCC-----HHHHHHHHHHC--CCCEEEE
T ss_conf             2476567886355777888863873589864--2332-----------2325789-----89999999868--9999998


Q ss_pred             CCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHH
Q ss_conf             788999999999983999754527877069789999999999
Q gi|254780434|r  294 GGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLS  335 (362)
Q Consensus       294 GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~  335 (362)
                      |||.+.+|..+.-.+|++.|-+++|+ |+|---++++++-++
T Consensus       199 GGv~s~~di~~l~~~g~~gvivG~Al-~~g~i~l~e~~~~~~  239 (240)
T PRK13585        199 GGVTSLDDVKALKEAGAAGVVVGSAL-YKGKFTLEEALEAAE  239 (240)
T ss_pred             CCCCCHHHHHHHHHCCCCEEEEEHHH-HCCCCCHHHHHHHHH
T ss_conf             89999999999997899789987687-679978999999964


No 99 
>PRK13139 consensus
Probab=98.46  E-value=4.1e-05  Score=54.23  Aligned_cols=208  Identities=18%  Similarity=0.220  Sum_probs=97.2

Q ss_pred             CCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH--HCCC
Q ss_conf             346-88--867798887403675241020013687899886268842555410000247777788999876410--0012
Q gi|254780434|r   61 AAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ--PTSP  135 (362)
Q Consensus        61 AaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~--~~~p  135 (362)
                      -+| +|  .+-+.++.+.+.|.-.+|+|==-..|-.-  .|-+. ...++++-|-+     ..+.+.+.+++.+  .+.|
T Consensus        23 taG~P~~e~s~~~~~~l~~~GaDiiElGiPFSDP~AD--GpvIq-~A~~~AL~~G~-----~~~~~~~~~~~~~~~~~~p   94 (254)
T PRK13139         23 VLGYPSLQANREVIRAMVAGGVDLMELQIPFSEPMAD--GPVIL-KANQAALAGGF-----KVRECFDFAREVVAAFNIP   94 (254)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHCCC-----CHHHHHHHHHHHHHCCCCC
T ss_conf             5848997999999999996699999978988886665--89999-99999997699-----7999999999997248976


Q ss_pred             CCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             10001104542467887765554206755269830333653221100002343211112244455655312688517865
Q gi|254780434|r  136 IGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLK  215 (362)
Q Consensus       136 i~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vK  215 (362)
                      +++=-=.|.--.-.+++|.+-+++.+  +|.+-+    |   ++.    .+.-.++.....          ...+..+-=
T Consensus        95 ivlM~Y~N~i~~~G~e~F~~~~~~~G--v~GvIi----p---DLP----~eE~~~~~~~~~----------~~gl~~I~l  151 (254)
T PRK13139         95 FLFMTYYNILFKYGVERFIDEVADIG--VKGLIV----P---DLP----PEQAQDYIAQCR----------AKGMAPIGI  151 (254)
T ss_pred             EEEEEEHHHHHHCCHHHHHHHHHHCC--CCEEEC----C---CCC----HHHHHHHHHHHH----------HCCCCEEEE
T ss_conf             89995259998709999999999759--985864----7---999----788999999998----------469757999


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC-
Q ss_conf             0577774888999998764498299980665553234577544632211356454246899999997408974899967-
Q gi|254780434|r  216 ISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTG-  294 (362)
Q Consensus       216 LsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~G-  294 (362)
                      ++|..+++.+..+++.     ++|++=.=+   +.++.        |.  -..+..-....+..+++.+  ++|| ++| 
T Consensus       152 vaPtt~~~Ri~~i~~~-----a~gFiY~vs---~~GvT--------G~--~~~~~~~~~~~i~~ik~~t--~~Pv-~vGF  210 (254)
T PRK13139        152 YAPTSTDERMGKIAAA-----ADGFIYCVA---RRGVT--------GS--KTSFDEHVGAFLHRCRAAT--PLPL-AVGF  210 (254)
T ss_pred             ECCCCCHHHHHHHHHC-----CCCEEEEEE---CCCCC--------CC--CCCCHHHHHHHHHHHHHCC--CCCE-EEEC
T ss_conf             4589998999999851-----698699996---66667--------98--8664588999999998558--9987-9973


Q ss_pred             CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             889999999999839997545278770
Q gi|254780434|r  295 GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       295 GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      ||.+++|+ +.+..+||.|=|+|+++-
T Consensus       211 GI~~~e~v-~~~~~~aDGvIVGSaiVk  236 (254)
T PRK13139        211 GVKSAADV-DYLKGKADIAVVGSQAIR  236 (254)
T ss_pred             CCCCHHHH-HHHHCCCCEEEECHHHHH
T ss_conf             77999999-999716999998889999


No 100
>PRK13119 consensus
Probab=98.43  E-value=5.5e-05  Score=53.40  Aligned_cols=225  Identities=20%  Similarity=0.250  Sum_probs=116.8

Q ss_pred             ECCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH---HC
Q ss_conf             5346-88--867798887403675241020013687899886268842555410000247777788999876410---00
Q gi|254780434|r   60 MAAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ---PT  133 (362)
Q Consensus        60 lAaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~---~~  133 (362)
                      +-+| +|  .+.+.++.+.+.|...+|+|==-..|..-  .|-+. ...++++-|-+     ..+.+++-+++.+   .+
T Consensus        21 ltaG~P~~e~s~~~l~~l~~~GadiiElGiPFSDP~AD--GPvIq-~A~~rAL~~G~-----~~~~~~~~~~~ir~~~~~   92 (261)
T PRK13119         21 ITVGDPDIRTTLALMHGMVANGADILELGVPFSDPMAD--GPVIQ-RAAERALANGI-----SLRDVLDVVRKFRETDTQ   92 (261)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHCCC-----CHHHHHHHHHHHHCCCCC
T ss_conf             64838998999999999996699999978988886665--89999-99999997799-----788999999986514899


Q ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             12100011045424678877655542067552698303336532211000023432111122444556553126885178
Q gi|254780434|r  134 SPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIF  213 (362)
Q Consensus       134 ~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~  213 (362)
                      .|+++=-=.|.--.-.+++|.+.+.+.  ++|.+-+    |--|       .+..+++.....          ...+.++
T Consensus        93 ~pivlMtY~N~i~~yG~e~F~~~~~~~--GvdGvIi----pDLP-------~ee~~~~~~~~~----------~~gl~~I  149 (261)
T PRK13119         93 TPVVLMGYLNPVHKMGYREFAQEAAKA--GVDGVLT----VDSP-------VETIDPLYRELK----------DNGVDCI  149 (261)
T ss_pred             CCEEEEECHHHHHHHHHHHHHHHHHHC--CCCEEEE----CCCC-------HHHHHHHHHHHH----------HCCCCEE
T ss_conf             898998403789886299999999975--9857983----6899-------788799999999----------7599764


Q ss_pred             EECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             65057777488899999876449829998066555323457754463221135645424689999999740897489996
Q gi|254780434|r  214 LKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGT  293 (362)
Q Consensus       214 vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~  293 (362)
                      .=++|..+++.+..+++.     +.|++=.=+   +.++        +|.  ......-..+.++.+|+.+  ++|| ++
T Consensus       150 ~lvaPtt~~~Ri~~i~~~-----a~gFiY~vs---~~Gv--------TG~--~~~~~~~~~~~i~~ik~~t--~~Pv-~v  208 (261)
T PRK13119        150 FLIAPTTTEDRIKTIAEL-----AGGFVYYVS---LKGV--------TGA--ASLDTDEVSRKIEYLHQYI--DIPI-GV  208 (261)
T ss_pred             EEECCCCCHHHHHHHHHH-----CCCEEEEEE---CCCC--------CCC--CCCCHHHHHHHHHHHHHCC--CCCE-EE
T ss_conf             430799989999999972-----898199973---6666--------687--7555488999999998636--9987-99


Q ss_pred             C-CCCCHHHHHHHHHCCCCEEEECHHHHCC----C---HHHHHHHHHHHHHH
Q ss_conf             7-8899999999998399975452787706----9---78999999999999
Q gi|254780434|r  294 G-GISSTKDALDKIMAGANLIQLYSAMIYE----G---ISLPKRIIQGLSDF  337 (362)
Q Consensus       294 G-GI~s~~Da~e~l~aGAs~VQi~Tali~~----G---p~~~~~I~~~L~~~  337 (362)
                      | ||.+++|+.+ +..+||.|=|+|+++-.    +   ..-+.+..++|++-
T Consensus       209 GFGIs~~e~v~~-~~~~aDGvIVGSaiV~~i~~~~~~~~~~v~~~vk~lk~a  259 (261)
T PRK13119        209 GFGISNAESARK-IGRVADAVIVGSRIVKEIENNAGNEAAAVGALVKELKDA  259 (261)
T ss_pred             EECCCCHHHHHH-HHCCCCEEEECHHHHHHHHHCCCCHHHHHHHHHHHHHHH
T ss_conf             836599999999-873499999828999999866887689999999999986


No 101
>PRK13135 consensus
Probab=98.41  E-value=9.8e-05  Score=51.73  Aligned_cols=205  Identities=19%  Similarity=0.219  Sum_probs=108.5

Q ss_pred             ECCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHH--CC
Q ss_conf             5346-88--8677988874036752410200136878998862688425554100002477777889998764100--01
Q gi|254780434|r   60 MAAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQP--TS  134 (362)
Q Consensus        60 lAaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~--~~  134 (362)
                      +-+| +|  .+.+.++.+.+.|...+|+|==...|-.  -.|-+. ....+++-|-     -..+.+++-+++.+.  +.
T Consensus        23 itaG~P~~~~s~~~l~~l~~~GaDiiElGiPfSDP~A--DGPvIq-~A~~rAL~~G-----~~~~~~~~~~~~~r~~~~~   94 (267)
T PRK13135         23 ITAGDPDLATTEALIPLLAESGADIIELGVPFSDPMA--DGPTIQ-LSSERALAAG-----TTLPRILAMVRSVRRRCQV   94 (267)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCC--CCHHHH-HHHHHHHHCC-----CCHHHHHHHHHHHHCCCCC
T ss_conf             7171899899999999999759999997899898666--589999-9999999769-----8499999999986335899


Q ss_pred             CCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             21000110454246788776555420675526983033365322110000234321111224445565531268851786
Q gi|254780434|r  135 PIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFL  214 (362)
Q Consensus       135 pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~v  214 (362)
                      |+++=-=.|.--.-.+++|.+.+.+.+  +|.+-+    |--|       .+...++.....          ...+.++-
T Consensus        95 PivlM~Y~N~i~~yG~e~F~~~~~~~G--vdGlIi----pDLP-------~ee~~~~~~~~~----------~~~l~~I~  151 (267)
T PRK13135         95 PIVLMGYYNPIFAYGLERFAADAAAAG--VDGVLL----VDLP-------PEEAEEFKACAD----------RHGLDVIF  151 (267)
T ss_pred             CEEEEECCHHHHHHHHHHHHHHHHHCC--CCEEEC----CCCC-------HHHHHHHHHHHH----------HCCCCEEE
T ss_conf             889984230998846899999999749--974763----7899-------788899999998----------72961899


Q ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEEE----CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             50577774888999998764498299980----66555323457754463221135645424689999999740897489
Q gi|254780434|r  215 KISPDLSEEELDDIAVEVLSHKVEGIIVS----NTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAI  290 (362)
Q Consensus       215 KLsPd~~~~~i~~ia~~a~~~g~dGiv~~----NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~I  290 (362)
                      =++|..+++.+..+++.     ..|++-.    .+|+.+.                 .+...-.+.+..+|+.+  ++||
T Consensus       152 lvsPtt~~~Ri~~i~~~-----s~GFiY~Vs~~GvTG~~~-----------------~~~~~~~~~i~~ik~~t--~~Pv  207 (267)
T PRK13135        152 LLTPTSDESRIRTVARL-----GRGFVYYVSVTGVTGARS-----------------GVEATVGGNVAKIREKI--TVPV  207 (267)
T ss_pred             EECCCCCHHHHHHHHHC-----CCCEEEEEECCCCCCCCC-----------------CCHHHHHHHHHHHHHHC--CCCE
T ss_conf             80898957999999961-----898189985456667764-----------------44488999999998606--8984


Q ss_pred             EEEC-CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             9967-889999999999839997545278770
Q gi|254780434|r  291 IGTG-GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       291 Ig~G-GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                       ++| ||.+++|+.+ +..+||.|=|+|+++-
T Consensus       208 -~vGFGI~~~e~v~~-i~~~ADGvIVGSaiVk  237 (267)
T PRK13135        208 -VVGFGISTPQQAAD-VAAMADGVVVGSALVK  237 (267)
T ss_pred             -EEEECCCCHHHHHH-HHCCCCEEEECHHHHH
T ss_conf             -89816799999999-9805999998789999


No 102
>PRK13116 consensus
Probab=98.40  E-value=4.2e-05  Score=54.19  Aligned_cols=207  Identities=19%  Similarity=0.226  Sum_probs=106.2

Q ss_pred             CCC-CCC--CHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH---HCC
Q ss_conf             346-888--67798887403675241020013687899886268842555410000247777788999876410---001
Q gi|254780434|r   61 AAG-YDK--NAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ---PTS  134 (362)
Q Consensus        61 AaG-~dk--~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~---~~~  134 (362)
                      -+| +|.  +.+.++.+.+.|...+|+|==-..|-.  -.|-+. ....+++-|-+     ..+.+++-+++.+   ++.
T Consensus        24 taG~P~~~~s~~~l~~l~~~GaDiiElGiPFSDP~A--DGPvIQ-~A~~rAL~~G~-----~~~~~~~~v~~ir~~~~~~   95 (278)
T PRK13116         24 MLSDPSPEEAFQIISTAIEAGADALELGVPFSDPVA--DGPTVA-ESHLRALDGGA-----TVDSALEQIKRVRAAYPEV   95 (278)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCC--CCHHHH-HHHHHHHHCCC-----CHHHHHHHHHHHCCCCCCC
T ss_conf             484899899999999999669999997999888566--689999-99999997698-----6789999999840358987


Q ss_pred             CCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             21000110454246788776555420675526983033365322110000234321111224445565531268851786
Q gi|254780434|r  135 PIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFL  214 (362)
Q Consensus       135 pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~v  214 (362)
                      |++.---.|..-...++.|++.++..+  +|.+-+    |.-|    +.+.   +++.....        +  ..+.++.
T Consensus        96 PivlM~Y~N~i~~~G~e~F~~~~~~aG--vdGlIi----pDLP----~eE~---~~~~~~~~--------~--~~i~~I~  152 (278)
T PRK13116         96 PIGMLIYGNVPFTRGLDRFYQEFAEAG--ADSILL----PDVP----VREG---APFSAAAA--------A--AGIDPIY  152 (278)
T ss_pred             CEEEEECCCHHHHCCHHHHHHHHHHCC--CCEEEE----CCCC----HHHH---HHHHHHHH--------H--CCCCEEE
T ss_conf             689980572887727999999997769--758994----6999----7888---99999998--------6--5766699


Q ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC--CCCCHHH-HHHHHHHHHHCCCCEEEE
Q ss_conf             5057777488899999876449829998066555323457754463221135--6454246-899999997408974899
Q gi|254780434|r  215 KISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSG--SPLFLKS-TIALAKIRQRVGPKIAII  291 (362)
Q Consensus       215 KLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG--~~i~~~a-l~~i~~i~~~~~~~i~II  291 (362)
                      =++|..+++.+..+++.     ++|++=.=+   +.            |..|  ....+.. ...|..+|+..  ++|| 
T Consensus       153 l~~ptt~~~ri~~I~~~-----s~GFiY~VS---~~------------GvTG~~~~~~~~~l~~~i~~ik~~t--~~Pv-  209 (278)
T PRK13116        153 IAPANASEKTLEGVSAA-----SKGYIYAIS---RD------------GVTGTERESSTDGLSAVVDNIKKFD--GAPI-  209 (278)
T ss_pred             EECCCCCHHHHHHHHHH-----CCCEEEEEE---CC------------CCCCCCCCCCHHHHHHHHHHHHHCC--CCCE-
T ss_conf             93799959999999971-----897399986---35------------2226886666789999999998457--9987-


Q ss_pred             EEC-CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             967-889999999999839997545278770
Q gi|254780434|r  292 GTG-GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       292 g~G-GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      ++| ||++++|+.+.+..+||-|=|+||++-
T Consensus       210 ~vGFGIs~~e~v~~~~~~~aDGVIVGSAiVk  240 (278)
T PRK13116        210 LLGFGISSPQHVADAIAAGASGAITGSAITK  240 (278)
T ss_pred             EEECCCCCHHHHHHHHHCCCCEEEECHHHHH
T ss_conf             9981679899999998668999998779999


No 103
>PRK13113 consensus
Probab=98.40  E-value=0.00013  Score=50.79  Aligned_cols=223  Identities=18%  Similarity=0.255  Sum_probs=112.9

Q ss_pred             ECCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH---HC
Q ss_conf             5346-88--867798887403675241020013687899886268842555410000247777788999876410---00
Q gi|254780434|r   60 MAAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ---PT  133 (362)
Q Consensus        60 lAaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~---~~  133 (362)
                      +-+| +|  .+.+.++.+.+.|...+|+|==...|..-  .|-+. ...++++-|-+     ..+.+++-+++.+   ..
T Consensus        23 itaG~P~~e~s~~~~~~l~~~GaDiiElGiPFSDP~AD--GPvIq-~A~~rAL~~G~-----~~~~~~~~v~~~r~~~~~   94 (263)
T PRK13113         23 VMAGDPDYDTSLEVMRGLPAAGVDIIELGMPFTDPMAD--GPTIQ-LAGQRALEGGM-----TLDRTLDMVRAFRKEDDT   94 (263)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHCCC-----CHHHHHHHHHHHHCCCCC
T ss_conf             73828997999999999997699999978988887765--89999-99999997798-----388999999975123899


Q ss_pred             CCCCCEEECCCC-CHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             121000110454-2467887765554206755269830333653221100002343211112244455655312688517
Q gi|254780434|r  134 SPIGINLGANKD-SKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPI  212 (362)
Q Consensus       134 ~pi~vsI~~~~~-s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi  212 (362)
                      .|+.+ .++.++ -.-.+++|++.++..+  +|.+-+    |   ++.    .+...++.....          ...+..
T Consensus        95 ~Pivl-M~Y~N~i~~~G~e~F~~~~~~~G--vdGvIi----p---DLP----~eE~~~~~~~~~----------~~~l~~  150 (263)
T PRK13113         95 TPIVM-MGYYNPIYSRGVDRFLAEAKEAG--IDGLIV----V---DLP----PEEDSELCLPAQ----------AAGLNF  150 (263)
T ss_pred             CCEEE-EECHHHHHHHHHHHHHHHHHHCC--CCEEEE----C---CCC----HHHHHHHHHHHH----------HCCCCE
T ss_conf             88899-83136898856999999987779--436971----7---999----788899999999----------779867


Q ss_pred             EEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             86505777748889999987644982999806655532345775446322113564542468999999974089748999
Q gi|254780434|r  213 FLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIG  292 (362)
Q Consensus       213 ~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg  292 (362)
                      +-=++|..+++.+..+++.+     +|++-.=+.   .++        +|.  ...+..-....+.++++.+  ++|+ .
T Consensus       151 I~lvaPtt~~~Ri~~i~~~a-----~gFiY~Vs~---~Gv--------TG~--~~~~~~~~~~~i~~ik~~t--~~Pv-~  209 (263)
T PRK13113        151 IRLATPTTDDRRLPKVLQNT-----SGFVYYVSI---TGI--------TGA--AAAQAADVAPEVARIKAAT--DLPV-I  209 (263)
T ss_pred             EEEECCCCCHHHHHHHHHCC-----CCCEEEEEC---CCC--------CCC--CCCCHHHHHHHHHHHHHCC--CCCE-E
T ss_conf             99947999999999998338-----984899834---556--------687--7554377999999998547--9988-9


Q ss_pred             EC-CCCCHHHHHHHHHCCCCEEEECHHHHC---CC--HHHHHHHHHHHHH
Q ss_conf             67-889999999999839997545278770---69--7899999999999
Q gi|254780434|r  293 TG-GISSTKDALDKIMAGANLIQLYSAMIY---EG--ISLPKRIIQGLSD  336 (362)
Q Consensus       293 ~G-GI~s~~Da~e~l~aGAs~VQi~Tali~---~G--p~~~~~I~~~L~~  336 (362)
                      +| ||.+++|+ +.+..+||.|=|+|+++-   +|  +.-+.+..++|++
T Consensus       210 vGFGI~~~e~~-~~~~~~ADGvIVGSa~v~~i~e~~~~~~~~~~v~~l~~  258 (263)
T PRK13113        210 VGFGITTPEAA-QAIAGVADGCVVGSAIVKLIGEGRPVAEVLAFVATLAD  258 (263)
T ss_pred             EECCCCCHHHH-HHHHCCCCEEEECHHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             98378998999-99973399999868999999828998999999999999


No 104
>pfam00977 His_biosynth Histidine biosynthesis protein. Proteins involved in steps 4 and 6 of the histidine biosynthesis pathway are contained in this family. Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes. The enzymes in this Pfam entry are called His6 and His7 in eukaryotes and HisA and HisF in prokaryotes. The structure of HisA is known to be a TIM barrel fold. In some archaeal HisA proteins the TIM barrel is composed of two tandem repeats of a half barrel. This family belong to the common phosphate binding site TIM barrel family.
Probab=98.39  E-value=1.3e-05  Score=57.52  Aligned_cols=164  Identities=15%  Similarity=0.169  Sum_probs=94.7

Q ss_pred             HHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             89998764100012100011045424678877655542067552698303336532211000023432111122444556
Q gi|254780434|r  122 TVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREE  201 (362)
Q Consensus       122 ~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~  201 (362)
                      .+++++.+.. ..|  +.+++.-.+.+.++.+      +..+||-+.+|=..        +.+++.+.++.+..-..+..
T Consensus        63 ~~i~~i~~~~-~~p--i~vgGGIrs~e~~~~~------l~~Ga~kvvigs~~--------~~~~~~~~~~~~~~g~q~iv  125 (229)
T pfam00977        63 DLIEEIAEEV-FIP--VQVGGGIRSLEDAERL------LSAGADKVIIGTAA--------VKNPELIKEAAEKFGSQCIV  125 (229)
T ss_pred             HHHHHHHHHC-CCC--EEEECCEEEHHHHHHH------HHCCCCEEEECCCH--------HHCHHHHHHHHHHCCCCCEE
T ss_conf             9999999866-987--8996456118999999------97699899958604--------30937899999980986479


Q ss_pred             HHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             55312688517865057777488899999876449829998066555323457754463221135645424689999999
Q gi|254780434|r  202 EKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIR  281 (362)
Q Consensus       202 ~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~  281 (362)
                      ........--++.+=....+...+.++++.+.+.|+..+++++  ++++           |-++|+.     +.++++++
T Consensus       126 ~siD~k~~~~v~~~~~~~~~~~~~~~~i~~~~~~g~~eii~td--i~~d-----------Gt~~G~d-----~~l~~~i~  187 (229)
T pfam00977       126 VAIDAKRDGKVAINGWREETGIDAVEWAKKLEELGAGEILLTD--IDRD-----------GTLSGPD-----LELTRELA  187 (229)
T ss_pred             EEEEECCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCEEEEEE--ECCC-----------CCCCCCC-----HHHHHHHH
T ss_conf             9998714517998064335674433445677651675068877--5042-----------7566689-----99999999


Q ss_pred             HHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCC
Q ss_conf             740897489996788999999999983999754527877069
Q gi|254780434|r  282 QRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEG  323 (362)
Q Consensus       282 ~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~G  323 (362)
                      +..  ++|+|++|||.+.+|..+....|++.|-++|+| |+|
T Consensus       188 ~~~--~~pii~~GGv~~~~di~~l~~~g~~gvivg~al-~~g  226 (229)
T pfam00977       188 EAV--NIPVIASGGVGSLEDLKELFSEGVDGVIAGSAL-HEG  226 (229)
T ss_pred             HHC--CCCEEEECCCCCHHHHHHHHHCCCCEEEEHHHH-HCC
T ss_conf             768--998999858999999999998799899985786-687


No 105
>pfam05690 ThiG Thiazole biosynthesis protein ThiG. This family consists of several bacterial thiazole biosynthesis protein G sequences. ThiG, together with ThiF and ThiH, is proposed to be involved in the synthesis of 4-methyl-5-(b-hydroxyethyl)thiazole (THZ) which is an intermediate in the thiazole production pathway.
Probab=98.39  E-value=0.00011  Score=51.39  Aligned_cols=210  Identities=17%  Similarity=0.193  Sum_probs=119.8

Q ss_pred             EECCEECCCCEEECCCCCCCHHHH-HHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHH
Q ss_conf             888733599748534688867798-8874036752410200136878998862688425554100002477777889998
Q gi|254780434|r   48 KVAGISLSNPLGMAAGYDKNAEVP-IELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSR  126 (362)
Q Consensus        48 ~~~Gl~~~nPiglAaG~dk~~~~~-~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~  126 (362)
                      ++.|.+|.+.+.+..|--++.+.+ +.+...|.--|   ||..+           |          +.+.+.+-+.+++.
T Consensus         1 ~I~~~~f~SRL~lGTgky~s~~~~~~ai~aSg~eiv---TVAlR-----------R----------~~~~~~~~~~~l~~   56 (246)
T pfam05690         1 KIGGKTFDSRLLLGTGKYPSPEVLKEAIRASGAEIV---TVALR-----------R----------VNAGQPGGENFLDL   56 (246)
T ss_pred             CCCCEEEECCEEEECCCCCCHHHHHHHHHHHCCCEE---EEEEE-----------E----------ECCCCCCCCHHHHH
T ss_conf             938888674447873899999999999999689779---98986-----------3----------05888884258886


Q ss_pred             HHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEE-CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             76410001210001104542467887765554206755269830-33365322110000234321111224445565531
Q gi|254780434|r  127 LSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTIN-ISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIK  205 (362)
Q Consensus       127 l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiN-iSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~  205 (362)
                      ++..+  ..+--|-.+-.+.+|++. .+++.+++.. .|.+-|- ++-|+           .|........++.+.....
T Consensus        57 i~~~~--~~iLPNTAGc~tA~EAVr-~A~laRE~~~-t~wIKLEVi~D~~-----------~LlPD~~etl~Aae~Lv~e  121 (246)
T pfam05690        57 LDWLG--ITLLPNTAGCRTAEEAVR-TARLAREAFG-TNWIKLEVIGDSK-----------TLLPDPIETLKAAEILVKE  121 (246)
T ss_pred             HHHCC--CEECCCCCCCCCHHHHHH-HHHHHHHHCC-CCEEEEEEECCCC-----------CCCCCHHHHHHHHHHHHHC
T ss_conf             41338--667776301188999999-9999999709-9748999826988-----------7798878999999999978


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             26885178650577774888999998764498299980665553234577544632211356454246899999997408
Q gi|254780434|r  206 TGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVG  285 (362)
Q Consensus       206 ~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~  285 (362)
                      .   .-|+.    +.+++  ..+++.+++.|+..+--         +-.+.     |  ||..|..  ...++.+++.. 
T Consensus       122 G---F~Vlp----Y~~~D--~v~akrLed~Gc~avMP---------lgsPI-----G--Sg~Gl~n--~~~l~~i~e~~-  173 (246)
T pfam05690       122 G---FTVLP----YTTDD--PVLARRLEEAGCAAVMP---------LGAPI-----G--SGLGLRN--PENLRIIIEEA-  173 (246)
T ss_pred             C---CEEEE----ECCCC--HHHHHHHHHCCCEEEEE---------CCCCC-----C--CCCCCCC--HHHHHHHHHHC-
T ss_conf             9---98988----61799--89999998759849862---------24401-----3--6888689--99999999967-


Q ss_pred             CCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC-CCHH
Q ss_conf             974899967889999999999839997545278770-6978
Q gi|254780434|r  286 PKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY-EGIS  325 (362)
Q Consensus       286 ~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~-~Gp~  325 (362)
                       ++|+|--.||-++.||.+-|..|||+|-+-||... +.|-
T Consensus       174 -~vPvIVDAGiG~pS~Aa~aMElG~DaVLvNTAIA~A~dPv  213 (246)
T pfam05690       174 -DVPVIVDAGIGTPSDAAQAMELGADAVLLNTAIARAKDPV  213 (246)
T ss_pred             -CCCEEEECCCCCHHHHHHHHHCCCCEEEHHHHHHCCCCHH
T ss_conf             -9988984898967889999974567777306777379989


No 106
>PRK13122 consensus
Probab=98.37  E-value=4.1e-05  Score=54.24  Aligned_cols=225  Identities=18%  Similarity=0.167  Sum_probs=115.5

Q ss_pred             CEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHH--CC
Q ss_conf             7485346888677988874036752410200136878998862688425554100002477777889998764100--01
Q gi|254780434|r   57 PLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQP--TS  134 (362)
Q Consensus        57 PiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~--~~  134 (362)
                      |++ .+++| .-+.++.+.+.|+..+|+|==-..|..-  .|-+. ...++++-|-     -..+.+.+.+++.+.  +.
T Consensus         7 pyi-~g~pd-~~~~~~~l~~~GaDiiElGiPfSDP~AD--GpvIQ-~A~~rAL~~G-----~~~~~~~~~l~~~r~~~~~   76 (242)
T PRK13122          7 PYI-MGNKD-LIENATLLSENGADIIEIGVPFSDPVAD--GPVIM-EAGQQAIKQG-----ITIDYIFNQLEKHGDQIKC   76 (242)
T ss_pred             EEE-CCCCC-HHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHCC-----CCHHHHHHHHHHHCCCCCC
T ss_conf             762-68999-9999999997599999978988886665--89999-9999999769-----9899999999973136798


Q ss_pred             CCCCEEECCCCC--HHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             210001104542--467887765554206755269830333653221100002343211112244455655312688517
Q gi|254780434|r  135 PIGINLGANKDS--KDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPI  212 (362)
Q Consensus       135 pi~vsI~~~~~s--~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi  212 (362)
                      |++  ++.-.+.  .-..+.|.+.+.+.  ++|.+-+    |--|      . +.-.++....        .+  ..+..
T Consensus        77 piv--lM~Y~N~i~~~G~~~F~~~~~~~--GvdGvIi----pDLP------~-ee~~~~~~~~--------~~--~gi~~  131 (242)
T PRK13122         77 NYV--LMTYYNIICHYGEQAFFEKCRDT--GVYGLII----PDLP------Y-ELSQRLKQQF--------SH--YGVKI  131 (242)
T ss_pred             CEE--EEEECHHHHHHCHHHHHHHHHHC--CCCEEEC----CCCC------H-HHHHHHHHHH--------HH--CCCCE
T ss_conf             779--99851698872799999999876--9986777----8998------7-8899999999--------86--79868


Q ss_pred             EEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             86505777748889999987644982999806655532345775446322113564542468999999974089748999
Q gi|254780434|r  213 FLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIG  292 (362)
Q Consensus       213 ~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg  292 (362)
                      +-=++|..+++.+..+++.+     +|++=.=+   +.++...          -..+.+...+.+..+|+..  ++|| .
T Consensus       132 I~lvaPtt~~~Ri~~i~~~s-----~GFiY~vs---~~GvTG~----------~~~~~~~~~~~i~~ik~~t--~~Pv-~  190 (242)
T PRK13122        132 ISLVAMTTDDKRIKDIVSHA-----EGFIYTVT---MNATTGQ----------NGAFHPELKRKIESIKAIA--NVPV-V  190 (242)
T ss_pred             EEEECCCCCHHHHHHHHHHC-----CCCEEEEE---CCCCCCC----------CCCCCHHHHHHHHHHHHHC--CCCE-E
T ss_conf             98718999899999999829-----99669873---3543576----------5556588999999999725--9985-8


Q ss_pred             EC-CCCCHHHHHHHHHCCCCEEEECHHHHC----CCHHHHHHHHHHHHHHH
Q ss_conf             67-889999999999839997545278770----69789999999999999
Q gi|254780434|r  293 TG-GISSTKDALDKIMAGANLIQLYSAMIY----EGISLPKRIIQGLSDFL  338 (362)
Q Consensus       293 ~G-GI~s~~Da~e~l~aGAs~VQi~Tali~----~Gp~~~~~I~~~L~~~l  338 (362)
                      +| ||.+++|+.+. ..+||.|=|+|+++-    +++.-+.+-.++|++-|
T Consensus       191 vGFGI~~~e~v~~i-~~~ADGvIVGSaivk~i~~~~~e~~~~~i~~l~~aL  240 (242)
T PRK13122        191 AGFGIRTPQHVADI-KEVADGIVIGSEIVKRFKSNTREEIIKYLQSIQQTL  240 (242)
T ss_pred             EECCCCCHHHHHHH-HHHCCEEEECHHHHHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             71587999999999-811999998489999999679899999999999985


No 107
>PRK13123 consensus
Probab=98.36  E-value=9.9e-05  Score=51.69  Aligned_cols=208  Identities=21%  Similarity=0.178  Sum_probs=109.9

Q ss_pred             CCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCC
Q ss_conf             346-88--867798887403675241020013687899886268842555410000247777788999876410001210
Q gi|254780434|r   61 AAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIG  137 (362)
Q Consensus        61 AaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~  137 (362)
                      -+| +|  .+.+.++.+.+.|+..+|+|==-..|..-  .|-+. ...++++-|-+     ..+.+++.+++.+.+.|+.
T Consensus        22 taG~P~~~~~~~~i~~l~~~GaDiiElGiPFSDPvAD--GPvIq-~A~~rAL~~G~-----~~~~~~~~~~~~~~~~Piv   93 (256)
T PRK13123         22 MAGDGGLDGLKETIRFLEEAGVSAIEIGIPFSDPVAD--GPVIQ-LAGLRALASGV-----SLKAILQALIEKETQIPLV   93 (256)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHCCC-----CHHHHHHHHHHCCCCCCEE
T ss_conf             1868997899999999997699999978998886665--79999-98999986799-----6999998876305799889


Q ss_pred             CEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             00110454246788776555420675526983033365322110000234321111224445565531268851786505
Q gi|254780434|r  138 INLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKIS  217 (362)
Q Consensus       138 vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLs  217 (362)
                      +=-=.|.--.-.+++|.+-+++.+  +|.+-+    |.-|       .+...++.....          ...+..+-=++
T Consensus        94 lMtY~N~i~~yG~e~F~~~~~~~G--vdGvIi----pDLP-------~eE~~~~~~~~~----------~~gi~~I~lia  150 (256)
T PRK13123         94 IMTYINPVFQYGIERFVEDLAETG--VKGLII----PDLP-------YEHQDFIAPLLR----------DTDIALIPLVS  150 (256)
T ss_pred             EEEHHHHHHHCCHHHHHHHHHHCC--CCEEEC----CCCC-------HHHHHHHHHHHH----------HCCCCEEEECC
T ss_conf             740425898718999999999749--978973----7999-------678999999999----------76997786408


Q ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC-CC
Q ss_conf             77774888999998764498299980665553234577544632211356454246899999997408974899967-88
Q gi|254780434|r  218 PDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTG-GI  296 (362)
Q Consensus       218 Pd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~G-GI  296 (362)
                      |..+++.+..+++.+     +|++=.=+   +.++.        |.  -..+.+.....++.+++.+  ++|+ ++| ||
T Consensus       151 Ptt~~~Ri~~i~~~a-----~GFiY~Vs---~~GvT--------G~--~~~~~~~~~~~i~~ik~~t--~~Pv-~vGFGI  209 (256)
T PRK13123        151 LTSPIERQKEIIKEA-----EGFIYAVA---VNGVT--------GK--RGNYRDDLDSHLEKLKSIA--HIPV-LAGFGI  209 (256)
T ss_pred             CCCCHHHHHHHHHCC-----CCCEEEEE---CCCCC--------CC--CCCCHHHHHHHHHHHHHCC--CCCE-EEECCC
T ss_conf             999388999998607-----88489974---45566--------76--5333388999999998568--9987-997688


Q ss_pred             CCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             9999999999839997545278770
Q gi|254780434|r  297 SSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       297 ~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      ++.+|+.+. ...||.|=|+|+++-
T Consensus       210 s~~e~v~~~-~~~aDGvIVGSaiv~  233 (256)
T PRK13123        210 STLEDVERF-NAVCDGVIVGSKIVE  233 (256)
T ss_pred             CCHHHHHHH-HHHCCEEEEHHHHHH
T ss_conf             999999999-713999997299999


No 108
>pfam00290 Trp_syntA Tryptophan synthase alpha chain.
Probab=98.36  E-value=7.3e-05  Score=52.58  Aligned_cols=210  Identities=19%  Similarity=0.223  Sum_probs=111.1

Q ss_pred             ECCC-CCC--CHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH---HC
Q ss_conf             5346-888--67798887403675241020013687899886268842555410000247777788999876410---00
Q gi|254780434|r   60 MAAG-YDK--NAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ---PT  133 (362)
Q Consensus        60 lAaG-~dk--~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~---~~  133 (362)
                      +-+| +|.  +.+.++.+.+.|...+|+|==-..|-.  -.|-+. ....+++-|-     -.++.+++.+++.+   .+
T Consensus        15 i~aG~P~~~~~~~~i~~l~~~GaDiiEiGiPFSDP~A--DGpvIq-~A~~~AL~~G-----~~~~~~~~~~~~~r~~~~~   86 (258)
T pfam00290        15 VTAGDPDLETTLEILEALEEAGADAIELGIPFSDPLA--DGPTIQ-RANLRALAGG-----MTLDQTLELVEEIRNKGTS   86 (258)
T ss_pred             EECCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCC--CCHHHH-HHHHHHHHCC-----CCHHHHHHHHHHHHHCCCC
T ss_conf             7073899899999999999769999997899888766--589999-9999999869-----9699999999985512899


Q ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             12100011045424678877655542067552698303336532211000023432111122444556553126885178
Q gi|254780434|r  134 SPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIF  213 (362)
Q Consensus       134 ~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~  213 (362)
                      .|+++=-=.|.--.-..+.|.+.+++.+  +|.+-+    |.-|       .+...++.....          ...+.++
T Consensus        87 ~pivlM~Y~N~i~~~G~e~F~~~~~~~G--vdGvIi----pDLP-------~eE~~~~~~~~~----------~~~l~~I  143 (258)
T pfam00290        87 VPIVLMTYYNPVLNYGIERFYAQAAEAG--VDGLII----PDLP-------PEEADPLREAAE----------KHGIDLI  143 (258)
T ss_pred             CCEEEEEECHHHHHCCHHHHHHHHHHCC--CCEEEC----CCCC-------HHHHHHHHHHHH----------HCCCCEE
T ss_conf             8889985208898729999999999759--977870----7999-------889999999998----------4584358


Q ss_pred             EECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             65057777488899999876449829998066555323457754463221135645424689999999740897489996
Q gi|254780434|r  214 LKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGT  293 (362)
Q Consensus       214 vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~  293 (362)
                      -=++|..+++.+..+++.+     +|++-.=+   +.++        +|  +...+.+.-...++.+|+..  ++||...
T Consensus       144 ~lvsPtt~~~Ri~~i~~~s-----~gFiY~vs---~~Gv--------TG--~~~~~~~~~~~~i~~ik~~t--~~Pv~vG  203 (258)
T pfam00290       144 FLVAPTTSDERLKTISEAA-----SGFVYLVS---RAGV--------TG--ARNAFNAQLDELVERLKKYT--NVPVAVG  203 (258)
T ss_pred             EEECCCCCHHHHHHHHHHC-----CCEEEEEE---CCCC--------CC--CCCCCCHHHHHHHHHHHHCC--CCCEEEE
T ss_conf             8845888199999999608-----98089985---3445--------67--65556388999999998606--9984899


Q ss_pred             CCCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             7889999999999839997545278770
Q gi|254780434|r  294 GGISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       294 GGI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      =||++.+|+.+. ..+||.|=++|+++-
T Consensus       204 FGIs~~e~v~~~-~~~aDGvIVGSaiv~  230 (258)
T pfam00290       204 FGISTPEHVKKI-AAGADGVIVGSAIVD  230 (258)
T ss_pred             ECCCCHHHHHHH-HCCCCEEEECHHHHH
T ss_conf             457999999999-815999998499999


No 109
>PRK00208 thiG thiazole synthase; Reviewed
Probab=98.32  E-value=0.00021  Score=49.47  Aligned_cols=212  Identities=17%  Similarity=0.206  Sum_probs=121.1

Q ss_pred             EEECCEECCCCEEECCCCCCCHHHH-HHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHH
Q ss_conf             6888733599748534688867798-887403675241020013687899886268842555410000247777788999
Q gi|254780434|r   47 TKVAGISLSNPLGMAAGYDKNAEVP-IELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFS  125 (362)
Q Consensus        47 ~~~~Gl~~~nPiglAaG~dk~~~~~-~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~  125 (362)
                      -++.|.+|+|.+.+..|--++.+.+ +.+...|.--|   ||..+           |          +.+.+.+-+.+++
T Consensus         2 l~I~~~~f~SRLilGTgky~s~~~~~~ai~aSg~eiv---TVAlR-----------R----------~~~~~~~~~~~l~   57 (256)
T PRK00208          2 LTIAGKTFSSRLLLGTGKYPSPEVMQEAIEASGAEIV---TVALR-----------R----------VNLGDPGGDNLLD   57 (256)
T ss_pred             CEECCEEEECCEEEECCCCCCHHHHHHHHHHHCCCEE---EEEEE-----------E----------ECCCCCCCHHHHH
T ss_conf             1899999774347864899999999999999689779---99986-----------4----------2477898505888


Q ss_pred             HHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             87641000121000110454246788776555420675526983033365322110000234321111224445565531
Q gi|254780434|r  126 RLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIK  205 (362)
Q Consensus       126 ~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~  205 (362)
                      .++..  +..+--|-.+-.+.+|++. .+++.+++.. .|.+-|-+-          .|+..|........++.+.....
T Consensus        58 ~i~~~--~~~lLPNTAGc~ta~EAVr-~A~laRE~~~-tnwIKLEVi----------~D~~~LlPD~~etl~Aae~Lv~e  123 (256)
T PRK00208         58 LLDPL--GVTLLPNTAGCRTAEEAVR-TARLAREALG-TDWIKLEVI----------GDDKTLLPDPIETLKAAEILVKE  123 (256)
T ss_pred             HHCCC--CCEECCCCCCCCCHHHHHH-HHHHHHHHHC-CCEEEEEEE----------CCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             74315--8567666403267999999-9999999848-986999981----------79767798868999999999988


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             26885178650577774888999998764498299980665553234577544632211356454246899999997408
Q gi|254780434|r  206 TGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVG  285 (362)
Q Consensus       206 ~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~  285 (362)
                      .   .-|+    |+.+++  .-+++.+++.|+..+--         +-.+. .      ||..|..  ...++.++++. 
T Consensus       124 G---F~Vl----pY~~~D--~v~akrLe~~Gc~avMP---------lgsPI-G------Sg~Gl~n--~~~l~~i~e~~-  175 (256)
T PRK00208        124 G---FVVL----PYCTDD--PVLAKRLEEAGCAAVMP---------LGAPI-G------SGLGLLN--PYNLRIIIEQA-  175 (256)
T ss_pred             C---CEEE----EECCCC--HHHHHHHHHCCCEEEEE---------CCCCC-C------CCCCCCC--HHHHHHHHHHC-
T ss_conf             9---9897----867889--89999999749534520---------45643-4------7988799--99999999867-


Q ss_pred             CCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC-CCHH
Q ss_conf             974899967889999999999839997545278770-6978
Q gi|254780434|r  286 PKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY-EGIS  325 (362)
Q Consensus       286 ~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~-~Gp~  325 (362)
                       ++|+|---||-++.||.+-|..|||+|-+-||... +.|-
T Consensus       176 -~vPvIVDAGiG~pS~Aa~AMElG~DaVL~NTAIA~A~dPv  215 (256)
T PRK00208        176 -DVPVIVDAGIGTPSDAAQAMELGADAVLLNTAIAVAGDPV  215 (256)
T ss_pred             -CCCEEEECCCCCHHHHHHHHHCCCCEEEHHHHHHCCCCHH
T ss_conf             -9988985788976678999862554323556877269989


No 110
>PRK00507 deoxyribose-phosphate aldolase; Provisional
Probab=98.31  E-value=2.2e-05  Score=56.15  Aligned_cols=86  Identities=23%  Similarity=0.290  Sum_probs=65.2

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             57777488899999876449829998066555323457754463221135645424689999999740897489996788
Q gi|254780434|r  217 SPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGI  296 (362)
Q Consensus       217 sPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI  296 (362)
                      ++.++++++...++.+.++|+|.|=- .|                |--+    ...+.+.|+.+++..++++.|-++|||
T Consensus       130 t~~Lt~~ei~~a~~~~~~aGadfvKT-ST----------------Gf~~----~gat~e~v~~m~~~~~~~~giKasGGI  188 (221)
T PRK00507        130 TCLLTDEEKVKACEICKEAGADFVKT-ST----------------GFST----GGATVEDVKLMRETVGPRVGVKASGGI  188 (221)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCEEEE-CC----------------CCCC----CCCCHHHHHHHHHHHCCCCEEECCCCC
T ss_conf             46599999999999999829787860-58----------------8788----998999999999972878638677898


Q ss_pred             CCHHHHHHHHHCCCCEEEECHHHHCCCHHHHH
Q ss_conf             99999999998399975452787706978999
Q gi|254780434|r  297 SSTKDALDKIMAGANLIQLYSAMIYEGISLPK  328 (362)
Q Consensus       297 ~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~  328 (362)
                      .+.+||.+|+.+||+-+...+     |+.++.
T Consensus       189 rt~~~a~~~l~aGa~riGtS~-----~~~i~~  215 (221)
T PRK00507        189 RTLEDALAMIEAGATRLGTSA-----GVAILE  215 (221)
T ss_pred             CCHHHHHHHHHHCCHHCCCCC-----HHHHHH
T ss_conf             999999999982751321675-----899995


No 111
>PRK13121 consensus
Probab=98.30  E-value=0.00023  Score=49.20  Aligned_cols=208  Identities=20%  Similarity=0.268  Sum_probs=103.9

Q ss_pred             CCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHH---HHCC
Q ss_conf             346-88--86779888740367524102001368789988626884255541000024777778899987641---0001
Q gi|254780434|r   61 AAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKI---QPTS  134 (362)
Q Consensus        61 AaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~---~~~~  134 (362)
                      -+| +|  .+.+.++.+.+.|...+|+|==-..|-.-  .|-+. ....+++-|-+     ..+.+++-+++.   ..+.
T Consensus        24 taG~P~~~~s~~~~~~l~~~GaDiiElGiPfSDP~AD--GPvIq-~A~~rAL~~G~-----~~~~~~~~~~~~r~~~~~~   95 (265)
T PRK13121         24 TAGDPDPAKTVELMHALVEGGADVIELGVPFSDPMAD--GPVIQ-RASERALAHGV-----SLRQVLAMVKEFRETNQTT   95 (265)
T ss_pred             ECCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHCCC-----CHHHHHHHHHHHHCCCCCC
T ss_conf             0718998999999999997699999978988997765--89999-99999997799-----8467799999831037999


Q ss_pred             CCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             21000110454246788776555420675526983033365322110000234321111224445565531268851786
Q gi|254780434|r  135 PIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFL  214 (362)
Q Consensus       135 pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~v  214 (362)
                      |+++=-=.|.--.-.+++|.+.+...+  +|.+-+    |--|       .|...++......          ..+..+.
T Consensus        96 PivlM~Y~N~i~~yG~e~F~~~~~~aG--vdGlIi----pDLP-------~eE~~~~~~~~~~----------~gl~~I~  152 (265)
T PRK13121         96 PVVLMGYANPIERMGYDAFAAAARAAG--VDGVLV----VDYP-------PEECEEFAAKMRA----------AGIDPIF  152 (265)
T ss_pred             CEEEEEHHHHHHHHHHHHHHHHHHHCC--CCEEEC----CCCC-------HHHHHHHHHHHHH----------CCCCEEE
T ss_conf             989862145999971999999998729--873434----8999-------8999999999986----------5996689


Q ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             50577774888999998764498299980665553234577544632211356454246899999997408974899967
Q gi|254780434|r  215 KISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTG  294 (362)
Q Consensus       215 KLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~G  294 (362)
                      =++|..+++.+..+++.     .+|++-.=+   +.++.        |.  .....+.....+..+|+.+  ++|+ ++|
T Consensus       153 lvaPtt~~~Ri~~i~~~-----~~gFiY~Vs---~~GvT--------G~--~~~~~~~~~~~i~~ik~~t--~~Pv-~vG  211 (265)
T PRK13121        153 LLAPTSTDERIAAVARV-----ASGYVYYVS---LKGVT--------GA--ATLDVSSVAAKLPAIRSHV--PLPV-GVG  211 (265)
T ss_pred             EECCCCCHHHHHHHHHH-----CCCEEEEEE---CCCCC--------CC--CCCCHHHHHHHHHHHHHCC--CCCE-EEE
T ss_conf             95899989999999962-----898099975---55566--------77--7566288999999998547--9985-997


Q ss_pred             -CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             -889999999999839997545278770
Q gi|254780434|r  295 -GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       295 -GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                       ||.+.+||.+ +..+||.|=|+|+++-
T Consensus       212 FGIs~~e~~~~-v~~~ADGvIVGSaiV~  238 (265)
T PRK13121        212 FGIRDAATARA-VAEVADAVVIGSRLVQ  238 (265)
T ss_pred             CCCCCHHHHHH-HHHCCCEEEECHHHHH
T ss_conf             68898999999-9811999998489999


No 112
>TIGR00742 yjbN TIM-barrel protein, yjbN family; InterPro: IPR004653   This family represents one branch of COG0042 from COG (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family) although NifR3 itself, a protein of unknown function associated with nitrogen regulation in Rhodobacter capsulatus, is not a member of this branch. Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also in some archaea. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA . They show a distant relationship to alpha/beta (TIM) barrel enzymes such as dihydroorotate dehydrogenase and glycolate oxidase.; GO: 0016491 oxidoreductase activity, 0050660 FAD binding, 0008033 tRNA processing.
Probab=98.28  E-value=8.3e-06  Score=58.95  Aligned_cols=201  Identities=18%  Similarity=0.211  Sum_probs=134.5

Q ss_pred             HHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCC--CCEEEEECCCC-----CCC-CCCCCCCHHHHHHHHHHHHHH
Q ss_conf             7641000121000110454246788776555420675--52698303336-----532-211000023432111122444
Q gi|254780434|r  127 LSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTI--ASYFTINISSP-----NTP-GLRSLQKKKNLERLLIHVMQT  198 (362)
Q Consensus       127 l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~--aD~iEiNiSCP-----Nt~-g~~~~~~~~~l~~~l~~v~~~  198 (362)
                      |+-.....||-+-||++.     -++..+|++....+  =|=+-||+.||     |.. |--.|..++.+.+.+.+..+ 
T Consensus        48 l~~~~~E~PvAlQlgg~d-----p~~l~~ca~i~e~h~gydEiNLNVGCPSdrvQng~fGACLMg~a~lVa~cv~~M~~-  121 (326)
T TIGR00742        48 LKFSPEEKPVALQLGGSD-----PNDLAKCAKIAEKHRGYDEINLNVGCPSDRVQNGNFGACLMGNADLVADCVKAMQE-  121 (326)
T ss_pred             HCCCCCCCCEEEEECCCC-----HHHHHHHHHHHHHHCCCCEEECCCCCCCHHHHCCCCCHHHCCCHHHHHHHHHHHHH-
T ss_conf             501767786578507898-----89999999999864587422156688312220444111111682368999999897-


Q ss_pred             HHHHHHHCCCCCEEEEEC-------CCC---CCHHHHHHHHHHHHHCC-CCEEEEECCCCCCCCCCCCCCCCCCCCCCC-
Q ss_conf             556553126885178650-------577---77488899999876449-829998066555323457754463221135-
Q gi|254780434|r  199 REEEKIKTGKFVPIFLKI-------SPD---LSEEELDDIAVEVLSHK-VEGIIVSNTTLSRKGVQCSDNHEQDGGLSG-  266 (362)
Q Consensus       199 ~~~~~~~~~~~~Pi~vKL-------sPd---~~~~~i~~ia~~a~~~g-~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG-  266 (362)
                              .+.+||-||-       |.|   -+-+++.++++.+...| +.-+++    -+|...        --|||= 
T Consensus       122 --------~v~iPvtvK~RiGId~~ssdykndSYe~l~~Fv~~v~~~Gec~~Fiv----HARkAw--------L~GlSPK  181 (326)
T TIGR00742       122 --------AVEIPVTVKHRIGIDELSSDYKNDSYEELCDFVEIVSGKGECQNFIV----HARKAW--------LSGLSPK  181 (326)
T ss_pred             --------HCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHHHH----HHHHHH--------HCCCCCC
T ss_conf             --------15788224201475644332232337899999998617886113468----789998--------5788862


Q ss_pred             --CCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             --645424689999999740897489996788999999999983999754527877069789999999999999983899
Q gi|254780434|r  267 --SPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEV  344 (362)
Q Consensus       267 --~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~  344 (362)
                        +.|=|.-=..|+++++.. +++.|-=-|||.+-|++.+.|-- -|.|+||.+ .|+-|.++..+-+++-.  +.+-.-
T Consensus       182 eNR~IPpL~y~~VYqLKkdf-p~L~i~INGGI~~~E~~k~HL~~-vD~VMvGR~-Ay~NP~l~A~~dr~~~~--~~~~~~  256 (326)
T TIGR00742       182 ENREIPPLRYERVYQLKKDF-PHLTIEINGGIKNSEQIKQHLSH-VDGVMVGRE-AYENPYLLANVDREIFN--ETDEIL  256 (326)
T ss_pred             CCCCCCCCCCHHHHHHHCCC-CCCEEEECCCCCCHHHHHHHHHH-HHHHHHCHH-HHHCHHHHHHHHHHHHC--CCCCCC
T ss_conf             25787798724677652003-21056335785535999976556-431130224-30052689999899707--787777


Q ss_pred             CHHHHHCCCCHHHH
Q ss_conf             77896169752664
Q gi|254780434|r  345 NFENIRGSYTEYWA  358 (362)
Q Consensus       345 si~e~iG~~~~~~~  358 (362)
                      +-.|++-+.++|--
T Consensus       257 ~~~~i~~~M~pYie  270 (326)
T TIGR00742       257 TRKEIVEQMLPYIE  270 (326)
T ss_pred             CHHHHHHHHHHHHH
T ss_conf             97999998679999


No 113
>PRK13120 consensus
Probab=98.27  E-value=0.00028  Score=48.66  Aligned_cols=209  Identities=22%  Similarity=0.265  Sum_probs=105.3

Q ss_pred             ECCC-CCC--CHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHH---HHC
Q ss_conf             5346-888--6779888740367524102001368789988626884255541000024777778899987641---000
Q gi|254780434|r   60 MAAG-YDK--NAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKI---QPT  133 (362)
Q Consensus        60 lAaG-~dk--~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~---~~~  133 (362)
                      +-|| +|.  +.+.++.+.+.|...+|+|==-..|-.-  .|-+. ....+++-|  |++   .+.+++-+++.   ...
T Consensus        27 itaG~P~~~~t~~~l~~l~~~GaDiiElGiPFSDPvAD--GPvIQ-~A~~rAL~~--G~~---l~~vl~~v~~~r~~~~~   98 (285)
T PRK13120         27 IAAGDPSPQATVPLMHALVRAGADLVELGVPFSDPMAD--GPVVQ-RAAERAIAQ--GVG---LRRVLELVADFRRDDSV   98 (285)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHC--CCC---HHHHHHHHHHHHHCCCC
T ss_conf             57858998999999999997699999978987874566--89999-999999976--998---44699999998734898


Q ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             12100011045424678877655542067552698303336532211000023432111122444556553126885178
Q gi|254780434|r  134 SPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIF  213 (362)
Q Consensus       134 ~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~  213 (362)
                      .|+.+=-=.|.--.-..+.|.+-+++.+  +|.+-|    |   ++.    .+.-.++.....          ...+.++
T Consensus        99 ~PivlM~Y~Npi~~yG~e~F~~~~~~aG--vdGlII----p---DLP----~EE~~~~~~~~~----------~~gi~~I  155 (285)
T PRK13120         99 TPVVLMGYANPIERMGQRAFAQAAQAAG--VDGVLV----V---DYP----PEEVDEFAAMLA----------EAGVAPI  155 (285)
T ss_pred             CCEEEEEHHHHHHHHHHHHHHHHHHHCC--CCEEEC----C---CCC----HHHHHHHHHHHH----------HCCCCEE
T ss_conf             8889861054999987999999999839--877964----7---999----799999999999----------6699658


Q ss_pred             EECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             65057777488899999876449829998066555323457754463221135645424689999999740897489996
Q gi|254780434|r  214 LKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGT  293 (362)
Q Consensus       214 vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~  293 (362)
                      -=++|..+++.+..+++.+     .|++=.=+   +.++        +|  +...+.......+..+++.+  ++|| ++
T Consensus       156 ~LiaPtT~~eRi~~I~~~s-----~GFvY~VS---~~GV--------TG--~~~~~~~~l~~~i~~ik~~t--~~Pv-~v  214 (285)
T PRK13120        156 FLLAPTSTEARIEAIGRVA-----RGYVYYVS---LKGV--------TG--AGSLDTDDVARKLALIRRHV--HIPV-GV  214 (285)
T ss_pred             EEECCCCCHHHHHHHHHHC-----CCCEEEEE---CCCC--------CC--CCCCCHHHHHHHHHHHHHCC--CCCE-EE
T ss_conf             9957999899999999508-----98189986---5654--------68--87556688999999999726--9975-99


Q ss_pred             C-CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             7-889999999999839997545278770
Q gi|254780434|r  294 G-GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       294 G-GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      | ||.+++||.+. ...||.|=|+|+++-
T Consensus       215 GFGIs~~e~v~~~-~~~ADGvIVGSAiVk  242 (285)
T PRK13120        215 GFGIRDAASAQRI-AAHADAVVIGSKLIE  242 (285)
T ss_pred             EECCCCHHHHHHH-HCCCCEEEECHHHHH
T ss_conf             9625989999999-702999998789999


No 114
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional
Probab=98.25  E-value=0.00022  Score=49.38  Aligned_cols=209  Identities=22%  Similarity=0.293  Sum_probs=107.5

Q ss_pred             ECCC-CCC--CHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH--HCC
Q ss_conf             5346-888--67798887403675241020013687899886268842555410000247777788999876410--001
Q gi|254780434|r   60 MAAG-YDK--NAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ--PTS  134 (362)
Q Consensus        60 lAaG-~dk--~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~--~~~  134 (362)
                      +-+| +|.  +.+.++.+.+.|...+|+|==-..|..  -.|-+. ....+++-|-     -..+.+.+-+++.+  .+.
T Consensus        15 ~taG~P~~e~~~~~~~~l~~~Gad~iEiGiPfSDP~a--DGpvIq-~a~~~AL~~G-----~~~~~~f~~~~~~r~~~~~   86 (256)
T PRK13111         15 ITAGDPDLETSLEILKALVEAGADIIELGIPFSDPVA--DGPVIQ-RASLRALAAG-----VTLADVLELLREIRAKPTI   86 (256)
T ss_pred             EECCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCC--CCHHHH-HHHHHHHHCC-----CCHHHHHHHHHHHHCCCCC
T ss_conf             7070899899999999999659999997888788766--579999-9999999779-----9699999999998606899


Q ss_pred             CCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             21000110454246788776555420675526983033365322110000234321111224445565531268851786
Q gi|254780434|r  135 PIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFL  214 (362)
Q Consensus       135 pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~v  214 (362)
                      |+++=-=.|.--.-.+++|.+.+++.+  +|.+-+    |--|       .+...++..+..+          ..+..+-
T Consensus        87 pivlM~Y~N~i~~~G~e~F~~~~~~~G--vdGvIi----pDLP-------~eE~~~~~~~~~~----------~gi~~I~  143 (256)
T PRK13111         87 PIVLMTYYNPIFQYGVEAFAADAAEAG--VDGLII----PDLP-------PEEAEEFRAAAKK----------HGIDLIF  143 (256)
T ss_pred             CEEEEEECCHHHHHCHHHHHHHHHHCC--CCEEEE----CCCC-------HHHHHHHHHHHHH----------CCCEEEE
T ss_conf             889985030898709999999999759--977981----6999-------7888999999997----------5980899


Q ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             50577774888999998764498299980665553234577544632211356454246899999997408974899967
Q gi|254780434|r  215 KISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTG  294 (362)
Q Consensus       215 KLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~G  294 (362)
                      =++|..+++.+..+++.+     +|++=.=+   +.++.        | . ...+...-...+.++|+..  ++||. +|
T Consensus       144 lvaPtt~~~Ri~~i~~~s-----~gfiY~vs---~~GvT--------G-~-~~~~~~~~~~~i~~ik~~t--~~Pi~-vG  202 (256)
T PRK13111        144 LVAPTTTDERLKKIASHA-----SGFVYYVS---RAGVT--------G-A-RSADAADVADLLARLKAHT--DLPVA-VG  202 (256)
T ss_pred             EECCCCCHHHHHHHHHHC-----CCEEEEEE---CCCCC--------C-C-CCCCHHHHHHHHHHHHHCC--CCCEE-EE
T ss_conf             969999889999999626-----98599985---67767--------8-8-7666288999999998706--89758-85


Q ss_pred             -CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             -889999999999839997545278770
Q gi|254780434|r  295 -GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       295 -GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                       ||.+++|+.+.. .|||.|=++|+++-
T Consensus       203 FGIs~~e~v~~~~-~~aDGvIVGSaiv~  229 (256)
T PRK13111        203 FGISTPEQAAAIA-EGADGVIVGSALVK  229 (256)
T ss_pred             CCCCCHHHHHHHH-CCCCEEEECHHHHH
T ss_conf             2889999999997-45999998689999


No 115
>PRK13134 consensus
Probab=98.23  E-value=0.00024  Score=49.13  Aligned_cols=204  Identities=18%  Similarity=0.219  Sum_probs=101.1

Q ss_pred             CCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHH--CCC
Q ss_conf             346-88--8677988874036752410200136878998862688425554100002477777889998764100--012
Q gi|254780434|r   61 AAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQP--TSP  135 (362)
Q Consensus        61 AaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~--~~p  135 (362)
                      -+| +|  .+.+.++.+.+.|.-.+|+|==...|..-  .|-+. -...+++-|-+     ..+.+++.+++.+.  +.|
T Consensus        26 taG~P~~e~s~~~i~~l~~~GaDiiEiGiPfSDP~AD--GPvIq-~A~~rAL~~G~-----~~~~~~~~~~~~~~~~~~p   97 (257)
T PRK13134         26 TAGFPTSERFWDELEALDAAGADIIEVGVPFSDPVAD--GPVVA-AASQRALESGV-----TLRWIMDGLAARKGRLRAG   97 (257)
T ss_pred             ECCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHCCC-----CHHHHHHHHHHHHCCCCCC
T ss_conf             0707997999999999997799999978988887655--89999-99999996799-----8789999999874468999


Q ss_pred             CCCEEECCCC--CHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             1000110454--24678877655542067552698303336532211000023432111122444556553126885178
Q gi|254780434|r  136 IGINLGANKD--SKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIF  213 (362)
Q Consensus       136 i~vsI~~~~~--s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~  213 (362)
                      +++  +...+  -.-.+++|.+.+.+.+  +|.+-+    |.-|    +.+.+.+.   ..+.          ...+.++
T Consensus        98 ivl--MtY~N~i~~yG~e~F~~~~~~aG--vdGvIi----pDLP----~eE~~~~~---~~~~----------~~gi~~I  152 (257)
T PRK13134         98 LVL--MGYLNPFMQYGFERFVRDAADAG--VAGCII----PDLP----LDEDADLR---ALLA----------ARGMDLI  152 (257)
T ss_pred             EEE--EECCHHHHHHHHHHHHHHHHHCC--CCEEEE----CCCC----HHHHHHHH---HHHH----------HCCCCEE
T ss_conf             899--85345999746899999998679--875994----6999----77889999---9999----------7598269


Q ss_pred             EECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCC--CCCHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             650577774888999998764498299980665553234577544632211356--454246899999997408974899
Q gi|254780434|r  214 LKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGS--PLFLKSTIALAKIRQRVGPKIAII  291 (362)
Q Consensus       214 vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~--~i~~~al~~i~~i~~~~~~~i~II  291 (362)
                      -=++|..+++.+..+++.     ..|++=.=+   +.            |..|.  .+.......+.++++.+  ++|+ 
T Consensus       153 ~lvaPtt~~~Ri~~i~~~-----s~gFIY~vs---~~------------GvTG~~~~~~~~~~~~i~~ik~~t--~~Pv-  209 (257)
T PRK13134        153 ALVGPNTGEGRMREYAAV-----ASGYVYVVS---VM------------GTTGVRDGLPVEVADTLARARQCF--SIPV-  209 (257)
T ss_pred             EECCCCCCHHHHHHHHHH-----CCCEEEEEE---CC------------CCCCCCCCCHHHHHHHHHHHHHHC--CCCE-
T ss_conf             963899999999999962-----888089984---35------------566876455288999999999706--9987-


Q ss_pred             EEC-CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             967-889999999999839997545278770
Q gi|254780434|r  292 GTG-GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       292 g~G-GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      .+| ||.+++|+ +.+..+||.|=|+|+++-
T Consensus       210 ~vGFGIs~~e~v-~~~~~~aDGvIVGSaiVk  239 (257)
T PRK13134        210 ALGFGISRPAQL-EGLSHPPDAVIFGSALLR  239 (257)
T ss_pred             EEECCCCCHHHH-HHHHCCCCEEEECHHHHH
T ss_conf             998067999999-999703999998799999


No 116
>PRK13138 consensus
Probab=98.23  E-value=0.00017  Score=50.08  Aligned_cols=207  Identities=18%  Similarity=0.195  Sum_probs=110.6

Q ss_pred             ECCC-CCC--CHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHH---HHC
Q ss_conf             5346-888--6779888740367524102001368789988626884255541000024777778899987641---000
Q gi|254780434|r   60 MAAG-YDK--NAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKI---QPT  133 (362)
Q Consensus        60 lAaG-~dk--~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~---~~~  133 (362)
                      +-+| +|.  +.+.++.+.+.|...+|+|==-..|..  -.|-+. -..++++-|-+     ..+.+++-+++.   ..+
T Consensus        19 itaG~P~~e~t~~~~~~l~~~GadiiEiGiPFSDP~A--DGPvIq-~A~~rAL~~G~-----~~~~~~~~~~~ir~~~~~   90 (264)
T PRK13138         19 ISLGDPDYDSCIIWADALIRGGAGILELGIPFSDPVA--DGPVIQ-KAFKRALAHPF-----SMDKILEITAEIHKLHPE   90 (264)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCC--CCHHHH-HHHHHHHHCCC-----CHHHHHHHHHHHCCCCCC
T ss_conf             6787999899999999999779998997998888666--589999-99999997799-----088974467760335898


Q ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             12100011045424678877655542067552698303336532211000023432111122444556553126885178
Q gi|254780434|r  134 SPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIF  213 (362)
Q Consensus       134 ~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~  213 (362)
                      .|++.--=.|.--.-.+++|.+.++..+  +|.+-+    |   ++.  .+.+...++...+.          ...+.++
T Consensus        91 ~pivlM~Y~N~i~~~G~e~F~~~~~~~G--vdGlIi----p---DLP--~e~~E~~~~~~~~~----------~~~i~~I  149 (264)
T PRK13138         91 IPLVYLTYFNPLFSMGLEAFTERAKNSG--IQGLII----P---DLP--FDTPEAEEFFSQLE----------RKKIDFI  149 (264)
T ss_pred             CCEEEEEEHHHHHHHCHHHHHHHHHHCC--CCEEEC----C---CCC--CCCHHHHHHHHHHH----------HCCCCEE
T ss_conf             8889752123898848999999998769--775853----6---898--65033599999999----------8699867


Q ss_pred             EECCCCCCHHHHHHHHHHHHHCCCCEEEEE----CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             650577774888999998764498299980----6655532345775446322113564542468999999974089748
Q gi|254780434|r  214 LKISPDLSEEELDDIAVEVLSHKVEGIIVS----NTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIA  289 (362)
Q Consensus       214 vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~----NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~  289 (362)
                      .=++|..+++.+..+++.+     +|++=.    .+|+.+.                 .+.......+..+|+.+  ++|
T Consensus       150 ~liaPtt~~~Ri~~i~~~s-----~gFiY~Vs~~GvTG~~~-----------------~~~~~~~~~i~~ik~~t--~~P  205 (264)
T PRK13138        150 HLVTPATTEDRIQSMKSFA-----SGFIYYVTSYGVTGERG-----------------AIASGLEDRIQMVRKIV--GLP  205 (264)
T ss_pred             EECCCCCCHHHHHHHHHHC-----CCEEEEEECCCCCCCCC-----------------CCCHHHHHHHHHHHHHC--CCC
T ss_conf             5217999899999999738-----88089875456678765-----------------55376999999999743--898


Q ss_pred             EEEEC-CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             99967-889999999999839997545278770
Q gi|254780434|r  290 IIGTG-GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       290 IIg~G-GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      + ++| ||.+++|+.+ +..+||.|=++|+++-
T Consensus       206 v-~vGFGIs~~e~~~~-~~~~ADGvIVGSaiv~  236 (264)
T PRK13138        206 V-CAGFGISTADQAKE-ISTYADGVIIGSAVQK  236 (264)
T ss_pred             E-EEEECCCCHHHHHH-HHHCCCEEEECHHHHH
T ss_conf             3-88606798999999-9834999998199999


No 117
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated
Probab=98.23  E-value=6.7e-05  Score=52.82  Aligned_cols=173  Identities=17%  Similarity=0.195  Sum_probs=98.8

Q ss_pred             HHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             89998764100012100011045424678877655542067552698303336532211000023432111122444556
Q gi|254780434|r  122 TVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREE  201 (362)
Q Consensus       122 ~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~  201 (362)
                      .+++++.+   ...+-+.+|+.--+.+.++.      .+..+||-+.+|=..        +.+++.+.++....-. +..
T Consensus        63 ~~I~~i~~---~~~~pi~vGGGIrs~e~~~~------~l~~GadkVvigS~a--------~~n~~~i~~~~~~~g~-~iv  124 (241)
T PRK00748         63 ELIEAIVA---AVDIPVQLGGGIRDLETVEA------YLDAGVARVIIGTAA--------VKNPELVKEACKKFPG-RIV  124 (241)
T ss_pred             HHHHHHHH---HCCCCEEEECCCCCHHHHHH------HHHCCCCEEEECCHH--------HHCHHHHHHHHHHCCC-CEE
T ss_conf             99999998---67999998277074999999------997697758864710--------3396899999862355-579


Q ss_pred             HHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             55312688517865057777488899999876449829998066555323457754463221135645424689999999
Q gi|254780434|r  202 EKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIR  281 (362)
Q Consensus       202 ~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~  281 (362)
                      ........ -+..+=--..+.-.+.++++.+.+.|+..+++++  +++++           -++|+.     +..++.++
T Consensus       125 vsiD~k~~-~v~~~gw~~~t~~~~~~~i~~~~~~G~~eii~td--I~~DG-----------t~~G~d-----~~l~~~i~  185 (241)
T PRK00748        125 VGLDARDG-KVATRGWQEVSGVDLEDLAKRFEDAGVAAIIYTD--ISRDG-----------TLSGPN-----VELTRELA  185 (241)
T ss_pred             EEEEECCC-EEECCCCCCCCCCCHHHHHHHHHHCCCCEEEEEE--EECCC-----------CCCCCC-----HHHHHHHH
T ss_conf             99982166-5401575546797489999999855875699988--70568-----------547689-----99999999


Q ss_pred             HHCCCCEEEEEECCCCCHHHHHHHHHC---CCCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             740897489996788999999999983---99975452787706978999999999
Q gi|254780434|r  282 QRVGPKIAIIGTGGISSTKDALDKIMA---GANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       282 ~~~~~~i~IIg~GGI~s~~Da~e~l~a---GAs~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                      +.+  ++|+|++|||.|.+|..+....   |.+.|-+++|+ |+|---+++.++.+
T Consensus       186 ~~~--~ipviasGGv~s~~Di~~L~~~~~~gv~gviiG~Al-y~g~i~l~eal~~~  238 (241)
T PRK00748        186 AAT--PIPVIASGGVSSLDDIRALKALGPEGVEGVIVGKAL-YEGKFDLAEALACW  238 (241)
T ss_pred             HHC--CCCEEEECCCCCHHHHHHHHHCCCCCCCEEEEEHHH-HCCCCCHHHHHHHH
T ss_conf             868--998999889999999999986031792489987898-77998999999986


No 118
>CHL00162 thiG thiamin biosynthesis protein G; Validated
Probab=98.23  E-value=0.00058  Score=46.50  Aligned_cols=215  Identities=18%  Similarity=0.166  Sum_probs=118.7

Q ss_pred             EEEECCEECCCCEEECCCCCCCHHHHH-HHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHH
Q ss_conf             168887335997485346888677988-8740367524102001368789988626884255541000024777778899
Q gi|254780434|r   46 NTKVAGISLSNPLGMAAGYDKNAEVPI-ELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVF  124 (362)
Q Consensus        46 ~~~~~Gl~~~nPiglAaG~dk~~~~~~-~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~  124 (362)
                      .-++.|.+|++.+.+..|--++.+.++ .+...|.--|   ||..+           |...        + .+.+.+.++
T Consensus         7 ~l~I~g~~f~SRLilGTgkY~s~~~~~~ai~aSgaeiV---TVAlR-----------R~~~--------~-~~~~~~~~l   63 (267)
T CHL00162          7 PLKIGNKSFNSRLMLGTGKYRNLEEAINSIEASGCEIV---TVAIR-----------RAQN--------N-KLNGNSSLL   63 (267)
T ss_pred             CEEECCEEEECCEEEECCCCCCHHHHHHHHHHHCCCEE---EEEEE-----------CCCC--------C-CCCCHHHHH
T ss_conf             66999999885327872899999999999999699879---99973-----------2557--------7-888746787


Q ss_pred             HHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHC-----CCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             9876410001210001104542467887765554206-----75526983033365322110000234321111224445
Q gi|254780434|r  125 SRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFF-----TIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTR  199 (362)
Q Consensus       125 ~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~-----~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~  199 (362)
                      +.++..+  ..+--|-.+-.+.+|++. .+++.|++.     ...+.+-|-+          ..|+..|........++.
T Consensus        64 ~~i~~~~--~~~LPNTAGc~taeEAVr-~A~lAREl~~~~g~~~tnwIKLEV----------i~D~~tLlPD~~etl~Aa  130 (267)
T CHL00162         64 DGLDWNK--LWLLPNTAGCQTAEEAIR-VAFLGRELAKQLGQEDNNFVKLEV----------IPDPKYLLPDPIGTLKAA  130 (267)
T ss_pred             HHCCCCC--EEECCCCCCCCCHHHHHH-HHHHHHHHHHHCCCCCCCEEEEEE----------ECCCCCCCCCHHHHHHHH
T ss_conf             4337024--178566302287999999-999999985301567897799998----------279877798878999999


Q ss_pred             HHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             56553126885178650577774888999998764498299980665553234577544632211356454246899999
Q gi|254780434|r  200 EEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAK  279 (362)
Q Consensus       200 ~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~  279 (362)
                      +......   .-|+    |+.+++  .-+++.+++.|+..+--         +-.+. .      ||..|..  ...++.
T Consensus       131 e~Lv~eG---F~Vl----pY~~dD--~v~akrLe~~Gc~avMP---------lgsPI-G------Sg~Gl~n--~~~l~~  183 (267)
T CHL00162        131 EFLVRKG---FTVL----PYINAD--PVLAKQLEDIGCATVMP---------LGSPI-G------SGQGLQN--LLNLQI  183 (267)
T ss_pred             HHHHHCC---CEEE----EECCCC--HHHHHHHHHCCCEEEEE---------CCCCC-C------CCCCCCC--HHHHHH
T ss_conf             9999789---9998----954899--89999998659868863---------45512-3------6887589--999999


Q ss_pred             HHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC-CCHH
Q ss_conf             997408974899967889999999999839997545278770-6978
Q gi|254780434|r  280 IRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY-EGIS  325 (362)
Q Consensus       280 i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~-~Gp~  325 (362)
                      +++.  .++|+|--.||-++.||.+-|..|||+|-+-||... +.|-
T Consensus       184 i~e~--~~vPvIVDAGiG~pSdAa~aMElG~DaVL~NTAIA~A~dPv  228 (267)
T CHL00162        184 IIEN--AKIPVIIDAGIGTPSEASQAMELGASGVLLNTAVAKAKNPE  228 (267)
T ss_pred             HHHC--CCCCEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCCHH
T ss_conf             9964--89988996898967888999974677787016767169989


No 119
>cd04732 HisA HisA.  Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase catalyzes the fourth step in histidine biosynthesis, an isomerisation of the aminoaldose moiety of ProFAR to the aminoketose of PRFAR (N-(5'-phospho-D-1'-ribulosylformimino)-5-amino-1-(5''-phospho-ribosyl)-4-imidazolecarboxamide). In bacteria and archaea, ProFAR isomerase is encoded by the HisA gene.
Probab=98.22  E-value=2.9e-05  Score=55.33  Aligned_cols=138  Identities=22%  Similarity=0.211  Sum_probs=82.8

Q ss_pred             HCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             06755269830333653221100002343211112244455655312688517865057777488899999876449829
Q gi|254780434|r  160 FFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEG  239 (362)
Q Consensus       160 ~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dG  239 (362)
                      +..++|.+.+|-..        +.+++.+.++....-............. -+..+--.+.+.-.+.++++.+.+.|+..
T Consensus        92 ~~~Ga~kvvi~s~~--------~~~~~~~~~~~~~~G~q~iv~slD~k~~-~~~~~~~~~~~~~~~~~~i~~~~~~g~ge  162 (234)
T cd04732          92 LDLGVSRVIIGTAA--------VKNPELVKELLKEYGGERIVVGLDAKDG-KVATKGWLETSEVSLEELAKRFEELGVKA  162 (234)
T ss_pred             HHCCCCEEEECCCH--------HHCHHHHHHHHHHCCCCCEEEEEEEECC-CHHCCCCCEEECCCHHHHHHHHHHCCCCE
T ss_conf             86488718971401--------1082789999998297646999997512-00016864001351699999997458646


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHH
Q ss_conf             99806655532345775446322113564542468999999974089748999678899999999998399975452787
Q gi|254780434|r  240 IIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAM  319 (362)
Q Consensus       240 iv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tal  319 (362)
                      +++++  ++++           |-++|+-     ++.+.++++..  ++|+|++|||.+.+|..+...+|++.|-++|||
T Consensus       163 iilt~--i~~d-----------Gt~~G~d-----~~ll~~i~~~~--~~p~i~~GGv~s~~di~~l~~~g~~gvivgsAl  222 (234)
T cd04732         163 IIYTD--ISRD-----------GTLSGPN-----FELYKELAAAT--GIPVIASGGVSSLDDIKALKELGVAGVIVGKAL  222 (234)
T ss_pred             EEEEE--ECCC-----------CCCCCCC-----HHHHHHHHHHC--CCCEEEEECCCCHHHHHHHHHCCCCEEEEEHHH
T ss_conf             99876--4256-----------6535689-----99999998657--998999818999999999997799899998898


Q ss_pred             HCCCHHHH
Q ss_conf             70697899
Q gi|254780434|r  320 IYEGISLP  327 (362)
Q Consensus       320 i~~Gp~~~  327 (362)
                       |+|---+
T Consensus       223 -h~g~i~~  229 (234)
T cd04732         223 -YEGKITL  229 (234)
T ss_pred             -HCCCCCH
T ss_conf             -7799898


No 120
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional
Probab=98.22  E-value=0.00049  Score=47.02  Aligned_cols=215  Identities=15%  Similarity=0.111  Sum_probs=121.5

Q ss_pred             CCEEEECCEECCCCEEECCCCCCCHHH-HHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHH
Q ss_conf             311688873359974853468886779-8887403675241020013687899886268842555410000247777788
Q gi|254780434|r   44 RLNTKVAGISLSNPLGMAAGYDKNAEV-PIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHT  122 (362)
Q Consensus        44 ~L~~~~~Gl~~~nPiglAaG~dk~~~~-~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~  122 (362)
                      +=+-.+.|.+|.+.+.+..|--++.+. .+.+...|.--|   ||..+           |          +.+.+++-+.
T Consensus        73 ~D~l~i~G~~f~SRL~~GTgky~s~~~~~~ai~aSgaeiv---TVAlR-----------R----------~~~~~~~~~~  128 (327)
T PRK11840         73 DDSWTVAGKTFSSRLLVGTGKYKDFEETAAAVEASGAEIV---TVAVR-----------R----------VNVSDPGAPM  128 (327)
T ss_pred             CCCEEECCEEEEEEEEEECCCCCCHHHHHHHHHHHCCCEE---EEEEE-----------E----------ECCCCCCCCH
T ss_conf             9976899988880178765899999999999998589769---99997-----------4----------2378889605


Q ss_pred             HHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99987641000121000110454246788776555420675526983033365322110000234321111224445565
Q gi|254780434|r  123 VFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEE  202 (362)
Q Consensus       123 ~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~  202 (362)
                      +++.++..+  ..+--|-.+-.+.+|++. .+++.+++. ..+.+-|-+          ..|+..|........++....
T Consensus       129 ~l~~i~~~~--~~~LPNTAGc~ta~eAvr-~a~lARe~~-~t~~iKLEV----------i~D~~tL~Pd~~etl~Aae~L  194 (327)
T PRK11840        129 LTDYIDPKK--YTYLPNTAGCFTAEDAVR-TLRLAREAG-GWDLVKLEV----------LGDQKTLYPDMVETLKAAEVL  194 (327)
T ss_pred             HHHHCCCCC--CEECCCCCCCCCHHHHHH-HHHHHHHHC-CCCEEEEEE----------ECCCCCCCCCHHHHHHHHHHH
T ss_conf             776418027--779985657788999999-999999855-998589998----------079766799858999999999


Q ss_pred             HHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             53126885178650577774888999998764498299980665553234577544632211356454246899999997
Q gi|254780434|r  203 KIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQ  282 (362)
Q Consensus       203 ~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~  282 (362)
                      ....   .-++    |+.+++  .-+++.+++.|+..+--         +-.+. .      ||..|..  ...++.+++
T Consensus       195 v~eG---F~Vl----pY~~dD--pv~akrLed~Gc~avMP---------lgsPI-G------Sg~Gi~n--~~~i~~i~e  247 (327)
T PRK11840        195 VKEG---FQVM----VYCSDD--PIAAKRLEDAGAVAVMP---------LGAPI-G------SGLGIQN--PYTIRLIVE  247 (327)
T ss_pred             HHCC---CEEE----EEECCC--HHHHHHHHHCCCEEEEE---------CCCCC-C------CCCCCCC--HHHHHHHHH
T ss_conf             9789---8898----871698--68999998759838862---------24523-4------7888689--999999997


Q ss_pred             HCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC-CCHH
Q ss_conf             408974899967889999999999839997545278770-6978
Q gi|254780434|r  283 RVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY-EGIS  325 (362)
Q Consensus       283 ~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~-~Gp~  325 (362)
                      ..  ++|+|---||-++.||.+.|..|+|+|-+-||... +.|-
T Consensus       248 ~~--~vpvivDAGiG~pS~A~~aMElG~daVL~NTAiA~a~~Pv  289 (327)
T PRK11840        248 GA--KVPVLVDAGVGTASDAAVAMELGCDGVLMNTAIAEAKNPI  289 (327)
T ss_pred             HC--CCCEEEECCCCCHHHHHHHHHCCCCEEEHHHHHHCCCCHH
T ss_conf             36--9978995798987899999863666666336767269979


No 121
>PRK13132 consensus
Probab=98.21  E-value=0.00019  Score=49.75  Aligned_cols=210  Identities=17%  Similarity=0.162  Sum_probs=107.3

Q ss_pred             CEEECCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHC
Q ss_conf             7485346-88--86779888740367524102001368789988626884255541000024777778899987641000
Q gi|254780434|r   57 PLGMAAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPT  133 (362)
Q Consensus        57 PiglAaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~  133 (362)
                      |. +-+| +|  .+.+.++.+.+.|...+|+|==...|-.  -.|-+. ....+++-|-     -..+.+.+-+++.+.+
T Consensus        15 ~y-itaG~P~~e~s~~~~~~l~~~GaDiiEiGiPfSDP~a--DGPvIq-~A~~~AL~~G-----~~~~~~~~~~~~ir~~   85 (246)
T PRK13132         15 GY-IVAGYPNLETTKEFLQRLDESPLDILELGIPYSDPLA--DGKLIA-DASFIALQQG-----VNTDTVFELLARVKTK   85 (246)
T ss_pred             EE-EECCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCC--CCHHHH-HHHHHHHHCC-----CCHHHHHHHHHHHCCC
T ss_conf             78-8285899899999999999749998997898888765--589999-9999998779-----9899999999975369


Q ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             12100011045424678877655542067552698303336532211000023432111122444556553126885178
Q gi|254780434|r  134 SPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIF  213 (362)
Q Consensus       134 ~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~  213 (362)
                      .|+++=--.|..-...+++|.+.+.+.+  +|.+-+    |.-|       .+...++......        .  .+.++
T Consensus        86 ~pivlM~Y~N~i~~~G~e~F~~~~~~~G--vdGlIi----pDLP-------~ee~~~~~~~~~~--------~--~i~~I  142 (246)
T PRK13132         86 KALVFLVYYNLIFAYGLEKFVKKAKELG--ISGLIV----PDLP-------FEESEELIKECEK--------Y--NIALI  142 (246)
T ss_pred             CCEEEEEECHHHHHCCHHHHHHHHHHCC--CCEEEC----CCCC-------HHHHHHHHHHHHH--------C--CCCEE
T ss_conf             9979996010887729999999998769--985775----7999-------7898999999998--------5--99701


Q ss_pred             EECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             65057777488899999876449829998066555323457754463221135645424689999999740897489996
Q gi|254780434|r  214 LKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGT  293 (362)
Q Consensus       214 vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~  293 (362)
                      -=++| .+.+.+..+++.     ++|++-.=+   +.++.        |.-  ....+.-...+..+++..  +.|+ .+
T Consensus       143 ~lvaP-Ts~~R~~~i~~~-----s~gfiY~vs---~~GvT--------G~~--~~~~~~~~~~i~~ik~~t--~~Pv-~v  200 (246)
T PRK13132        143 PLISV-TSPKRAKKILKH-----AKGFIYALG---SIGVT--------GTK--SVEEARLKDKVKEIKSFT--DLPV-AV  200 (246)
T ss_pred             EEECC-CCHHHHHHHHHC-----CCCCEEEEE---CCCCC--------CCC--CCCHHHHHHHHHHHHHCC--CCCE-EE
T ss_conf             44257-978999999954-----898279975---35677--------776--663688999999999628--9986-99


Q ss_pred             C-CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             7-889999999999839997545278770
Q gi|254780434|r  294 G-GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       294 G-GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      | ||.+++|+.. +..+||.|=++|+++-
T Consensus       201 GFGI~~~e~v~~-~~~~aDGvIVGSa~v~  228 (246)
T PRK13132        201 GFGIKNNQDVKR-MRKYADGVIVGTSIVK  228 (246)
T ss_pred             ECCCCCHHHHHH-HHHCCCEEEECHHHHH
T ss_conf             779899999999-9822999997099999


No 122
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA). TPRS is a bifunctional tetrameric enzyme (2 alpha and 2 beta subunits) that catalyzes the last two steps of L-tryptophan biosynthesis. Alpha and beta subunit catalyze two distinct reactions which are both strongly stimulated by the formation of the complex. The alpha subunit catalyzes the cleavage of indole 3-glycerol phosphate (IGP) to indole and d-glyceraldehyde 3-phosphate (G3P). Indole is then channeled to the active site of the beta subunit, a PLP-dependent enzyme that catalyzes a replacement reaction to convert L-serine into L-tryptophan.
Probab=98.20  E-value=0.00026  Score=48.84  Aligned_cols=209  Identities=22%  Similarity=0.282  Sum_probs=111.5

Q ss_pred             ECCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHH--CC
Q ss_conf             5346-88--8677988874036752410200136878998862688425554100002477777889998764100--01
Q gi|254780434|r   60 MAAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQP--TS  134 (362)
Q Consensus        60 lAaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~--~~  134 (362)
                      +-+| ++  .+.+.++.+.+.|...+|+|==...|-.-  .|-+. ...++++-|  |   -..+.+.+-+++.+.  +.
T Consensus         6 ~taG~P~~~~~~~~~~~l~~~G~d~iEiGiPfsDP~aD--GpvIq-~A~~~aL~~--g---~~~~~~~~~~~~~r~~~~~   77 (242)
T cd04724           6 ITAGDPDLETTLEILKALVEAGADIIELGIPFSDPVAD--GPVIQ-AASERALAN--G---VTLKDVLELVKEIRKKNTI   77 (242)
T ss_pred             EECCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHC--C---CCHHHHHHHHHHHHHCCCC
T ss_conf             73778997999999999997699999978998887765--89999-999999976--9---9499999999998734798


Q ss_pred             CCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             21000110454246788776555420675526983033365322110000234321111224445565531268851786
Q gi|254780434|r  135 PIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFL  214 (362)
Q Consensus       135 pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~v  214 (362)
                      |+++=-=.|.--....++|.+.+++.+  +|.+-+    |--|-       +....+.....          ...+..+-
T Consensus        78 pivlM~Y~N~i~~~G~e~F~~~~~~~G--v~Gvii----pDLP~-------ee~~~~~~~~~----------~~~i~~I~  134 (242)
T cd04724          78 PIVLMGYYNPILQYGLERFLRDAKEAG--VDGLII----PDLPP-------EEAEEFREAAK----------EYGLDLIF  134 (242)
T ss_pred             CEEEEEECHHHHHHCHHHHHHHHHHCC--CCEEEE----CCCCH-------HHHHHHHHHHH----------HCCCEEEE
T ss_conf             889998445766528999999999759--975870----69995-------78468999998----------65983889


Q ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             50577774888999998764498299980665553234577544632211356454246899999997408974899967
Q gi|254780434|r  215 KISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTG  294 (362)
Q Consensus       215 KLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~G  294 (362)
                      =++|..+++.+..+++.     ++|++-.=+.   .++.        |  +...+..-..+.+.++|+..  ++|| .+|
T Consensus       135 lvsPtt~~~ri~~i~~~-----s~gfiY~vs~---~GvT--------G--~~~~~~~~~~~~i~~ik~~t--~~Pv-~vG  193 (242)
T cd04724         135 LVAPTTPDERIKKIAEL-----ASGFIYYVSR---TGVT--------G--ARTELPDDLKELIKRIRKYT--DLPI-AVG  193 (242)
T ss_pred             EECCCCCHHHHHHHHHH-----CCCEEEEEEC---CCCC--------C--CCCCCHHHHHHHHHHHHHHC--CCCE-EEE
T ss_conf             96898878999999974-----7984999857---7777--------8--77556499999999998716--8974-874


Q ss_pred             -CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             -889999999999839997545278770
Q gi|254780434|r  295 -GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       295 -GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                       ||.+++|+.+.... ||.|=++|+++-
T Consensus       194 FGI~~~e~v~~~~~~-aDGvIVGSa~V~  220 (242)
T cd04724         194 FGISTPEQAAEVAKY-ADGVIVGSALVK  220 (242)
T ss_pred             CCCCCHHHHHHHHHH-CCEEEECHHHHH
T ss_conf             387999999999965-999998789999


No 123
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional
Probab=98.18  E-value=7.9e-05  Score=52.33  Aligned_cols=162  Identities=17%  Similarity=0.197  Sum_probs=93.5

Q ss_pred             HHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99987641000121000110454246788776555420675526983033365322110000234321111224445565
Q gi|254780434|r  123 VFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEE  202 (362)
Q Consensus       123 ~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~  202 (362)
                      +++++.+   ...+-+.+|+.--+.+.++.      .+..++|.+.||=.        .+.+++.+.++....-. +...
T Consensus        67 ~I~~i~~---~~~~~iqvGGGIRs~e~i~~------~l~~G~~rViigT~--------a~~~~~~l~~~~~~f~~-~Ivv  128 (234)
T PRK13587         67 YIKSLRR---LTTKDIEVGGGIRTKSQIMD------YFAAGINYCIVGTK--------GIQDTDWLKEMAHTFPG-RIYL  128 (234)
T ss_pred             HHHHHHH---HCCCCEEEECCCCCHHHHHH------HHHCCCCEEEECCC--------CCCCHHHHHHHHHHCCC-CEEE
T ss_conf             9999984---37986798465475999999------99768999998881--------30286999999986667-7687


Q ss_pred             HHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             53126885178650577774888999998764498299980665553234577544632211356454246899999997
Q gi|254780434|r  203 KIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQ  282 (362)
Q Consensus       203 ~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~  282 (362)
                      ....... -+.++=--..+.-.+.++++.+.+.|+..+++++  +++++           -++|+-     +..++++.+
T Consensus       129 ~iD~~~~-~v~~~GW~~~s~~~~~d~~~~~~~~g~~~il~Td--I~rDG-----------tl~G~n-----~el~~~i~~  189 (234)
T PRK13587        129 SVDAYGE-DIKVNGWEEDTELNLFSFVRQLSDIPLGGIIYTD--IAKDG-----------KMSGPN-----FELTGQLVK  189 (234)
T ss_pred             EEECCCC-EEEECCCCEECCCCHHHHHHHHHHCCCCEEEEEC--CCCCC-----------CCCCCC-----HHHHHHHHH
T ss_conf             1202385-4544575142586799999999743987899840--26657-----------455799-----999999997


Q ss_pred             HCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCH
Q ss_conf             408974899967889999999999839997545278770697
Q gi|254780434|r  283 RVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGI  324 (362)
Q Consensus       283 ~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp  324 (362)
                      ..  ++|+|++|||.|-+|..+.-.+|.+-|=++.|+ |+|-
T Consensus       190 ~~--~~pvIaSGGv~sl~Di~~L~~~gv~GvIvGkAl-Yeg~  228 (234)
T PRK13587        190 AT--TIPVIASGGIRHQQDIQRLASLNVHAAIIGKAA-HQAS  228 (234)
T ss_pred             HC--CCCEEEECCCCCHHHHHHHHHCCCCEEEEEEEC-CCCC
T ss_conf             67--999999899899999999998899899999750-1782


No 124
>TIGR00007 TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; InterPro: IPR006063   1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (5.3.1.16 from EC), also known as Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase or HisA, catalyses the fourth step in histidine biosynthesis. HisA from Lactococcus lactis was found to be inactive . The putative HisA from Thermotoga maritima, is a conspicuous outlier to the set of all other HisA, including experimental HisA from the bacterium E. coli and the Archaeaon Methanococcus voltae. Neighbor joining shows HisA from Thermotoga maritima to be within the HisA family (with HisF as an outgroup) but with a long branch. ; GO: 0003949 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity, 0000105 histidine biosynthetic process.
Probab=98.17  E-value=3.2e-05  Score=54.99  Aligned_cols=138  Identities=22%  Similarity=0.278  Sum_probs=86.5

Q ss_pred             HHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC----CEEEEECCC-CCCHHHHHHHHHHH
Q ss_conf             4206755269830333653221100002343211112244455655312688----517865057-77748889999987
Q gi|254780434|r  158 RLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKF----VPIFLKISP-DLSEEELDDIAVEV  232 (362)
Q Consensus       158 ~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~----~Pi~vKLsP-d~~~~~i~~ia~~a  232 (362)
                      +.+..+++.+.|-        --.+.+++.+.+.+...-..+..........    +-|.++ .+ .-+.-...++++..
T Consensus        90 ~ll~~Gv~RVI~G--------T~A~~~~~~v~~~~~~~g~~~i~V~lD~~~g~~G~~~V~v~-GW~E~s~~~~~~~~~~~  160 (241)
T TIGR00007        90 KLLDLGVDRVIIG--------TAAVENPDLVKELLKEYGPERIVVSLDARDGEEGVKEVAVK-GWKEKSEVSLEELAKRL  160 (241)
T ss_pred             HHHHCCCCEEEEE--------EEEECCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEE-EEECCCCCCHHHHHHHH
T ss_conf             9997398579973--------32210869999999984899659998631488751788874-04113562799999998


Q ss_pred             HHCC-CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHH--CC
Q ss_conf             6449-82999806655532345775446322113564542468999999974089748999678899999999998--39
Q gi|254780434|r  233 LSHK-VEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIM--AG  309 (362)
Q Consensus       233 ~~~g-~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~--aG  309 (362)
                      ++.| +.+|+.|+  +++++           -|+|+-.     ...+++.+++ .++++|++|||+|-+|+...-.  .|
T Consensus       161 ~~~G~~~~ii~Td--I~~DG-----------tl~G~n~-----~~~~~~~~~~-~~~~viaSGGv~s~~D~~~L~~~~~G  221 (241)
T TIGR00007       161 EELGELEGIIYTD--ISRDG-----------TLSGPNF-----ELTKELVKAL-VNVPVIASGGVSSIDDLRALKEIELG  221 (241)
T ss_pred             HHCCCCCEEEEEE--EECCC-----------CEECCCC-----CHHHHHHHHH-CCCEEEEECCCCCHHHHHHHHHCCCC
T ss_conf             5158633689975--20067-----------2007873-----2889999873-58418994265788999999971598


Q ss_pred             CCEEEECHHHHCCCH
Q ss_conf             997545278770697
Q gi|254780434|r  310 ANLIQLYSAMIYEGI  324 (362)
Q Consensus       310 As~VQi~Tali~~Gp  324 (362)
                      .+-|=|++|| |+|-
T Consensus       222 ~~GvIvGkAL-Y~g~  235 (241)
T TIGR00007       222 VYGVIVGKAL-YEGK  235 (241)
T ss_pred             CCEEEEEEEE-CCCC
T ss_conf             3279986211-1688


No 125
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ. This clade of sequences is highly similar to the HisF protein, but generally represents the second HisF homolog in the genome where the other is an authentic HisF observed in the context of a complete histidine biosynthesis operon. The similarity between these WbuZ sequences and true HisFs is such that often the closest match by BLAST of a WbuZ is a HisF. Only by making a multiple sequence alignment is the homology relationship among the WbuZ sequences made apparent. WbuZ genes are invariably observed in the presence of a homolog of the HisH protein (designated WbuY) and a proposed N-acetyl sugar amidotransferase designated in WbuX in E. coli, IfnA in P. aeriginosa and PseA in C. jejuni. Similarly, this trio of genes is invariably found in the context of saccharide biosynthesis loci. It has been shown that the WbuYZ homologs are not essential components of the activity expressed by WbuX, leading to the proposal that these to pr
Probab=98.16  E-value=5.5e-05  Score=53.40  Aligned_cols=208  Identities=16%  Similarity=0.176  Sum_probs=113.0

Q ss_pred             CCEECCCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHH
Q ss_conf             87335997485346888677988874036752410200136878998862688425554100002477777889998764
Q gi|254780434|r   50 AGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSK  129 (362)
Q Consensus        50 ~Gl~~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~  129 (362)
                      -|..|++..-+  | | =.+..+.|.+.|+-.+.+=-+  .                .+.-   |-+  --..+++++.+
T Consensus        19 k~~~~~~~~~~--g-d-P~~~ak~~~~~g~d~lhivDl--d----------------~a~~---~~~--~n~~~I~~i~~   71 (232)
T TIGR03572        19 KTVQFKDPRYI--G-D-PVNAARIYNAKGADELIVLDI--D----------------ASKR---GRE--PLFELISNLAE   71 (232)
T ss_pred             ECCCCCCCEEC--C-C-HHHHHHHHHHCCCCEEEEEEC--C----------------CCCC---CCC--CHHHHHHHHHH
T ss_conf             78478776578--8-9-999999999869999999968--7----------------6434---882--17999999999


Q ss_pred             HHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCC-
Q ss_conf             1000121000110454246788776555420675526983033365322110000234321111224445565531268-
Q gi|254780434|r  130 IQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGK-  208 (362)
Q Consensus       130 ~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~-  208 (362)
                         ..-+-+.+|+.-.+.+.++.      .+..+||-+.+|=.        .+.+++.+.++.+..-............ 
T Consensus        72 ---~~~ipi~vGGGIrs~e~~~~------ll~~GadkViigs~--------a~~~p~~~~~~~~~~G~q~ivvsiD~k~~  134 (232)
T TIGR03572        72 ---ECFMPLTVGGGIRSLEDAKK------LLSLGADKVSINTA--------ALENPDLIEEAARRFGSQCVVVSIDVKKE  134 (232)
T ss_pred             ---HCCCCEEEEECEEEHHHHHH------HHHCCCCEEEECHH--------HHHCCHHHHHHHHHCCCCCEEEEEEEECC
T ss_conf             ---72985899713303899999------99769968993454--------52193577899998699458999998416


Q ss_pred             ----CCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             ----8517865057777488899999876449829998066555323457754463221135645424689999999740
Q gi|254780434|r  209 ----FVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRV  284 (362)
Q Consensus       209 ----~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~  284 (362)
                          ..-++.+=.-..+.-.+.++++.+.+.|+..+++++  +++++           -+.|+-     +..++++++.+
T Consensus       135 ~~~~~~~v~~~g~~~~~~~~~~~~i~~~~~~g~geii~td--I~~DG-----------~~~G~d-----~~l~~~i~~~~  196 (232)
T TIGR03572       135 LDGSDYKVYSDNGRRATGRDPVEWAREAEQLGAGEILLNS--IDRDG-----------TMKGYD-----LELIKTVSDAV  196 (232)
T ss_pred             CCCCCEEEEECCCCCCCCCCHHHHHHHHHHCCCCEEEEEE--ECCCC-----------CCCCCC-----HHHHHHHHHHC
T ss_conf             7787279996677635798799999998735998999988--85768-----------567689-----99999999868


Q ss_pred             CCCEEEEEECCCCCHHHHHHHH-HCCCCEEEECHHHHC
Q ss_conf             8974899967889999999999-839997545278770
Q gi|254780434|r  285 GPKIAIIGTGGISSTKDALDKI-MAGANLIQLYSAMIY  321 (362)
Q Consensus       285 ~~~i~IIg~GGI~s~~Da~e~l-~aGAs~VQi~Tali~  321 (362)
                        ++|+|++|||.+.+|..+.+ ..|+++|-++|.|.|
T Consensus       197 --~~piiasGGi~~~~di~~l~~~~~~~gv~~gs~f~~  232 (232)
T TIGR03572       197 --SIPVIALGGAGSLDDLVEVALEAGASAVAAASLFHF  232 (232)
T ss_pred             --CCCEEEECCCCCHHHHHHHHHHCCCEEEEEEECCCC
T ss_conf             --999999889899999999998589819997211449


No 126
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family. DERA belongs to the class I aldolases and catalyzes a reversible aldol reaction between acetaldehyde and glyceraldehyde 3-phosphate to generate 2-deoxyribose 5-phosphate. DERA is unique in catalyzing the aldol reaction between two aldehydes, and its broad substrate specificity confers considerable utility as a biocatalyst, offering an environmentally benign alternative to chiral transition metal catalysis of the asymmetric aldol reaction.
Probab=98.16  E-value=7.5e-05  Score=52.51  Aligned_cols=82  Identities=26%  Similarity=0.312  Sum_probs=62.3

Q ss_pred             EEEEC---CCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             78650---577774888999998764498299980665553234577544632211356454246899999997408974
Q gi|254780434|r  212 IFLKI---SPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKI  288 (362)
Q Consensus       212 i~vKL---sPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i  288 (362)
                      ..+|+   ++.++++++...++.+.++|+|.|=- .|                | ...   ...+...++.+++..++++
T Consensus       117 ~~lKVIlEt~~L~~~ei~~a~~~a~~aGadfvKT-ST----------------G-~~~---~gat~e~v~~m~~~~~~~~  175 (203)
T cd00959         117 APLKVILETGLLTDEEIIKACEIAIEAGADFIKT-ST----------------G-FGP---GGATVEDVKLMKEAVGGRV  175 (203)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEE-CC----------------C-CCC---CCCCHHHHHHHHHHHCCCC
T ss_conf             8269997446599999999999999829788971-58----------------8-688---9989999999999838786


Q ss_pred             EEEEECCCCCHHHHHHHHHCCCCEEE
Q ss_conf             89996788999999999983999754
Q gi|254780434|r  289 AIIGTGGISSTKDALDKIMAGANLIQ  314 (362)
Q Consensus       289 ~IIg~GGI~s~~Da~e~l~aGAs~VQ  314 (362)
                      -|-++|||.|.+||.+|+.+||+-+.
T Consensus       176 giKasGGIrt~~~a~~~l~aGa~riG  201 (203)
T cd00959         176 GVKAAGGIRTLEDALAMIEAGATRIG  201 (203)
T ss_pred             EEECCCCCCCHHHHHHHHHHCCHHEE
T ss_conf             07715897999999999981841221


No 127
>PRK07807 inositol-5-monophosphate dehydrogenase; Validated
Probab=98.15  E-value=7.6e-05  Score=52.44  Aligned_cols=128  Identities=14%  Similarity=0.200  Sum_probs=68.7

Q ss_pred             HHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             20675526983033365322110000234321111224445565531268851786505777748889999987644982
Q gi|254780434|r  159 LFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVE  238 (362)
Q Consensus       159 ~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~d  238 (362)
                      .+..++|++.|..+-=|.         ...   ++.++..+     +...+++|++-   |...   .+-++.+.++|+|
T Consensus       235 Lv~AGvDvlvIDtAHGhS---------~~v---i~~vk~iK-----~~~p~~~viaG---NvaT---~~~a~~Li~aGad  291 (479)
T PRK07807        235 LLEAGVDVLVIDTAHGHQ---------EKM---LEAIRAVR-----ALDPGVPLVAG---NVVT---AEGTRDLVEAGAD  291 (479)
T ss_pred             HHHCCCCEEEEECCCCCH---------HHH---HHHHHHHH-----HHCCCCCEEEE---EHHH---HHHHHHHHHCCCC
T ss_conf             997699899975457664---------899---99999998-----40898857874---3202---9999999973999


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHH
Q ss_conf             99980665553234577544632211356454246899999997408974899967889999999999839997545278
Q gi|254780434|r  239 GIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSA  318 (362)
Q Consensus       239 Giv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Ta  318 (362)
                      +|-+.=-.++   +++-....   |. |.| ...|...++...+..  .+|||+-|||.+.-|+.+-|.+|||+|++++-
T Consensus       292 ~ikvGiG~GS---iCtTr~v~---gv-G~p-q~tAi~~~a~~a~~~--gvpiIADGGIr~sGdi~KAla~GA~~VMlGsl  361 (479)
T PRK07807        292 IVKVGVGPGA---MCTTRMMT---GV-GRP-QFSAVLECAAAAREL--GAHVWADGGVRHPRDVALALAAGASNVMIGSW  361 (479)
T ss_pred             EEECCCCCCC---CEECCCCC---CC-CCC-HHHHHHHHHHHHHHC--CCCEEECCCCCCCCHHHHHHHCCCCEEEECCC
T ss_conf             7631555783---24346323---77-886-099999999998756--99789458725346799998728987888830


Q ss_pred             H
Q ss_conf             7
Q gi|254780434|r  319 M  319 (362)
Q Consensus       319 l  319 (362)
                      |
T Consensus       362 l  362 (479)
T PRK07807        362 F  362 (479)
T ss_pred             C
T ss_conf             1


No 128
>PRK13114 consensus
Probab=98.13  E-value=0.00013  Score=50.89  Aligned_cols=210  Identities=14%  Similarity=0.107  Sum_probs=109.1

Q ss_pred             ECCC-CCC--CHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH---HC
Q ss_conf             5346-888--67798887403675241020013687899886268842555410000247777788999876410---00
Q gi|254780434|r   60 MAAG-YDK--NAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ---PT  133 (362)
Q Consensus        60 lAaG-~dk--~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~---~~  133 (362)
                      +-+| +|.  +.+.++.+.+.|...+|+|==-..|..-  .|-+. -..++++-|-+     ..+.+++.+++.+   .+
T Consensus        19 itaG~P~~~~t~~~i~~l~~~GaDiiEiGiPFSDP~AD--GpvIq-~A~~rAL~~G~-----~l~~~f~~v~~~r~~~~~   90 (266)
T PRK13114         19 ITGGDPTPGDTAANLDALVAGGADVIELGMPFTDPMAD--GPAIQ-AANLRSLAAGT-----TTADIFRIAAEFRQRHPE   90 (266)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHCCC-----CHHHHHHHHHHHHHCCCC
T ss_conf             70718998999999999997699999979998886776--89999-99999998699-----799999999998741899


Q ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             12100011045424678877655542067552698303336532211000023432111122444556553126885178
Q gi|254780434|r  134 SPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIF  213 (362)
Q Consensus       134 ~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~  213 (362)
                      .|+++=-=.|.--....+.|.+-+++.  ++|.+-+ .-+|.          +...++.....          ...+.++
T Consensus        91 ~PivlM~Y~N~i~~~G~~~F~~~~~~a--GvdG~Ii-pDLP~----------eE~~~~~~~~~----------~~gi~~I  147 (266)
T PRK13114         91 VPLVLMGYANPMVRRGPDWFAAECKKA--GVDGVIC-VDIPP----------EEDAELGPALR----------AAGIDPI  147 (266)
T ss_pred             CCEEEEEEHHHHHHHHHHHHHHHHHHC--CCCEEEE-CCCCH----------HHHHHHHHHHH----------HCCCCEE
T ss_conf             887998630199986499999999974--9977984-58997----------88899999999----------7499726


Q ss_pred             EECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             65057777488899999876449829998066555323457754463221135645424689999999740897489996
Q gi|254780434|r  214 LKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGT  293 (362)
Q Consensus       214 vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~  293 (362)
                      -=++|..+++.+..+++.+     +|++-.=+....++..             ..+...-...++++|+.+  ++|+.-.
T Consensus       148 ~liaPtt~~~Ri~~i~~~a-----~gFiY~vs~~GvTG~~-------------~~~~~~~~~~i~~ik~~t--~~Pv~vG  207 (266)
T PRK13114        148 RLATPTTDAARLPAVLEGA-----SGFLYYVSVAGITGMQ-------------QAAQASIEAAVARIKAAT--DLPVAVG  207 (266)
T ss_pred             EEECCCCCHHHHHHHHHHC-----CCCEEEEECCCCCCCC-------------CCCHHHHHHHHHHHHHHC--CCCEEEE
T ss_conf             7756999799999999738-----9958998445566776-------------566588999999999707--9986998


Q ss_pred             CCCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             7889999999999839997545278770
Q gi|254780434|r  294 GGISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       294 GGI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      =||.+++|+.+. ...||.|=|+|+++-
T Consensus       208 FGIs~~e~~~~~-~~~ADGvIVGSaiVk  234 (266)
T PRK13114        208 FGVRTPEQAAAI-ARVADGVVVGSAFVD  234 (266)
T ss_pred             CCCCCHHHHHHH-HHCCCEEEECHHHHH
T ss_conf             366989999999-800999998199999


No 129
>PRK13133 consensus
Probab=98.11  E-value=0.0005  Score=46.93  Aligned_cols=213  Identities=17%  Similarity=0.090  Sum_probs=102.8

Q ss_pred             ECCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH-----
Q ss_conf             5346-88--867798887403675241020013687899886268842555410000247777788999876410-----
Q gi|254780434|r   60 MAAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ-----  131 (362)
Q Consensus        60 lAaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~-----  131 (362)
                      +-+| +|  .+.+.++.+.+.|...+|+|==-..|..-  .|-+. ...++++-|  |+   ..+.+++-+++.+     
T Consensus        21 itaG~P~~~~t~~~i~~l~~~GaDiiElGiPFSDP~AD--GpvIQ-~A~~rAL~~--G~---~~~~~~~~~~~~r~~~~~   92 (267)
T PRK13133         21 YMPEFPVAGATLPVLEALQESGADIIELGIPYSDPIGD--GPVIQ-NAAHTAIRN--GV---SVRSLLELVRKARNGEGC   92 (267)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHC--CC---CHHHHHHHHHHHHHCCCC
T ss_conf             56869998999999999997599989978998886666--89999-999999986--99---899999999999730243


Q ss_pred             --HCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             --001210001104542467887765554206755269830333653221100002343211112244455655312688
Q gi|254780434|r  132 --PTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKF  209 (362)
Q Consensus       132 --~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~  209 (362)
                        .+.|+++--=.|.--.-..+.|.+.+++.  ++|.+-+    |--|       .+.-.++.....          ...
T Consensus        93 ~~~~~PivlMtY~N~i~~yG~e~F~~~~~~a--GvdGlIi----pDLP-------~eE~~~~~~~~~----------~~g  149 (267)
T PRK13133         93 RKITVPILLMGYCNPLIAYGGDCFLADAVKA--GVDGLLI----PDLP-------PEEAIDFLERAK----------NFG  149 (267)
T ss_pred             CCCCCCEEEHHHHHHHHHHCHHHHHHHHHHC--CCCEEEC----CCCC-------HHHHHHHHHHHH----------HCC
T ss_conf             4668778715645799984779999999986--9878877----8999-------688899999998----------469


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             51786505777748889999987644982999806655532345775446322113564542468999999974089748
Q gi|254780434|r  210 VPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIA  289 (362)
Q Consensus       210 ~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~  289 (362)
                      +..+-=++|..+++.+..+++.     .+|++=.=+   +.++....      -++-..+...-...++++|+.+  +.|
T Consensus       150 l~~I~lvaPtt~~eRi~~i~~~-----s~GFiY~vs---~~GvTG~~------~~~~~~~~~~~~~~i~~ik~~t--~~P  213 (267)
T PRK13133        150 LTVVFLISPVTPPERIEFIDSL-----STDFSYCLA---VNATTGTA------KLSDAGTEAAVDEYLKRVRQHT--KKK  213 (267)
T ss_pred             CCEEEEECCCCCHHHHHHHHHC-----CCCCEEEEE---EECCCCCC------CCCCCCHHHHHHHHHHHHHHCC--CCC
T ss_conf             8602442899999999999842-----789579998---00134677------5555426789999999999718--998


Q ss_pred             EEEEC-CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             99967-889999999999839997545278770
Q gi|254780434|r  290 IIGTG-GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       290 IIg~G-GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      + .+| ||.+++||.+.... ||-|=|+|+++-
T Consensus       214 v-~vGFGI~~~e~~~~i~~~-ADGvIVGSaiV~  244 (267)
T PRK13133        214 F-VVGFGIKDRERVEHMWEL-ADGAVVGTALLQ  244 (267)
T ss_pred             E-EEECCCCCHHHHHHHHHH-CCEEEECHHHHH
T ss_conf             7-996687999999999822-999998789999


No 130
>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism]
Probab=98.10  E-value=5.8e-05  Score=53.26  Aligned_cols=86  Identities=24%  Similarity=0.330  Sum_probs=65.9

Q ss_pred             EEEEC---CCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             78650---577774888999998764498299980665553234577544632211356454246899999997408974
Q gi|254780434|r  212 IFLKI---SPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKI  288 (362)
Q Consensus       212 i~vKL---sPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i  288 (362)
                      ..+|+   ++.++++++...++.+.++|+|.|= +.|                |.-.|    ..++..+..+++..++++
T Consensus       126 ~~lKVIlEt~~Lt~ee~~~A~~i~~~aGAdFVK-TST----------------Gf~~~----gAT~edv~lM~~~vg~~v  184 (228)
T COG0274         126 VVLKVILETGLLTDEEKRKACEIAIEAGADFVK-TST----------------GFSAG----GATVEDVKLMKETVGGRV  184 (228)
T ss_pred             CEEEEEEECCCCCHHHHHHHHHHHHHHCCCEEE-CCC----------------CCCCC----CCCHHHHHHHHHHHCCCC
T ss_conf             448999742556979999999999995899898-477----------------87898----987999999999856571


Q ss_pred             EEEEECCCCCHHHHHHHHHCCCCEEEECHH
Q ss_conf             899967889999999999839997545278
Q gi|254780434|r  289 AIIGTGGISSTKDALDKIMAGANLIQLYSA  318 (362)
Q Consensus       289 ~IIg~GGI~s~~Da~e~l~aGAs~VQi~Ta  318 (362)
                      -|-++|||.+.+|+..|+.+||+-+...++
T Consensus       185 gvKaSGGIrt~eda~~~i~aga~RiGtSs~  214 (228)
T COG0274         185 GVKASGGIRTAEDAKAMIEAGATRIGTSSG  214 (228)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHCCCCH
T ss_conf             053268848899999999975787244648


No 131
>PRK11750 gltB glutamate synthase subunit alpha; Provisional
Probab=98.10  E-value=5.9e-05  Score=53.19  Aligned_cols=182  Identities=18%  Similarity=0.223  Sum_probs=112.6

Q ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             78877655542067552698303336532211000023432111122444556553126885178650577774888999
Q gi|254780434|r  149 FILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDI  228 (362)
Q Consensus       149 ~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~i  228 (362)
                      .+.++..-+|..-|+++.    ||=|+--   +.-+-|-|..++..++...        .+--|-|||.   +..-+-.+
T Consensus       950 KV~~~IA~~R~stPGV~L----ISPPPHH---DIYSIEDLaQLI~DLK~~N--------p~ArVsVKLV---s~~GVGTI 1011 (1483)
T PRK11750        950 KVNPLIAKLRYSVPGVTL----ISPPPHH---DIYSIEDLAQLIFDLKQVN--------PKALVSVKLV---SEPGVGTI 1011 (1483)
T ss_pred             CCCHHHHHHCCCCCCCCC----CCCCCCC---CCCCHHHHHHHHHHHHHCC--------CCCEEEEEEC---CCCCCCEE
T ss_conf             457999987079999780----4899966---5212778999999986358--------7754567740---23674311


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC-CHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHH
Q ss_conf             99876449829998066555323457754463221135645-42468999999974089748999678899999999998
Q gi|254780434|r  229 AVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPL-FLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIM  307 (362)
Q Consensus       229 a~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i-~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~  307 (362)
                      |.-+.++++|-|+++.-.+.   +...+..+..  .-|-|. .-++-.--..+..-+..++.+=.-||..||.|+....+
T Consensus      1012 AaGVAKA~AD~I~ISG~dGG---TGAsp~tSik--haGlPwElGlaEthq~L~~n~LR~rV~l~~DGglkTGrDVviaal 1086 (1483)
T PRK11750       1012 ATGVAKAYADLITISGYDGG---TGASPLTSVK--YAGSPWELGLAETHQALVANGLRHKIRLQVDGGLKTGLDVIKAAI 1086 (1483)
T ss_pred             ECCHHHCCCCEEEECCCCCC---CCCCCHHHHC--CCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             20112047888998168898---7767323420--388865443899999999737546389996698561689999987


Q ss_pred             CCCCEEEECHHHH-------------------------------CCC-H----HHHHHHHHHHHHHHHHCCCCCHHHHHC
Q ss_conf             3999754527877-------------------------------069-7----899999999999999838997789616
Q gi|254780434|r  308 AGANLIQLYSAMI-------------------------------YEG-I----SLPKRIIQGLSDFLNKENEVNFENIRG  351 (362)
Q Consensus       308 aGAs~VQi~Tali-------------------------------~~G-p----~~~~~I~~~L~~~l~~~G~~si~e~iG  351 (362)
                      .||+-...+|+.+                               |.| |    .++.-+.+|+.++|.+-||.+++|+||
T Consensus      1087 LGAeefgfgT~~Lia~GCiM~R~CHlntCpvGIATQ~~~Lr~~~f~G~pe~vvn~f~~vAeevReilA~LG~rsl~e~iG 1166 (1483)
T PRK11750       1087 LGAESFGFGTAPMVALGCKYLRICHLNNCATGVATQDEKLRKNHYHGLPEMVMNYFEFIAEETREWMAQLGVRSLEDLIG 1166 (1483)
T ss_pred             HCCHHHCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHC
T ss_conf             26055434427899844088786425889874015898888634289889999999999999999999968415999848


Q ss_pred             CC
Q ss_conf             97
Q gi|254780434|r  352 SY  353 (362)
Q Consensus       352 ~~  353 (362)
                      +.
T Consensus      1167 r~ 1168 (1483)
T PRK11750       1167 RT 1168 (1483)
T ss_pred             CC
T ss_conf             63


No 132
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism]
Probab=98.10  E-value=6.4e-05  Score=52.97  Aligned_cols=228  Identities=16%  Similarity=0.241  Sum_probs=134.1

Q ss_pred             EEEECCEECCCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHH
Q ss_conf             16888733599748534688867798887403675241020013687899886268842555410000247777788999
Q gi|254780434|r   46 NTKVAGISLSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFS  125 (362)
Q Consensus        46 ~~~~~Gl~~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~  125 (362)
                      ..-+.|++|+|.--  +|  .-.+..+++.+.|+-=++.=-||..+.                          |-+.+++
T Consensus        15 GrVVKGv~F~~lrd--~G--DpVelA~~Y~e~GADElvFlDItAs~~--------------------------gr~~~~~   64 (256)
T COG0107          15 GRVVKGVNFKNLRD--AG--DPVELAKRYNEEGADELVFLDITASSE--------------------------GRETMLD   64 (256)
T ss_pred             CEEEECCCCCCHHH--CC--CHHHHHHHHHHCCCCEEEEEECCCCCC--------------------------CCCCHHH
T ss_conf             87984563122131--48--949999999775997699986225656--------------------------6620799


Q ss_pred             HHHHHHH--CCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHH-----HHHHHH
Q ss_conf             8764100--012100011045424678877655542067552698303336532211000023432111-----122444
Q gi|254780434|r  126 RLSKIQP--TSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLL-----IHVMQT  198 (362)
Q Consensus       126 ~l~~~~~--~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l-----~~v~~~  198 (362)
                      -+++...  .+|+  -+|+.-   ..++|..+   .+..+||=+-||=+-        +.+|+.+.+..     +.++..
T Consensus        65 vv~~~A~~vfiPl--tVGGGI---~s~eD~~~---ll~aGADKVSINsaA--------v~~p~lI~~~a~~FGsQciVva  128 (256)
T COG0107          65 VVERVAEQVFIPL--TVGGGI---RSVEDARK---LLRAGADKVSINSAA--------VKDPELITEAADRFGSQCIVVA  128 (256)
T ss_pred             HHHHHHHHCEEEE--EECCCC---CCHHHHHH---HHHCCCCEEEECHHH--------HCCHHHHHHHHHHHCCCEEEEE
T ss_conf             9999973030324--754775---88899999---997699746528467--------5095999999998388129999


Q ss_pred             HHHHHHH--CCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             5565531--26885178650577774888999998764498299980665553234577544632211356454246899
Q gi|254780434|r  199 REEEKIK--TGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIA  276 (362)
Q Consensus       199 ~~~~~~~--~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~  276 (362)
                      .+..+..  .....-++.+=.-..+.-+..+.++.+++.|+--|.+ | .++++++     +.++           -+.+
T Consensus       129 IDakr~~~g~~~~~~v~~~gGr~~t~~d~~eWa~~~e~~GAGEIlL-t-smD~DGt-----k~Gy-----------Dl~l  190 (256)
T COG0107         129 IDAKRVPDGENGWYEVFTHGGREDTGLDAVEWAKEVEELGAGEILL-T-SMDRDGT-----KAGY-----------DLEL  190 (256)
T ss_pred             EEEEECCCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHCCCCEEEE-E-EECCCCC-----CCCC-----------CHHH
T ss_conf             8755426899876799966897568857999999999738854878-6-3556565-----3675-----------7999


Q ss_pred             HHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCC-CCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             999997408974899967889999999999839-99754527877069789999999999999983899
Q gi|254780434|r  277 LAKIRQRVGPKIAIIGTGGISSTKDALDKIMAG-ANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEV  344 (362)
Q Consensus       277 i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aG-As~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~  344 (362)
                      ++.+++.+  ++|+|++||.-+.+|.+|-+..| ||++--.|-|.|+...     ..+++++|.++|+.
T Consensus       191 ~~~v~~~v--~iPvIASGGaG~~ehf~eaf~~~~adAaLAAsiFH~~~~~-----i~evK~yl~~~gi~  252 (256)
T COG0107         191 TRAVREAV--NIPVIASGGAGKPEHFVEAFTEGKADAALAASIFHFGEIT-----IGEVKEYLAEQGIE  252 (256)
T ss_pred             HHHHHHHC--CCCEEECCCCCCHHHHHHHHHHCCCHHHHHHHHHHCCCCC-----HHHHHHHHHHCCCC
T ss_conf             99999648--8788911898968899999981570088764433147454-----99999999985986


No 133
>PRK13140 consensus
Probab=98.07  E-value=0.00081  Score=45.53  Aligned_cols=211  Identities=19%  Similarity=0.170  Sum_probs=105.6

Q ss_pred             ECCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH--HCC
Q ss_conf             5346-88--867798887403675241020013687899886268842555410000247777788999876410--001
Q gi|254780434|r   60 MAAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ--PTS  134 (362)
Q Consensus        60 lAaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~--~~~  134 (362)
                      +-+| +|  .+.+.++.+.+.|...+|+|==...|..-  .|-+. ....+++-|  |   -..+.+++.+++.+  .+.
T Consensus        20 ~taG~P~~~~s~~~~~~l~~~GaDiiElGiPfSDP~AD--GpvIq-~A~~rAL~~--G---~~~~~~~~~~~~~r~~~~~   91 (257)
T PRK13140         20 FTAGYPTLEDTVSIIKDLEKHGVDMIEIGIPFSDPLAD--GPVIQ-KSATQALKN--G---MTLKLLFEQLKDIRKEVQI   91 (257)
T ss_pred             EECCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHC--C---CCHHHHHHHHHHHHCCCCC
T ss_conf             81828987999999999997599999978988987765--89999-999999986--9---9899999999997436898


Q ss_pred             CCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             21000110454246788776555420675526983033365322110000234321111224445565531268851786
Q gi|254780434|r  135 PIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFL  214 (362)
Q Consensus       135 pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~v  214 (362)
                      |+.+--=.|.--.-.+++|.+.+++.+  +|.+-+    |--|      -.+....+.....          ...+.++-
T Consensus        92 pivlM~Y~N~i~~~G~e~F~~~~~~~G--vdGlIi----pDLP------~ee~~~~~~~~~~----------~~~i~~I~  149 (257)
T PRK13140         92 PLILMGYLNPIMQYGFEKFCKKCAETG--IDGVII----PDLP------FDDYQEHYKEIFE----------KYGLKNIM  149 (257)
T ss_pred             CEEEEECHHHHHHHCHHHHHHHHHHCC--CCEEEE----CCCC------HHHHHHHHHHHHH----------HCCCCEEE
T ss_conf             889990559998517999999999849--986983----5998------5675899999999----------86997799


Q ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             50577774888999998764498299980665553234577544632211356454246899999997408974899967
Q gi|254780434|r  215 KISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTG  294 (362)
Q Consensus       215 KLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~G  294 (362)
                      =++|..+++.+..+++.+     +|++=.=+   +.++....          ..+.......++.+++.. .++|+. +|
T Consensus       150 lvaPtt~~~Ri~~i~~~a-----~gFiY~vs---~~GvTG~~----------~~~~~~~~~~i~~ik~~~-~~~Pv~-vG  209 (257)
T PRK13140        150 LITPQTSEERIREIDSHT-----DGFIYMVS---SASTTGAQ----------QDFNNQKRAYFKRIKDMN-LKNPRM-VG  209 (257)
T ss_pred             EECCCCCHHHHHHHHHHC-----CCCEEECC---CCCCCCCC----------CCCCHHHHHHHHHHHHHC-CCCCEE-EE
T ss_conf             868999899999999739-----99668703---65666887----------665156899999999827-899869-98


Q ss_pred             -CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             -889999999999839997545278770
Q gi|254780434|r  295 -GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       295 -GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                       ||.+.+|+. .+..+||.|=|+|+++-
T Consensus       210 FGIs~~e~v~-~~~~~aDGvIVGSaivk  236 (257)
T PRK13140        210 FGISNKATFN-AACEYASGAIIGSAFVK  236 (257)
T ss_pred             ECCCCHHHHH-HHHHCCCEEEECHHHHH
T ss_conf             0579899999-99831999998799999


No 134
>PRK13124 consensus
Probab=98.06  E-value=0.001  Score=44.92  Aligned_cols=208  Identities=21%  Similarity=0.237  Sum_probs=105.3

Q ss_pred             ECCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHH--CC
Q ss_conf             5346-88--8677988874036752410200136878998862688425554100002477777889998764100--01
Q gi|254780434|r   60 MAAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQP--TS  134 (362)
Q Consensus        60 lAaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~--~~  134 (362)
                      +-+| +|  .+.+.++.+.+.|...+|+|==...|..-  .|-+. ...++++-|-     -..+.+.+-+++.+.  +.
T Consensus        15 itaG~P~~e~s~~~~~~l~~~GaDiiElGiPfSDP~AD--GpvIq-~A~~~AL~~G-----~~~~~~~~~~~~~r~~~~~   86 (257)
T PRK13124         15 ITAGDPDPETTIDLVLALEEAGADILELGIPYSDPLAD--GPVIQ-RASKRALNGG-----MNIVKAMELVGKMRKKVTI   86 (257)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHCC-----CCHHHHHHHHHHHHCCCCC
T ss_conf             63708998999999999997699999978988887765--79999-9999999769-----9689999999985244788


Q ss_pred             CCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             21000110454246788776555420675526983033365322110000234321111224445565531268851786
Q gi|254780434|r  135 PIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFL  214 (362)
Q Consensus       135 pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~v  214 (362)
                      |+++=-=.|.--.-.+++|.+.+++.+  +|.+-+    |.-|    +.+.+   ++.....        +  ..+.++-
T Consensus        87 pivlM~Y~N~i~~~G~e~F~~~~~~~G--v~GvIi----pDLP----~eE~~---~~~~~~~--------~--~gl~~I~  143 (257)
T PRK13124         87 PIVYFTYYNPVLQYGLEKFFALARENG--IDGLLI----PDLP----LEESG---ELQEICD--------K--YGIYLIP  143 (257)
T ss_pred             CEEEEEHHHHHHHHHHHHHHHHHHHCC--CCEEEC----CCCC----HHHHH---HHHHHHH--------H--CCCCEEE
T ss_conf             889975007898757999999999759--984777----8999----79999---9999998--------6--6873578


Q ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             50577774888999998764498299980665553234577544632211356454246899999997408974899967
Q gi|254780434|r  215 KISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTG  294 (362)
Q Consensus       215 KLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~G  294 (362)
                      =++| .+++++..+++.     .+|++=.=+   +.++        +|  +...+..--...+..+++.+  ++|+ .+|
T Consensus       144 lvaP-Ts~~Ri~~i~~~-----s~gFiY~vs---~~Gv--------TG--~~~~~~~~~~~~i~~ik~~t--~~Pv-~vG  201 (257)
T PRK13124        144 LVAP-TSKERIKKIAEQ-----AEGFVYCVS---SLGV--------TG--VREEIETDLEEFIRTVKQYS--NVPV-AVG  201 (257)
T ss_pred             EECC-CCHHHHHHHHHC-----CCCCEEEEE---CCCC--------CC--CCCCCHHHHHHHHHHHHHCC--CCCE-EEE
T ss_conf             8479-967999999854-----898389962---4666--------78--76556088999999998617--9983-898


Q ss_pred             -CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             -889999999999839997545278770
Q gi|254780434|r  295 -GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       295 -GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                       ||.+++|+. .+..+||.|=|+|+++-
T Consensus       202 FGI~~~e~v~-~~~~~ADGvIVGSaivk  228 (257)
T PRK13124        202 FGISTPEQVQ-KMKEIADGVVVGSALVE  228 (257)
T ss_pred             ECCCCHHHHH-HHHHHCCEEEECHHHHH
T ss_conf             4469999999-99801999998289999


No 135
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate. This reaction is part of the pathway that allows the usage of sialic acid as a carbohydrate source. Sialic acids are a family of related sugars that are found as a component of glycoproteins, gangliosides, and other sialoglycoconjugates.
Probab=98.05  E-value=9e-05  Score=51.96  Aligned_cols=128  Identities=20%  Similarity=0.209  Sum_probs=81.4

Q ss_pred             HCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             06755269830333653221100002343211112244455655312688517865057777488899999876449829
Q gi|254780434|r  160 FFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEG  239 (362)
Q Consensus       160 ~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dG  239 (362)
                      +..+||.+-+.-..      |.--+.+.+.+++..++...         ..++++-++   +   +++ +..+.+.|+|-
T Consensus        89 ~~aGadiIA~DaT~------R~RP~g~~l~~~i~~i~~~~---------~~l~MAD~s---t---~ee-~~~A~~~G~D~  146 (219)
T cd04729          89 AAAGADIIALDATD------RPRPDGETLAELIKRIHEEY---------NCLLMADIS---T---LEE-ALNAAKLGFDI  146 (219)
T ss_pred             HHCCCCEEEEECCC------CCCCCCCCHHHHHHHHHHHH---------CCEEEEECC---C---HHH-HHHHHHCCCCE
T ss_conf             98599999994678------87989978999999999986---------977887548---8---999-99999849989


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHH
Q ss_conf             99806655532345775446322113564542468999999974089748999678899999999998399975452787
Q gi|254780434|r  240 IIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAM  319 (362)
Q Consensus       240 iv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tal  319 (362)
                      |-   ||.+  +.....          +.+...-+++++++++.+  ++|+|+=|+|.|+++|.+.+.+||++|-|+||.
T Consensus       147 vg---TTL~--GYT~~t----------~~~~~PD~~lv~~l~~~~--~~pvIaEGri~tPe~a~~a~~~GA~aVVVGsAI  209 (219)
T cd04729         147 IG---TTLS--GYTEET----------AKTEDPDFELLKELRKAL--GIPVIAEGRINSPEQAAKALELGADAVVVGSAI  209 (219)
T ss_pred             EE---CCCC--CCCCCC----------CCCCCCCHHHHHHHHHHC--CCCEEEECCCCCHHHHHHHHHCCCCEEEECCCC
T ss_conf             97---0214--567787----------889998789999999975--993997069899999999998399899989543


Q ss_pred             HCCCHHHHH
Q ss_conf             706978999
Q gi|254780434|r  320 IYEGISLPK  328 (362)
Q Consensus       320 i~~Gp~~~~  328 (362)
                       -+ |..+.
T Consensus       210 -Tr-P~~IT  216 (219)
T cd04729         210 -TR-PEHIT  216 (219)
T ss_pred             -CC-HHHHH
T ss_conf             -88-89986


No 136
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism]
Probab=98.05  E-value=0.00037  Score=47.84  Aligned_cols=204  Identities=22%  Similarity=0.278  Sum_probs=108.1

Q ss_pred             CCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH---HCCCCCCEEE
Q ss_conf             8867798887403675241020013687899886268842555410000247777788999876410---0012100011
Q gi|254780434|r   65 DKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ---PTSPIGINLG  141 (362)
Q Consensus        65 dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~---~~~pi~vsI~  141 (362)
                      +...+.++.|.+.|..++|+|==...|-.-  .|.+. ....+++-+     +.-.+..++-++..+   .+.|++.=.=
T Consensus        31 e~s~e~i~~L~~~GaD~iELGvPfSDPvAD--GP~Iq-~A~~rAL~~-----g~t~~~~lel~~~~r~~~~~~Pivlm~Y  102 (265)
T COG0159          31 ETSLEIIKTLVEAGADILELGVPFSDPVAD--GPTIQ-AAHLRALAA-----GVTLEDTLELVEEIRAKGVKVPIVLMTY  102 (265)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHC-----CCCHHHHHHHHHHHHHCCCCCCEEEEEE
T ss_conf             999999999986798889966888886766--88999-989999977-----9988999999999986189998899870


Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCC
Q ss_conf             04542467887765554206755269830333653221100002343211112244455655312688517865057777
Q gi|254780434|r  142 ANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLS  221 (362)
Q Consensus       142 ~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~  221 (362)
                      .|..-...+++|.+.+++.+  +|-+-+       +++.    .+.-+++.....        +... -|| .=.+|+.+
T Consensus       103 ~Npi~~~Gie~F~~~~~~~G--vdGliv-------pDLP----~ee~~~~~~~~~--------~~gi-~~I-~lvaPtt~  159 (265)
T COG0159         103 YNPIFNYGIEKFLRRAKEAG--VDGLLV-------PDLP----PEESDELLKAAE--------KHGI-DPI-FLVAPTTP  159 (265)
T ss_pred             CCHHHHHHHHHHHHHHHHCC--CCEEEE-------CCCC----HHHHHHHHHHHH--------HCCC-CEE-EEECCCCC
T ss_conf             11887735999999999759--987985-------7898----667778999999--------7698-679-88699999


Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC-CCCCHH
Q ss_conf             4888999998764498299980665553234577544632211356454246899999997408974899967-889999
Q gi|254780434|r  222 EEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTG-GISSTK  300 (362)
Q Consensus       222 ~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~G-GI~s~~  300 (362)
                      ++.+..+++.+     +|++-.=+   +.++.         |...+ ......+.++++|+..  ++|| .+| ||++++
T Consensus       160 ~~rl~~i~~~a-----~GFiY~vs---~~GvT---------G~~~~-~~~~~~~~v~~vr~~~--~~Pv-~vGFGIs~~e  218 (265)
T COG0159         160 DERLKKIAEAA-----SGFIYYVS---RMGVT---------GARNP-VSADVKELVKRVRKYT--DVPV-LVGFGISSPE  218 (265)
T ss_pred             HHHHHHHHHHC-----CCCEEEEE---CCCCC---------CCCCC-CCHHHHHHHHHHHHHC--CCCE-EEECCCCCHH
T ss_conf             89999999747-----98589996---66666---------77765-3046999999999744--8973-8744869999


Q ss_pred             HHHHHHHCCCCEEEECHHHHC
Q ss_conf             999999839997545278770
Q gi|254780434|r  301 DALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       301 Da~e~l~aGAs~VQi~Tali~  321 (362)
                      +|.+...+ ||-|-++|+++-
T Consensus       219 ~~~~v~~~-ADGVIVGSAiV~  238 (265)
T COG0159         219 QAAQVAEA-ADGVIVGSAIVK  238 (265)
T ss_pred             HHHHHHHH-CCEEEECHHHHH
T ss_conf             99999976-885797399999


No 137
>PRK13136 consensus
Probab=98.02  E-value=0.0013  Score=44.08  Aligned_cols=208  Identities=21%  Similarity=0.216  Sum_probs=105.9

Q ss_pred             ECCC-CCC--CHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH--HCC
Q ss_conf             5346-888--67798887403675241020013687899886268842555410000247777788999876410--001
Q gi|254780434|r   60 MAAG-YDK--NAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ--PTS  134 (362)
Q Consensus        60 lAaG-~dk--~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~--~~~  134 (362)
                      +-|| +|.  +.+.++.+.+.|...+|+|==...|..-  .|-+ +....+++-|-     -..+.+++-+++.+  .+.
T Consensus        18 itaG~P~~e~s~~~~~~l~~~G~DiiElGiPfSDP~AD--GpvI-q~A~~rAL~~G-----~~~~~~~~~v~~~r~~~~~   89 (253)
T PRK13136         18 LTAGDGGLERSLESLLALAKGGVNILEVGVPFSDPVAD--GPVI-QEASIRALAQG-----TTLHDVLTLITSFRQHSEI   89 (253)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHH-HHHHHHHHHCC-----CCHHHHHHHHHHHCCCCCC
T ss_conf             64848998999999999996599989978998886665--7999-99999999869-----9799999999982257898


Q ss_pred             CCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             21000110454246788776555420675526983033365322110000234321111224445565531268851786
Q gi|254780434|r  135 PIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFL  214 (362)
Q Consensus       135 pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~v  214 (362)
                      |++.=-=.|.--.-. ++|.+.+++.  ++|.+-+    |--|    +   +.-.++.....        +.  .+..+.
T Consensus        90 pivlM~Y~N~i~~~G-~~f~~~~~~~--GvdGlIi----pDLP----~---eE~~~~~~~~~--------~~--~i~~I~  145 (253)
T PRK13136         90 PIILFTYFNPLLAAG-DKIYQQMKSA--GVDGCLV----VDLP----V---EEAAPHLTACK--------TA--KIAPIL  145 (253)
T ss_pred             CEEEECCCHHHHHHH-HHHHHHHHHC--CCCCEEC----CCCC----H---HHHHHHHHHHH--------HC--CCCCEE
T ss_conf             889986517999979-9999999974--9872006----7899----7---77699999999--------75--887125


Q ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             50577774888999998764498299980665553234577544632211356454246899999997408974899967
Q gi|254780434|r  215 KISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTG  294 (362)
Q Consensus       215 KLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~G  294 (362)
                      =++|..+++.+..+++.     +.|++=.=+   +.++.        |.-  ..+...-...++++++.+  ++|+ .+|
T Consensus       146 liaPtt~~eRi~~i~~~-----a~gFiY~vs---~~GvT--------G~~--~~~~~~~~~~i~~ik~~t--~~Pv-~vG  204 (253)
T PRK13136        146 LISPSTTQERLKKINEH-----GEGMLYYVC---RPGTT--------GVR--ATLPENFPAKMNQIKSMT--SLPI-VTG  204 (253)
T ss_pred             EECCCCCHHHHHHHHHC-----CCCEEEEEE---CCCCC--------CCC--CCCHHHHHHHHHHHHHHC--CCCE-EEE
T ss_conf             52689988999999960-----898199985---55236--------876--446388999999999726--9986-997


Q ss_pred             -CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             -889999999999839997545278770
Q gi|254780434|r  295 -GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       295 -GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                       ||.+.+||.+.... ||.|=|+|+++-
T Consensus       205 FGIs~~e~v~~~~~~-ADGvIVGSaiV~  231 (253)
T PRK13136        205 FGIANRKMAAQALQY-ADGFVIGSLFVK  231 (253)
T ss_pred             CCCCCHHHHHHHHHH-CCEEEECHHHHH
T ss_conf             154999999999822-999998589999


No 138
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism]
Probab=98.02  E-value=0.00067  Score=46.11  Aligned_cols=101  Identities=16%  Similarity=0.182  Sum_probs=66.2

Q ss_pred             CCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC--CHHHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             77488899999876449829998066555323457754463221135645--4246899999997408974899967889
Q gi|254780434|r  220 LSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPL--FLKSTIALAKIRQRVGPKIAIIGTGGIS  297 (362)
Q Consensus       220 ~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i--~~~al~~i~~i~~~~~~~i~IIg~GGI~  297 (362)
                      ++++++.++++.+.+.|.+.+|=+++--....... .... .=|+--+-+  +..-+..-..+....+.+..+|+=.||.
T Consensus       140 L~~~~l~el~~~A~~LGm~~LVEVh~~eEl~rAl~-~ga~-iIGINnRdL~tf~vdl~~t~~la~~~p~~~~~IsESGI~  217 (254)
T COG0134         140 LDDEQLEELVDRAHELGMEVLVEVHNEEELERALK-LGAK-IIGINNRDLTTLEVDLETTEKLAPLIPKDVILISESGIS  217 (254)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHH-CCCC-EEEEECCCCCHHEECHHHHHHHHHHCCCCCEEEECCCCC
T ss_conf             39999999999999769923899789999999996-7998-899837884021006889999884487775899617989


Q ss_pred             CHHHHHHHHHCCCCEEEECHHHHCC
Q ss_conf             9999999998399975452787706
Q gi|254780434|r  298 STKDALDKIMAGANLIQLYSAMIYE  322 (362)
Q Consensus       298 s~~Da~e~l~aGAs~VQi~Tali~~  322 (362)
                      +.+|+..+..+||+++=|+|++|-+
T Consensus       218 ~~~dv~~l~~~ga~a~LVG~slM~~  242 (254)
T COG0134         218 TPEDVRRLAKAGADAFLVGEALMRA  242 (254)
T ss_pred             CHHHHHHHHHCCCCEEEECHHHHCC
T ss_conf             9999999997489989963888569


No 139
>cd02812 PcrB_like PcrB_like proteins. One member of this family, a protein from Archaeoglobus fulgidus, has been characterized as a (S)-3-O-geranylgeranylglyceryl phosphate synthase (AfGGGPS). AfGGGPS catalyzes the formation of an ether linkage between sn-glycerol-1-phosphate (G1P) and geranylgeranyl diphosphate (GGPP), the committed step in archaeal lipid biosynthesis. Therefore, it has been proposed that PcrB-like proteins are either prenyltransferases or are involved in lipoteichoic acid biosynthesis although the exact function is still unknown.
Probab=98.02  E-value=8e-05  Score=52.30  Aligned_cols=89  Identities=20%  Similarity=0.226  Sum_probs=64.4

Q ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             77774888999998764498299980665553234577544632211356454246899999997408974899967889
Q gi|254780434|r  218 PDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGIS  297 (362)
Q Consensus       218 Pd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~  297 (362)
                      |+...+.+...|.+++-.|..-+                 ..+   .||.+   ....+|+.+++.++ +.++|=.|||.
T Consensus       130 ~~~~~~~~~ayAlaae~lg~~~i-----------------YLE---gSGa~---v~~e~V~~vk~~l~-~~~LivGGGIr  185 (219)
T cd02812         130 TDLKPEDAAAYALAAEYLGMPIV-----------------YLE---YSGAY---GPPEVVRAVKKVLG-DTPLIVGGGIR  185 (219)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCEE-----------------EEE---CCCCC---CCHHHHHHHHHHCC-CCEEEEECCCC
T ss_conf             79998999999999998299389-----------------995---68997---99999999998467-97099928979


Q ss_pred             CHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHH
Q ss_conf             9999999998399975452787706978999999
Q gi|254780434|r  298 STKDALDKIMAGANLIQLYSAMIYEGISLPKRII  331 (362)
Q Consensus       298 s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~  331 (362)
                      |+++|.++..||||.|.++|+ +++.|....++.
T Consensus       186 s~e~a~~~~~AgAD~IVvGn~-iee~~~~~l~~v  218 (219)
T cd02812         186 SGEQAKEMAEAGADTIVVGNI-VEEDPNAALETV  218 (219)
T ss_pred             CHHHHHHHHHCCCCEEEECCC-EEECHHHHHHHH
T ss_conf             999999999869999998872-240689997643


No 140
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional
Probab=97.97  E-value=0.00032  Score=48.28  Aligned_cols=135  Identities=17%  Similarity=0.148  Sum_probs=82.6

Q ss_pred             HCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             06755269830333653221100002343211112244455655312688517865057777488899999876449829
Q gi|254780434|r  160 FFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEG  239 (362)
Q Consensus       160 ~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dG  239 (362)
                      +..+||.+-+.=.-      |.--+.+.+.+++..++...         ..++++-++   +   +++ +..+.+.|+|-
T Consensus        85 ~~aGadiIA~DaT~------R~RP~g~~~~~~i~~i~~~~---------~~l~MAD~s---t---~ee-a~~A~~~G~D~  142 (222)
T PRK01130         85 AAAGADIIALDATL------RPRPDGETLAELVKRIKEKP---------GQLLMADCS---T---LEE-GLAAAKLGFDF  142 (222)
T ss_pred             HHCCCCEEEEECCC------CCCCCCCCHHHHHHHHHHHH---------CCEEEEECC---C---HHH-HHHHHHCCCCE
T ss_conf             98699999984678------98989968999999999982---------987898548---8---999-99999849999


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHH
Q ss_conf             99806655532345775446322113564542468999999974089748999678899999999998399975452787
Q gi|254780434|r  240 IIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAM  319 (362)
Q Consensus       240 iv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tal  319 (362)
                      |.   ||.+        ++.+  .-.|+.+...-+.+++++++.   ++|+|+=|+|.++++|.+.+.+||++|-|+||.
T Consensus       143 V~---TTLs--------GYT~--~t~~~~~~~pD~~lv~~l~~~---~~pvIaEGri~tPe~a~~al~~GA~aVvVGsAI  206 (222)
T PRK01130        143 IG---TTLS--------GYTE--YTEGETPEEPDFALLKELLKA---GCPVIAEGRINTPEQAKKALELGAHAVVVGSAI  206 (222)
T ss_pred             EE---CCCC--------CCCC--CCCCCCCCCCCHHHHHHHHHC---CCCEEEECCCCCHHHHHHHHHCCCCEEEECCCC
T ss_conf             97---2334--------5676--767787899869999999958---998997479899999999998499899989754


Q ss_pred             HCCCHHHH-HHHHHHH
Q ss_conf             70697899-9999999
Q gi|254780434|r  320 IYEGISLP-KRIIQGL  334 (362)
Q Consensus       320 i~~Gp~~~-~~I~~~L  334 (362)
                       -+ |..+ ++-.+.+
T Consensus       207 -Tr-P~~IT~~F~~ai  220 (222)
T PRK01130        207 -TR-PEEITKWFVDAL  220 (222)
T ss_pred             -CC-HHHHHHHHHHHH
T ss_conf             -79-899999999997


No 141
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein; InterPro: IPR008205   This family contains prokaryotic proteins that are related to pcrB. Staphylococcus aureus chromosomal gene pcrA encodes a protein with significant similarity (40 0dentity) to two Escherichia coli helicases: the helicase II encoded by the uvrD gene and the Rep helicase. PcrB gene seems to belong to an operon containing at least one other gene, pcrBA, downstream from pcrB . The PcrB proteins often contain an FMN binding site although the function of these proteins is still unknown..
Probab=97.96  E-value=7.7e-05  Score=52.41  Aligned_cols=78  Identities=19%  Similarity=0.226  Sum_probs=64.3

Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHH--CCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHH
Q ss_conf             775446322113564542468999999974--089748999678899999999998399975452787706978999999
Q gi|254780434|r  254 CSDNHEQDGGLSGSPLFLKSTIALAKIRQR--VGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRII  331 (362)
Q Consensus       254 ~~~~~~~~GGlSG~~i~~~al~~i~~i~~~--~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~  331 (362)
                      .+....|+||=-|.|+.|-....|+++-..  ++++..++=.|||.|.|+|.++..||||.|=++| ++|+.+.++..+.
T Consensus       160 ~~~~YLEagsgap~pvpPE~va~vk~v~~~aGyGGe~~L~vGGGIRs~E~A~~~a~AgAD~~VtGn-vie~~~nv~~k~~  238 (242)
T TIGR01768       160 MPIIYLEAGSGAPEPVPPELVAEVKKVLDKAGYGGEVKLIVGGGIRSVEKARKLAEAGADVVVTGN-VIEEDDNVVDKAL  238 (242)
T ss_pred             CCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEEEE-EEECCHHHHHHHH
T ss_conf             968999637875479745899999987410478863257840764788999999534598999846-8751637899999


Q ss_pred             H
Q ss_conf             9
Q gi|254780434|r  332 Q  332 (362)
Q Consensus       332 ~  332 (362)
                      +
T Consensus       239 ~  239 (242)
T TIGR01768       239 E  239 (242)
T ss_pred             H
T ss_conf             9


No 142
>pfam04481 DUF561 Protein of unknown function (DUF561). Protein of unknown function found in a cyanobacterium, and the chloroplasts of algae.
Probab=97.93  E-value=0.0013  Score=44.13  Aligned_cols=176  Identities=18%  Similarity=0.092  Sum_probs=100.3

Q ss_pred             HCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEE-ECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             00121000110454246788776555420675526983-03336532211000023432111122444556553126885
Q gi|254780434|r  132 PTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTI-NISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFV  210 (362)
Q Consensus       132 ~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEi-NiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~  210 (362)
                      .+.|+-||--       +.+.|.   ..+..+||.+|| |+-|=-.. +|.|...+-    +.-.++.|     ..-.++
T Consensus        60 ~~lPiCVSaV-------ep~~f~---~aV~AGA~lvEIGNfDsFY~q-Gr~f~a~eV----L~Lt~~Tr-----~LLP~~  119 (243)
T pfam04481        60 SNIPICVSAV-------EPELLY---EAVLAGADLVEIGNFDSFYKQ-GRVLSVCEI----IALVKETR-----KLLPHT  119 (243)
T ss_pred             CCCCEEEECC-------CHHHHH---HHHHHCCCEEEECCHHHHHHC-CCEECHHHH----HHHHHHHH-----HHCCCC
T ss_conf             8998586047-------978889---999827878986453647654-766449999----99999999-----768998


Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC-HHHHHHHHHHHHHCCCCEE
Q ss_conf             178650577774888999998764498299980665553234577544632211356454-2468999999974089748
Q gi|254780434|r  211 PIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLF-LKSTIALAKIRQRVGPKIA  289 (362)
Q Consensus       211 Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~-~~al~~i~~i~~~~~~~i~  289 (362)
                      |+-|-+|.-+..++..+++..+++.|+|=|-   |-+...   .   .+...|..|---+ -.++...+.+.+.+  ++|
T Consensus       120 ~LsVTVPHiL~ld~Qv~LA~~L~~~GaDiIQ---TEGgts---s---~p~~~g~~glIekaapTLAaay~IS~~v--~vP  188 (243)
T pfam04481       120 PLCVTIPHILKLKEQINLAKQLESLGIDLIQ---TEGKIT---S---ISKNHCVNDLIEKSASTLASTYEISKHV--QLP  188 (243)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHCCCEEE---CCCCCC---C---CCCCCCHHHHHHHHHHHHHHHHHHHHCC--CCC
T ss_conf             4477457635678999999999981887787---289877---7---8888425777988758899999998617--876


Q ss_pred             EEEECCCCCHHHHHHHHHCCCCEEEECHHHHC-CCHHHHHHHHHHHHHHHH
Q ss_conf             99967889999999999839997545278770-697899999999999999
Q gi|254780434|r  290 IIGTGGISSTKDALDKIMAGANLIQLYSAMIY-EGISLPKRIIQGLSDFLN  339 (362)
Q Consensus       290 IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~-~Gp~~~~~I~~~L~~~l~  339 (362)
                      ||..-|+++ -.+---+.+||+-|.++|+.-. +...-.--..++|.+-|.
T Consensus       189 VlcASGlS~-vT~PmAiaaGAsGVGVGSavn~Lnd~~aMva~vr~l~~al~  238 (243)
T pfam04481       189 VICASGLSD-VTVPLAFSYGASGIGIGSAVSKLNDIEKMVNYISEIKKAIS  238 (243)
T ss_pred             EEECCCCCH-HHHHHHHHCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             675467642-14788997487710065776500249999999999999973


No 143
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein; InterPro: IPR005992    This family of proteins, often annotated as a putative IMP dehydrogenase, are related to IMP dehydrogenase and GMP reductase. Most species with a member of this family belong to the high GC Gram-positive bacteria..
Probab=97.93  E-value=0.00062  Score=46.29  Aligned_cols=51  Identities=25%  Similarity=0.428  Sum_probs=35.1

Q ss_pred             HHHHHHHHHHHH----HCCCC-EEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             246899999997----40897-4899967889999999999839997545278770
Q gi|254780434|r  271 LKSTIALAKIRQ----RVGPK-IAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       271 ~~al~~i~~i~~----~~~~~-i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      +.|..=++-.|+    +++++ ++||+=|||.+.=|..+-|.+|||+|.++|-+-.
T Consensus       239 ATAiAD~AAARrDYLdEtGGRYVHviADG~i~~sGd~~KAIACGADAV~lGSPLAr  294 (376)
T TIGR01304       239 ATAIADVAAARRDYLDETGGRYVHVIADGGIETSGDLAKAIACGADAVVLGSPLAR  294 (376)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCHHHHEECCCCHHHHCCCHHH
T ss_conf             67899999730113330689337788628705546300100137760200780256


No 144
>pfam01791 DeoC DeoC/LacD family aldolase. This family includes diverse aldolase enzymes. This family includes the enzyme deoxyribose-phosphate aldolase EC:4.1.2.4, which is involved in nucleotide metabolism. The family also includes a group of related bacterial proteins of unknown function. The family also includes tagatose 1,6-diphosphate aldolase (EC:4.1.2.40) is part of the tagatose-6-phosphate pathway of galactose-6-phosphate degradation.
Probab=97.92  E-value=0.00038  Score=47.77  Aligned_cols=91  Identities=18%  Similarity=0.186  Sum_probs=59.2

Q ss_pred             CCCCEEEEECCC-------CCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             688517865057-------7774888999998764498299980665553234577544632211356454246899999
Q gi|254780434|r  207 GKFVPIFLKISP-------DLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAK  279 (362)
Q Consensus       207 ~~~~Pi~vKLsP-------d~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~  279 (362)
                      ...+|+++-.-|       ..+.+.+...++.+.+.|+|-|=. .|.              ++ -.     ..+..-++.
T Consensus       121 ~~~lkvIiE~~~~~~~~~~~~~~~~i~~a~ria~e~GaD~vKt-stg--------------~~-~~-----gat~~~v~~  179 (231)
T pfam01791       121 GEGLKVILEAYLRGEEIKDKVDPHLVAKATRVGAEAGADFVKT-STG--------------FG-ER-----GATEEDVQI  179 (231)
T ss_pred             HCCCEEEEEEEECCCHHCCCCCHHHHHHHHHHHHHHCCCEEEE-CCC--------------CC-CC-----CCCHHHHHH
T ss_conf             0487089998515721003268999999999999959998981-578--------------78-88-----778889999


Q ss_pred             HHHHCCCC-EEEEEECCC------CCHHHHHHHHHCCCCEEEECHH
Q ss_conf             99740897-489996788------9999999999839997545278
Q gi|254780434|r  280 IRQRVGPK-IAIIGTGGI------SSTKDALDKIMAGANLIQLYSA  318 (362)
Q Consensus       280 i~~~~~~~-i~IIg~GGI------~s~~Da~e~l~aGAs~VQi~Ta  318 (362)
                      +++..+.. ++|..+|||      .+.+++.+++.|||+...+.++
T Consensus       180 ~~~~~~~~~~~Vk~sGGi~~~~~~~~l~~a~~~i~aGA~~~G~s~G  225 (231)
T pfam01791       180 FKEVVGGAPPGVKASGGIKEKDFLRTVEDAIALIEAGADRIGVSAG  225 (231)
T ss_pred             HHHHHCCCCCCEEEECCCCCCCHHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             9998568787489933868643789999999999869981209998


No 145
>PRK13131 consensus
Probab=97.90  E-value=0.00052  Score=46.84  Aligned_cols=226  Identities=18%  Similarity=0.227  Sum_probs=115.7

Q ss_pred             ECCC-CCC--CHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHH---HHHHHHHHHHC
Q ss_conf             5346-888--67798887403675241020013687899886268842555410000247777788---99987641000
Q gi|254780434|r   60 MAAG-YDK--NAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHT---VFSRLSKIQPT  133 (362)
Q Consensus        60 lAaG-~dk--~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~---~~~~l~~~~~~  133 (362)
                      +-+| +|.  +.+.++.+.+.|...+|+|==-..|-.-  .|-+. ....+++      +|--...   +++++++...+
T Consensus        17 itaG~P~~e~s~~~~~~l~~~GadiiEiGiPFSDP~AD--GpvIQ-~a~~rAL------~~g~~~~~~~~~~~~r~~~~~   87 (257)
T PRK13131         17 VTLGDPNYELSFEIIKTLIISGVSALELGFAFSDPVAD--GITIQ-ASHLRAL------KHASMAKNFQLLKKIRDYNHH   87 (257)
T ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHH------HCCCHHHHHHHHHHHHHCCCC
T ss_conf             61868998899999999997799999978998885545--59999-9999999------789889999999998704999


Q ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEE-ECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             121000110454246788776555420675526983-0333653221100002343211112244455655312688517
Q gi|254780434|r  134 SPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTI-NISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPI  212 (362)
Q Consensus       134 ~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEi-NiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi  212 (362)
                      .|+..=--.|.--.-.+++|.+.+++.+  +|.+-+ .+  |.          +.-.++..+..        +  ..+.+
T Consensus        88 ~pivlM~Y~N~i~~yG~e~F~~~~~~~G--vdGvIipDL--P~----------eE~~~~~~~~~--------~--~~l~~  143 (257)
T PRK13131         88 IPIGLLAYANLIFSYGVDGFYAQAKECG--VDSVLIADM--PL----------IEKELVIKSAQ--------K--HQIKQ  143 (257)
T ss_pred             CCEEEECCHHHHHHHCHHHHHHHHHHCC--CCCEECCCC--CH----------HHHHHHHHHHH--------H--CCCCE
T ss_conf             8889992768999857999999998659--985655899--96----------78899999999--------7--79847


Q ss_pred             EEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             86505777748889999987644982999806655532345775446322113564542468999999974089748999
Q gi|254780434|r  213 FLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIG  292 (362)
Q Consensus       213 ~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg  292 (362)
                      +-=++|..+++++..+++.     ++|++=.=+   +.++....          ..+.......++.+|+..  ++|+ .
T Consensus       144 I~lvaPtt~~~Ri~~i~~~-----s~GFiY~vs---~~GvTG~~----------~~~~~~~~~~i~~ik~~t--~~Pv-~  202 (257)
T PRK13131        144 IFIASPNASVKDLEQVATH-----SQGYIYTLA---RSGVTGAS----------HTLENDASAIIKTLKTFS--PTPA-L  202 (257)
T ss_pred             EEEECCCCCHHHHHHHHHC-----CCCEEEEEE---CCCCCCCC----------CCCCHHHHHHHHHHHHCC--CCCE-E
T ss_conf             9972899988999999835-----897499984---57677986----------434076999999999668--9987-9


Q ss_pred             EC-CCCCHHHHHHHHHCCCCEEEECHHHHC---CCHHHHHHHHHHHHHHHH
Q ss_conf             67-889999999999839997545278770---697899999999999999
Q gi|254780434|r  293 TG-GISSTKDALDKIMAGANLIQLYSAMIY---EGISLPKRIIQGLSDFLN  339 (362)
Q Consensus       293 ~G-GI~s~~Da~e~l~aGAs~VQi~Tali~---~Gp~~~~~I~~~L~~~l~  339 (362)
                      +| ||++.+|+.+....|||.|=++|+++-   ++..--..+.+.++++.+
T Consensus       203 vGFGIs~~e~v~~~~~~gaDGvIVGSaiV~~I~~~~~~~~~~~~~i~~fv~  253 (257)
T PRK13131        203 LGFGISKKEHITNAKGMGADGVICGSALVKIIEENLNNENAMLEKIKGFIG  253 (257)
T ss_pred             EECCCCCHHHHHHHHHCCCCEEEECHHHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             980579889999998559999998789999998727888999999999999


No 146
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism]
Probab=97.89  E-value=0.0013  Score=44.05  Aligned_cols=84  Identities=27%  Similarity=0.389  Sum_probs=67.5

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHH
Q ss_conf             88899999876449829998066555323457754463221135645424689999999740897489996788999999
Q gi|254780434|r  223 EELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDA  302 (362)
Q Consensus       223 ~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da  302 (362)
                      -.+.++++..++.|+.+|+.++  +++++           -++|+-     ...+.++.+.+  ++|+|++|||.|-+|.
T Consensus       147 ~~~~~l~~~~~~~g~~~ii~Td--I~~DG-----------tl~G~n-----~~l~~~l~~~~--~ipviaSGGv~s~~Di  206 (241)
T COG0106         147 VELEELAKRLEEVGLAHILYTD--ISRDG-----------TLSGPN-----VDLVKELAEAV--DIPVIASGGVSSLDDI  206 (241)
T ss_pred             CCHHHHHHHHHHCCCCEEEEEE--CCCCC-----------CCCCCC-----HHHHHHHHHHH--CCCEEEECCCCCHHHH
T ss_conf             7899999999857877699985--14466-----------457778-----79999999982--7678986686879999


Q ss_pred             HHHHHC-CCCEEEECHHHHCCCHHHH
Q ss_conf             999983-9997545278770697899
Q gi|254780434|r  303 LDKIMA-GANLIQLYSAMIYEGISLP  327 (362)
Q Consensus       303 ~e~l~a-GAs~VQi~Tali~~Gp~~~  327 (362)
                      ...-.. |..-|-+++|+ |+|-.-+
T Consensus       207 ~~l~~~~G~~GvIvG~AL-y~g~~~l  231 (241)
T COG0106         207 KALKELSGVEGVIVGRAL-YEGKFTL  231 (241)
T ss_pred             HHHHHCCCCCEEEEEHHH-HCCCCCH
T ss_conf             999855797289986689-6489789


No 147
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional
Probab=97.88  E-value=0.00074  Score=45.78  Aligned_cols=193  Identities=16%  Similarity=0.196  Sum_probs=103.9

Q ss_pred             HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCH
Q ss_conf             77988874036752410200136878998862688425554100002477777889998764100012100011045424
Q gi|254780434|r   68 AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSK  147 (362)
Q Consensus        68 ~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~  147 (362)
                      .+..+.|.+.|+-.+.+=-+  ..-.|++                   .|   ..+++++.+. ...|  +.+|+.--+.
T Consensus        32 ~~~a~~~~~~Ga~~lhvvDL--daa~g~~-------------------~N---~~~I~~i~~~-~~~p--iqvGGGIrs~   84 (231)
T PRK13586         32 LKIAEELYNEGYDSIHVVDL--DAAEGKG-------------------DN---EEYIKRICKI-GFSW--IQVGGGIRDV   84 (231)
T ss_pred             HHHHHHHHHCCCCEEEEEEC--CCCCCCC-------------------CH---HHHHHHHHHH-CCCC--EEEECCCCCH
T ss_conf             99999999879998999967--1568998-------------------43---9999999974-5985--7985671769


Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHH
Q ss_conf             67887765554206755269830333653221100002343211112244455655312688517865057777488899
Q gi|254780434|r  148 DFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDD  227 (362)
Q Consensus       148 ~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~  227 (362)
                      +.++.      .+..+||-+.+|=.        .+.+++.+.+++...-..+............+..+ .+..+...+.+
T Consensus        85 e~~~~------~l~~Ga~kViigS~--------a~~np~~~~~~~~~~G~~~iv~siD~~~~~~v~~~-Gw~~~~~~~~~  149 (231)
T PRK13586         85 EKAER------LLSYDCSAIVMSTL--------PFTNPDTFRRIVAGIGENRVLVSVDYDDRKYVLIK-GWKEKSMKVED  149 (231)
T ss_pred             HHHHH------HHHCCCCEEEECHH--------HHHCHHHHHHHHHHHCCCCEEEEEEECCCCEEEEE-CCCCCCCCHHH
T ss_conf             99999------99779988997688--------87695999999998499668999997589689984-87268866999


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHH
Q ss_conf             99987644982999806655532345775446322113564542468999999974089748999678899999999998
Q gi|254780434|r  228 IAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIM  307 (362)
Q Consensus       228 ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~  307 (362)
                      +++.+.+.|+..+++++  +++++           -++|+-     +...+.+....  ..+++ +|||.|-+|..+...
T Consensus       150 ~i~~~~~~g~~~ii~Td--I~~DG-----------t~~G~d-----~~l~~~i~~~~--~~~i~-aGGi~s~~Di~~L~~  208 (231)
T PRK13586        150 AISHVNSLESLGVIFTY--VCNEG-----------TKNGID-----NNVKRYVKLVK--GEKEY-AGGIGSIQDLQKLKK  208 (231)
T ss_pred             HHHHHHHCCCCEEEEEE--ECCHH-----------CCCCCC-----HHHHHHHHHCC--CCCEE-ECCCCCHHHHHHHHH
T ss_conf             99999975998899976--45112-----------036899-----89999998718--99599-868899999999986


Q ss_pred             CCCCEEEECHHHHCCCH
Q ss_conf             39997545278770697
Q gi|254780434|r  308 AGANLIQLYSAMIYEGI  324 (362)
Q Consensus       308 aGAs~VQi~Tali~~Gp  324 (362)
                      +|++.|-+++|+ |+|-
T Consensus       209 ~G~~gaivG~Al-y~G~  224 (231)
T PRK13586        209 MGFDYAIVGMSF-YAGV  224 (231)
T ss_pred             CCCCEEEEEHHH-HCCC
T ss_conf             799889999788-6882


No 148
>cd00945 Aldolase_Class_I Class I aldolases. The class I aldolases use an active-site lysine which stablilzes a reaction intermediates via Schiff base formation, and have TIM beta/alpha barrel fold. The members of this family include 2-keto-3-deoxy-6-phosphogluconate (KDPG) and 2-keto-4-hydroxyglutarate (KHG) aldolases, transaldolase, dihydrodipicolinate synthase sub-family, Type I 3-dehydroquinate dehydratase, DeoC and DhnA proteins, and metal-independent fructose-1,6-bisphosphate aldolase. Although structurally similar, the class II aldolases use a different mechanism and are believed to have an independent evolutionary origin.
Probab=97.87  E-value=0.0016  Score=43.49  Aligned_cols=85  Identities=25%  Similarity=0.319  Sum_probs=60.1

Q ss_pred             CEEEEEC-CCCC-CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             5178650-5777-7488899999876449829998066555323457754463221135645424689999999740897
Q gi|254780434|r  210 VPIFLKI-SPDL-SEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPK  287 (362)
Q Consensus       210 ~Pi~vKL-sPd~-~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~  287 (362)
                      +|+.+=+ +..+ +.+++...++.+.+.|+|.|=-+ |           .   ++  .    ....+..++.+++..+++
T Consensus       114 ~~~kvi~e~~~l~~~~~i~~a~~~~~~~GadfvKts-t-----------G---~~--~----~~at~~~v~~m~~~~~~~  172 (201)
T cd00945         114 LPLKVILETRGLKTADEIAKAARIAAEAGADFIKTS-T-----------G---FG--G----GGATVEDVKLMKEAVGGR  172 (201)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEC-C-----------C---CC--C----CCCCHHHHHHHHHHHCCC
T ss_conf             837999616778999999999999998099879855-8-----------8---78--8----989999999999982878


Q ss_pred             EEEEEECCCCCHHHHHHHHHCCCCEEEE
Q ss_conf             4899967889999999999839997545
Q gi|254780434|r  288 IAIIGTGGISSTKDALDKIMAGANLIQL  315 (362)
Q Consensus       288 i~IIg~GGI~s~~Da~e~l~aGAs~VQi  315 (362)
                      ++|.++|||.+.+++.+++.+||+.+..
T Consensus       173 ~~vk~sGGi~~~~~a~~~l~aGa~~igt  200 (201)
T cd00945         173 VGVKAAGGIKTLEDALAAIEAGADGIGT  200 (201)
T ss_pred             CEEECCCCCCCHHHHHHHHHHCCCEEEC
T ss_conf             6386358979999999999828653537


No 149
>PRK13112 consensus
Probab=97.83  E-value=0.0003  Score=48.45  Aligned_cols=208  Identities=17%  Similarity=0.183  Sum_probs=109.4

Q ss_pred             CCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHH---HHCC
Q ss_conf             346-88--86779888740367524102001368789988626884255541000024777778899987641---0001
Q gi|254780434|r   61 AAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKI---QPTS  134 (362)
Q Consensus        61 AaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~---~~~~  134 (362)
                      -+| +|  .+.+.++.+.+.|...+|+|==-..|..-  .|-+. ...++++-|-+     .++.+++-+++.   ....
T Consensus        25 taG~P~~~~s~~~l~~l~~~GaDiiElGiPFSDPvAD--GPvIQ-~A~~rAL~~G~-----~~~~~~~~~~~ir~~~~~~   96 (279)
T PRK13112         25 MGGDPDLETSLKIMKALPKAGADIIELGMPFSDPMAD--GPAIQ-AAGLRALKAGQ-----TLAKTLYLAREFRKDDDTT   96 (279)
T ss_pred             ECCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCC--CHHHH-HHHHHHHHCCC-----CHHHHHHHHHHHHCCCCCC
T ss_conf             0738997899999999987799989978998986665--79999-99999997699-----6889999999851348998


Q ss_pred             CCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             21000110454246788776555420675526983033365322110000234321111224445565531268851786
Q gi|254780434|r  135 PIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFL  214 (362)
Q Consensus       135 pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~v  214 (362)
                      |+++=-=.|.--...++.|.+.+++.+  +|.+-+ .-+|.          +.-.++..+..          ...+.++-
T Consensus        97 PivlM~Y~N~i~~~G~e~F~~~~~~aG--vdGvIi-pDLP~----------eE~~~~~~~~~----------~~~i~~I~  153 (279)
T PRK13112         97 PIVLMGYYNPIYIYGVERFLTDAKAAG--VDGLIV-VDLPP----------EMDAELCIPAM----------KAGINFIR  153 (279)
T ss_pred             CEEEEEECHHHHHHCHHHHHHHHHHCC--CCEEEE-CCCCH----------HHHHHHHHHHH----------HCCCCEEE
T ss_conf             879985124998847999999999739--987984-69997----------88899999998----------57834699


Q ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             50577774888999998764498299980665553234577544632211356454246899999997408974899967
Q gi|254780434|r  215 KISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTG  294 (362)
Q Consensus       215 KLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~G  294 (362)
                      =++|..+++.+..+++.+     .|++-.=+   +.++....          ..+.......|..+++.+  ++|| .+|
T Consensus       154 lvaPtt~~eRi~~i~~~s-----~GFiY~Vs---~~GvTG~~----------~~~~~~~~~~i~~ik~~t--~~Pv-~vG  212 (279)
T PRK13112        154 LATPTTDDKRLPKVLANT-----SGFVYYVS---MTGITGSA----------LADTSAVGEAVARIKRHT--DLPV-CVG  212 (279)
T ss_pred             EECCCCCHHHHHHHHHCC-----CCCEEEEE---CCCCCCCC----------CCCHHHHHHHHHHHHHHC--CCCC-EEE
T ss_conf             825899899999998527-----88089983---56666766----------456488999999999717--8987-678


Q ss_pred             -CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             -889999999999839997545278770
Q gi|254780434|r  295 -GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       295 -GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                       ||.+++||. .+..+||-|=|+|+++-
T Consensus       213 FGIs~~e~~~-~~~~~aDGvIVGSAiVk  239 (279)
T PRK13112        213 FGVKTPEQAR-AIAAHADGVVVGTAIVN  239 (279)
T ss_pred             ECCCCHHHHH-HHHCCCCEEEECHHHHH
T ss_conf             3569999999-99725999998779999


No 150
>PRK07107 inositol-5-monophosphate dehydrogenase; Validated
Probab=97.81  E-value=0.0038  Score=41.02  Aligned_cols=35  Identities=29%  Similarity=0.335  Sum_probs=31.9

Q ss_pred             CCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHH
Q ss_conf             89748999678899999999998399975452787
Q gi|254780434|r  285 GPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAM  319 (362)
Q Consensus       285 ~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tal  319 (362)
                      +..+|||+-|||...-|+.+.|.+|||+|++++-|
T Consensus       350 g~~vpiiADGGi~~sGDi~KAlaaGA~~VMlGsll  384 (497)
T PRK07107        350 GVYIPICSDGGIVHDYHMTLALAMGADFIMLGRYF  384 (497)
T ss_pred             CCCCEEECCCCCCCCCHHHHHHHCCCCEEEECCCC
T ss_conf             67632871787565545999985389889988110


No 151
>PRK02747 consensus
Probab=97.77  E-value=0.00042  Score=47.48  Aligned_cols=88  Identities=14%  Similarity=0.136  Sum_probs=59.4

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHH
Q ss_conf             99999876449829998066555323457754463221135645424689999999740897489996788999999999
Q gi|254780434|r  226 DDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDK  305 (362)
Q Consensus       226 ~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~  305 (362)
                      .+.++.-.+.|+|-+++.+-..+               ..|   ++.-+..|+++++.+  .+||--.|||.|-+||.++
T Consensus        33 ~~~ak~~~~~Gadelh~vDl~~a---------------~~~---~~~~~~lI~~i~~~~--~ipi~vGGGIrs~e~~~~l   92 (257)
T PRK02747         33 VEAARAYDAAGADELCFLDITAS---------------HEN---RGTMLDVVARTAEQC--FMPLTVGGGVRTVDDIRKL   92 (257)
T ss_pred             HHHHHHHHHCCCCEEEEEECCCC---------------CCC---CHHHHHHHHHHHHHC--CCCEEEECCCCCHHHHHHH
T ss_conf             99999999869998999947677---------------567---552899999999866--9988984882073887899


Q ss_pred             HHCCCCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             98399975452787706978999999999
Q gi|254780434|r  306 IMAGANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       306 l~aGAs~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                      +.+|||-|-++|+.+ +.|.+++++.+..
T Consensus        93 l~~GadkViigs~a~-~np~l~~~~~~~f  120 (257)
T PRK02747         93 LLAGADKVSINSAAV-ARPEFVAEAADKF  120 (257)
T ss_pred             HHCCCCEEEECHHHH-HCCHHHHHHHHHC
T ss_conf             876996898344465-4834777788755


No 152
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit; InterPro: IPR004651 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes. Proteins involved in steps 4 and 6 of the histidine biosynthesis pathway are contained in one family. These enzymes are called His6 and His7 in eukaryotes and HisA and HisF in prokaryotes. HisA is a phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (), involved in the fourth step of histidine biosynthesis. The bacterial HisF protein is a cyclase which catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate during the sixth step of histidine biosynthesis. The yeast His7 protein is a bifunctional protein which catalyzes an amido-transferase reaction that generates imidazole-glycerol phosphate and 5-aminoimidazol-4-carboxamide. The latter is the ribonucleotide used for purine biosynthesis. The enzyme also catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate, and is involved in the fifth and sixth steps in histidine biosynthesis.    This family describes the histidine biosynthesis protein, HisF. ; GO: 0000107 imidazoleglycerol-phosphate synthase activity, 0000105 histidine biosynthetic process, 0005737 cytoplasm, 0009382 imidazoleglycerol-phosphate synthase complex.
Probab=97.77  E-value=0.00013  Score=50.94  Aligned_cols=256  Identities=16%  Similarity=0.189  Sum_probs=141.8

Q ss_pred             HHCCCCCCCCCCEEEECCEECCCC-EEECCCC---CCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCC
Q ss_conf             110467889631168887335997-4853468---886779888740367524102001368789988626884255541
Q gi|254780434|r   34 LSFFPVHSDPRLNTKVAGISLSNP-LGMAAGY---DKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAI  109 (362)
Q Consensus        34 ~~~~~~~~~~~L~~~~~Gl~~~nP-iglAaG~---dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~i  109 (362)
                      +...-...+++ ..=+.|++|.|. ---.-|+   ..=-|.-+.+.+-|+-=+|.==||.-.-    .| +     .+  
T Consensus         8 PCLDV~~~~~~-GrVVKGv~F~~reksdGkGlrdaGDPVeLA~~Y~~eGADELVFLDITAS~e----cP-l-----~R--   74 (312)
T TIGR00735         8 PCLDVRDNDGD-GRVVKGVQFLNREKSDGKGLRDAGDPVELAQRYDEEGADELVFLDITASSE----CP-L-----GR--   74 (312)
T ss_pred             CCCCCCCCCCC-CEEECCEEECCCCCCCCCCHHHCCCHHHHHHHHHHCCCCEEEECCCCCCCC----CC-C-----CC--
T ss_conf             44566577899-447724231003343554201217823789998762895898514113666----78-8-----88--


Q ss_pred             EEECCCCCCCHHHHHHHHHHHHH--CCCCCCEEECCCCCHHHHHHHH-------HHH-HHHCCCCCEEEEE---CCCCCC
Q ss_conf             00002477777889998764100--0121000110454246788776-------555-4206755269830---333653
Q gi|254780434|r  110 INKLGFNNAGYHTVFSRLSKIQP--TSPIGINLGANKDSKDFILDYV-------SGI-RLFFTIASYFTIN---ISSPNT  176 (362)
Q Consensus       110 iN~~Gl~N~G~~~~~~~l~~~~~--~~pi~vsI~~~~~s~~~~~dy~-------~~~-~~~~~~aD~iEiN---iSCPNt  176 (362)
                                 +.+++-+++.-.  .+|+=  +|+--   ..++|+.       +.. +.|..+||=+-||   +-+|+-
T Consensus        75 -----------~~m~~Vv~r~Ae~VfiPlT--VGGGI---~~~eD~~GtkiPalevas~~L~aGADKvSiNTaAv~~P~l  138 (312)
T TIGR00735        75 -----------ETMIDVVERTAEKVFIPLT--VGGGI---KSIEDVKGTKIPALEVASKLLRAGADKVSINTAAVKNPEL  138 (312)
T ss_pred             -----------CCHHHHHHHHHHHCCCCEE--ECCCC---CCHHHCCCCCCCHHHHHHHHHHCCCCEEEECCHHHHCCHH
T ss_conf             -----------0116788887521452222--16888---8432045644427899999985489846328467508447


Q ss_pred             C-CCCCC---CCH-------HHHHHHHHHHHHHHHHHHHHC-CCCCEEEEEC-------------CCCC----CHHHHHH
Q ss_conf             2-21100---002-------343211112244455655312-6885178650-------------5777----7488899
Q gi|254780434|r  177 P-GLRSL---QKK-------KNLERLLIHVMQTREEEKIKT-GKFVPIFLKI-------------SPDL----SEEELDD  227 (362)
Q Consensus       177 ~-g~~~~---~~~-------~~l~~~l~~v~~~~~~~~~~~-~~~~Pi~vKL-------------sPd~----~~~~i~~  227 (362)
                      - .+-..   .+|       =+-++++-++-.++....... .+.. ..+++             .=..    +.-+..+
T Consensus       139 i~e~a~~GdGtsPietiskaFGsQciVvaIDakr~~~~~~~~~k~~-f~~e~~dGy~~y~V~~~GGR~~rtr~tg~da~~  217 (312)
T TIGR00735       139 ISEAADRGDGTSPIETISKAFGSQCIVVAIDAKRVYVNSNPDEKNE-FIVEVEDGYCWYEVYIYGGRESRTRVTGLDAVE  217 (312)
T ss_pred             HHHHHHCCCCCCHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCC-EEEECCCCCEEEEEEEECCCCCCCCCCHHHHHH
T ss_conf             8998732787551566653138517997552640544556333465-078733896026899830865554102067999


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHH
Q ss_conf             99987644982999806655532345775446322113564542468999999974089748999678899999999998
Q gi|254780434|r  228 IAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIM  307 (362)
Q Consensus       228 ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~  307 (362)
                      .++.+++-||==|.+ |. +++++.     +.++         +  +.+++.+++.+  ++|+|++||.-+.++.+|-+.
T Consensus       218 Wa~~v~~lGAGEILL-ts-mD~DG~-----k~GY---------D--l~L~~~v~e~v--~iPVIASGGAG~~eHf~EAF~  277 (312)
T TIGR00735       218 WAKEVEKLGAGEILL-TS-MDRDGT-----KSGY---------D--LELTKAVSEAV--KIPVIASGGAGKPEHFYEAFT  277 (312)
T ss_pred             HHHHHHHCCCCEEEE-EC-CCCCCC-----CCCC---------C--HHHHHHHHHHC--CCCEEEECCCCCCCCHHHHHH
T ss_conf             999987458856653-03-374678-----7877---------6--89999898416--656575078798530032221


Q ss_pred             CC-CCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             39-99754527877069789999999999999983899
Q gi|254780434|r  308 AG-ANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEV  344 (362)
Q Consensus       308 aG-As~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~  344 (362)
                      .| ||++=..|-|.|+=..     ..||++||.++|+.
T Consensus       278 ~gkADAaLaAS~FH~~e~~-----I~evK~YL~~~Gi~  310 (312)
T TIGR00735       278 KGKADAALAASIFHYREIT-----IGEVKEYLAERGIP  310 (312)
T ss_pred             CCCHHHHHHHHHHHCCCCC-----HHHHHHHHHHCCCC
T ss_conf             0003453443555104554-----89999999964787


No 153
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed
Probab=97.74  E-value=0.00022  Score=49.34  Aligned_cols=62  Identities=19%  Similarity=0.375  Sum_probs=44.9

Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             9999999740897489996788999999999983999754527877069789999999999999
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFL  338 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l  338 (362)
                      ..++.++.-++++++++.+|||.. +++.+|+.+||.+|.++|.+.-.| ....+|.+--++++
T Consensus       139 ~~ikal~~p~P~~~~~~ptGGV~~-~N~~~~l~aGa~avG~Gs~L~~~~-~~~~~i~~~a~~fv  200 (206)
T PRK09140        139 AGIKALRAVLPPDVPVFAVGGVTP-ENLAPYLAAGAAGFGLGSALYRPG-QSAEEVAERARAFV  200 (206)
T ss_pred             HHHHHHHCCCCCCCEEEECCCCCH-HHHHHHHHCCCCEEEECHHCCCCC-CCHHHHHHHHHHHH
T ss_conf             999998643899998995379888-889999986991999606515999-99999999999999


No 154
>KOG1799 consensus
Probab=97.74  E-value=3.2e-06  Score=61.69  Aligned_cols=29  Identities=10%  Similarity=-0.044  Sum_probs=14.2

Q ss_pred             CHHHHHHHHHHHHHHCC-CCCEEEE-ECCCC
Q ss_conf             24678877655542067-5526983-03336
Q gi|254780434|r  146 SKDFILDYVSGIRLFFT-IASYFTI-NISSP  174 (362)
Q Consensus       146 s~~~~~dy~~~~~~~~~-~aD~iEi-NiSCP  174 (362)
                      ++...+.|..+++++.. +-+-+.| .+-|-
T Consensus       184 sdr~~e~~L~~f~eLk~~~p~~imIas~Mci  214 (471)
T KOG1799         184 SDRKAEQYLGTFGELKNVEPVVIMIASEMCI  214 (471)
T ss_pred             CCCHHHHHHHHHHHHCCCCCCEEEEHHHHHH
T ss_conf             4523999999999750148834634678988


No 155
>PRK07107 inositol-5-monophosphate dehydrogenase; Validated
Probab=97.74  E-value=0.00048  Score=47.09  Aligned_cols=82  Identities=16%  Similarity=0.242  Sum_probs=57.5

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             85178650577774888999998764498299980665553234577544632211356454246899999997408974
Q gi|254780434|r  209 FVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKI  288 (362)
Q Consensus       209 ~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i  288 (362)
                      ++=+-+-+++    .+..+-++++.++|+|-+++ .|         ....      |     ....+.|+++++.+++.+
T Consensus       231 rL~VgAAIg~----~d~~eRa~~Lv~aGvD~lvi-D~---------AhGh------s-----~~v~~~ik~ik~~~~~~~  285 (497)
T PRK07107        231 RYVVGAGINT----RDYEERVPALVEAGADVLCI-DS---------SDGY------S-----EWQKRTLDYIKEKYGDTV  285 (497)
T ss_pred             CEEEEEECCC----CCHHHHHHHHHHCCCCEEEE-CC---------CCCC------H-----HHHHHHHHHHHHHCCCCC
T ss_conf             8889996377----78999999999859999980-34---------3535------2-----999999999998669876


Q ss_pred             EEEEECCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             8999678899999999998399975452
Q gi|254780434|r  289 AIIGTGGISSTKDALDKIMAGANLIQLY  316 (362)
Q Consensus       289 ~IIg~GGI~s~~Da~e~l~aGAs~VQi~  316 (362)
                       .|.+|-|.+++.+...+.||||+|-|+
T Consensus       286 -~i~aGNVaT~~~~~~L~~aGad~vkVG  312 (497)
T PRK07107        286 -KVGAGNVVDRDGFLYLAEAGADFVKVG  312 (497)
T ss_pred             -CCCCCCHHCHHHHHHHHHCCCCEEEEC
T ss_conf             -341452126999999998089868971


No 156
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; InterPro: IPR005990    Synonyms: Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase     IMP dehydrogenase (1.1.1.205 from EC,IMPDH) catalyzes the rate-limiting reaction of de novo GTP biosynthesis, the NAD-dependent reduction of IMP into XMP .  Inosine 5-phosphate + NAD+ + H2O = xanthosine 5-phosphate + NADH     IMP dehydrogenase is associated with cell proliferation and is a possible target for cancer chemotherapy. Mammalian and bacterial IMPDHs are tetramers of identical chains. There are two IMP dehydrogenase isozymes in humans . IMP dehydrogenase nearly always contains a long insertion that has two CBS domains within it and adopts a TIM barrel structure.; GO: 0003938 IMP dehydrogenase activity, 0006177 GMP biosynthetic process.
Probab=97.73  E-value=0.0052  Score=40.11  Aligned_cols=44  Identities=27%  Similarity=0.412  Sum_probs=35.7

Q ss_pred             HHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHH
Q ss_conf             6899999997408974899967889999999999839997545278
Q gi|254780434|r  273 STIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSA  318 (362)
Q Consensus       273 al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Ta  318 (362)
                      |...+++..+..  .+|+||=|||..-=|..+-|.||||+|+++|=
T Consensus       330 Av~~Va~~A~~~--Gi~VIADGGIr~SGDivKAlAaGA~aVMlGsl  373 (476)
T TIGR01302       330 AVYDVAEYAAQS--GIPVIADGGIRYSGDIVKALAAGADAVMLGSL  373 (476)
T ss_pred             HHHHHHHHHHHC--CCEEEECCCCCCHHHHHHHHHHCCCEEHHCCC
T ss_conf             999999999727--99099837756255899999816772202342


No 157
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF). The ProFAR isomerase catalyzes the fourth step in histidine biosynthesis, an isomerisation of the aminoaldose moiety of ProFAR to the aminoketose of PRFAR (N-(5'-phospho-D-1'-ribulosylformimino)-5-amino-1-(5''-phospho-ribosyl)-4-imidazolecarboxamide). In bacteria and archaea, ProFAR isomerase is encoded by the HisA gene. The Imidazole glycerol phosphate synthase (IGPS) catalyzes the fifth step of histidine biosynthesis, the formation of the imidazole ring. IGPS converts N1-(5'-phosphoribulosyl)-formimino-5-aminoimidazole-4-carboxamide ribonucleotide (PRFAR) to imidazole glycerol phosphate (ImGP) and 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR). This conversion involves two tightly coupled reactions in distinct active sites of IGPS. The two catalytic domains can be fused, like in fungi and pl
Probab=97.73  E-value=0.00082  Score=45.50  Aligned_cols=83  Identities=23%  Similarity=0.276  Sum_probs=58.4

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHH
Q ss_conf             89999987644982999806655532345775446322113564542468999999974089748999678899999999
Q gi|254780434|r  225 LDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALD  304 (362)
Q Consensus       225 i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e  304 (362)
                      ..++.+.+.+. +..+++++  +++++           -++|+.     +.+++++++..  ++|+|++|||.+.+|..+
T Consensus       148 ~~~~~~~~~~~-~~eii~t~--Id~dG-----------t~~G~d-----~~l~~~i~~~~--~~pvi~sGGv~s~~di~~  206 (233)
T cd04723         148 PEELLRRLAKW-PEELIVLD--IDRVG-----------SGQGPD-----LELLERLAARA--DIPVIAAGGVRSVEDLEL  206 (233)
T ss_pred             HHHHHHHHHHH-CCEEEEEE--ECCCC-----------CCCCCC-----HHHHHHHHHHC--CCCEEEECCCCCHHHHHH
T ss_conf             99999999965-89599986--43446-----------567779-----99999999868--998999889999999999


Q ss_pred             HHHCCCCEEEECHHHHCCCHHHHHH
Q ss_conf             9983999754527877069789999
Q gi|254780434|r  305 KIMAGANLIQLYSAMIYEGISLPKR  329 (362)
Q Consensus       305 ~l~aGAs~VQi~Tali~~Gp~~~~~  329 (362)
                      ....|++.|-++||| |+|---+.+
T Consensus       207 l~~~g~~gvivg~al-h~g~i~l~e  230 (233)
T cd04723         207 LKKLGASGALVASAL-HDGGLTLED  230 (233)
T ss_pred             HHHCCCCEEEEEHHH-HCCCCCHHH
T ss_conf             997899899986397-789978899


No 158
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism]
Probab=97.70  E-value=0.00075  Score=45.76  Aligned_cols=91  Identities=20%  Similarity=0.247  Sum_probs=72.5

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHH
Q ss_conf             88999998764498299980665553234577544632211356454246899999997408974899967889999999
Q gi|254780434|r  224 ELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDAL  303 (362)
Q Consensus       224 ~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~  303 (362)
                      +..++++.-.+.|+|-++.-+-|-+..               |   +..-+.+|+++.+.+  .+|+--.|||.|-+|+.
T Consensus        31 DpVelA~~Y~e~GADElvFlDItAs~~---------------g---r~~~~~vv~~~A~~v--fiPltVGGGI~s~eD~~   90 (256)
T COG0107          31 DPVELAKRYNEEGADELVFLDITASSE---------------G---RETMLDVVERVAEQV--FIPLTVGGGIRSVEDAR   90 (256)
T ss_pred             CHHHHHHHHHHCCCCEEEEEECCCCCC---------------C---CCCHHHHHHHHHHHC--EEEEEECCCCCCHHHHH
T ss_conf             949999999775997699986225656---------------6---620799999997303--03247547758889999


Q ss_pred             HHHHCCCCEEEECHHHHCCCHHHHHHHHHHHH
Q ss_conf             99983999754527877069789999999999
Q gi|254780434|r  304 DKIMAGANLIQLYSAMIYEGISLPKRIIQGLS  335 (362)
Q Consensus       304 e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~  335 (362)
                      +.+++|||=|.+-|+.+.+ |.+++++-+..-
T Consensus        91 ~ll~aGADKVSINsaAv~~-p~lI~~~a~~FG  121 (256)
T COG0107          91 KLLRAGADKVSINSAAVKD-PELITEAADRFG  121 (256)
T ss_pred             HHHHCCCCEEEECHHHHCC-HHHHHHHHHHHC
T ss_conf             9997699746528467509-599999999838


No 159
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed
Probab=97.69  E-value=0.00012  Score=51.04  Aligned_cols=67  Identities=25%  Similarity=0.310  Sum_probs=53.3

Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHH
Q ss_conf             446322113564542468999999974089748999678899999999998399975452787706978999
Q gi|254780434|r  257 NHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPK  328 (362)
Q Consensus       257 ~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~  328 (362)
                      ...++||-.|.|   ....+|+.+++.+. +.++|-.|||.|+++|.++..+|||.|-++|. +++.|....
T Consensus       159 iYLE~gsga~~p---v~~e~V~~v~~~l~-~~~LivGGGIrs~e~a~~~~~aGAD~IVvGn~-ie~d~~~~l  225 (229)
T PRK04169        159 VYLEYGGGAGDP---VPPEMVKAVKKALT-DTPLIVGGGIRSPEQAREMAKAGADTIVVGTI-IEEDIEKAL  225 (229)
T ss_pred             EEEECCCCCCCC---CCHHHHHHHHHHCC-CCCEEEECCCCCHHHHHHHHHCCCCEEEECCC-EECCHHHHH
T ss_conf             999658888997---89999999997378-98789928969999999999769999998862-010799998


No 160
>PRK02145 consensus
Probab=97.69  E-value=0.00054  Score=46.70  Aligned_cols=88  Identities=16%  Similarity=0.161  Sum_probs=60.3

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHH
Q ss_conf             99999876449829998066555323457754463221135645424689999999740897489996788999999999
Q gi|254780434|r  226 DDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDK  305 (362)
Q Consensus       226 ~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~  305 (362)
                      .++++.-.+.|+|-+++.+-...               ..|   ++.-+..|+.+.+.+  .+||--.|||.|-+|+.++
T Consensus        34 ~~~a~~~~~~GadelhivDld~a---------------~~~---~~~~~~~I~~i~~~~--~iPi~vGGGIrs~e~~~~l   93 (257)
T PRK02145         34 VEIARRYDEQGADELTFLDITAT---------------SDG---RDLILPIIEAVASQV--FIPLTVGGGVRAVEDVRRL   93 (257)
T ss_pred             HHHHHHHHHCCCCEEEEEECCCC---------------CCC---CHHHHHHHHHHHHHC--CCCEEEECCCCCHHHHHHH
T ss_conf             99999999879998999978887---------------667---540899999999656--8748962773046889999


Q ss_pred             HHCCCCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             98399975452787706978999999999
Q gi|254780434|r  306 IMAGANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       306 l~aGAs~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                      +.+||+-|-+.|+. ++.|.+++++.+..
T Consensus        94 l~~GadkVii~s~a-~~np~~v~~~~~~f  121 (257)
T PRK02145         94 LNAGADKVSMNSSA-VANPQLVRDAADKY  121 (257)
T ss_pred             HHCCCCEEEEHHHH-HHCCCHHHHHHHHC
T ss_conf             98199889841556-65930224578766


No 161
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only]
Probab=97.67  E-value=0.0003  Score=48.47  Aligned_cols=92  Identities=18%  Similarity=0.188  Sum_probs=64.6

Q ss_pred             CCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCH
Q ss_conf             77488899999876449829998066555323457754463221135645424689999999740897489996788999
Q gi|254780434|r  220 LSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISST  299 (362)
Q Consensus       220 ~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~  299 (362)
                      .+.+++...+..+.+.  -              ..+....++||-.|.|..+   ++++++.+.    .++|-.|||.|+
T Consensus       147 ~~~~~iaa~y~la~~~--~--------------g~~~~YlEagsga~~Pv~~---e~v~~v~~~----~~LivGGGIrs~  203 (240)
T COG1646         147 LDKEDIAAYYALAEKY--L--------------GMPVVYLEAGSGAGDPVPV---EMVSRVLSD----TPLIVGGGIRSP  203 (240)
T ss_pred             CCCHHHHHHHHHHHHH--H--------------CCEEEEEEECCCCCCCCCH---HHHHHHHCC----CEEEECCCCCCH
T ss_conf             9858899999999997--1--------------9858999806888998688---999986145----508985884989


Q ss_pred             HHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHH
Q ss_conf             999999983999754527877069789999999999
Q gi|254780434|r  300 KDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLS  335 (362)
Q Consensus       300 ~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~  335 (362)
                      ++|.++..||||.+-++|. +++.|..+.++.+..+
T Consensus       204 E~A~~~a~agAD~IVtG~i-iee~~~~~~~~v~~~k  238 (240)
T COG1646         204 EQAREMAEAGADTIVTGTI-IEEDPDKALETVEAIK  238 (240)
T ss_pred             HHHHHHHHCCCCEEEECCE-EECCHHHHHHHHHHHH
T ss_conf             9999999717998997700-2008788999999860


No 162
>pfam00218 IGPS Indole-3-glycerol phosphate synthase.
Probab=97.65  E-value=0.00083  Score=45.44  Aligned_cols=196  Identities=19%  Similarity=0.244  Sum_probs=108.6

Q ss_pred             EECCEECCCCE-E-ECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHH
Q ss_conf             88873359974-8-534688867798887403675241020013687899886268842555410000247777788999
Q gi|254780434|r   48 KVAGISLSNPL-G-MAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFS  125 (362)
Q Consensus        48 ~~~Gl~~~nPi-g-lAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~  125 (362)
                      =++-++-++|- | +...+| -.+..+.+.+.|+.++.+=|   +       |++|.                |.-..+.
T Consensus        50 iIAEiKraSPS~G~i~~~~d-p~~iA~~Y~~~GA~aiSVLT---d-------~~~F~----------------Gs~~~L~  102 (254)
T pfam00218        50 LIAEVKKASPSKGLIREDFD-PAEIARAYEAAGASAISVLT---E-------PKYFQ----------------GSLEYLR  102 (254)
T ss_pred             EEEEEECCCCCCCCCCCCCC-HHHHHHHHHHCCCCEEEEEC---C-------CCCCC----------------CCHHHHH
T ss_conf             89877268999998689899-99999999977983799842---6-------78679----------------8799999


Q ss_pred             HHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             87641000121000110454246788776555420675526983033365322110000234321111224445565531
Q gi|254780434|r  126 RLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIK  205 (362)
Q Consensus       126 ~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~  205 (362)
                      ..++. .+.|+--        .|.+.|-.+..+...-+||++=|-.++         -+++.+..++......       
T Consensus       103 ~vr~~-v~lPiLr--------KDFIid~yQI~ear~~GADaiLLI~~~---------L~~~~l~~l~~~a~~l-------  157 (254)
T pfam00218       103 EVREA-VSLPVLR--------KDFIIDEYQIYEARAYGADTVLLIVAV---------LSDELLEELYEYARSL-------  157 (254)
T ss_pred             HHHHH-CCCCEEC--------CHHEEEHHHHHHHHHCCCCEEEHHHHC---------CCHHHHHHHHHHHHHH-------
T ss_conf             99986-4885111--------410465999999998088863144711---------9999999999999984-------


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             26885178650577774888999998764498299980665553234577544632211356454246899999997408
Q gi|254780434|r  206 TGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVG  285 (362)
Q Consensus       206 ~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~  285 (362)
                         ..-++|-+.   +.++    ++.+.+.+++ ++.+|.   |. +.+               +...+..-.+++..++
T Consensus       158 ---gl~~LvEvh---~~~E----l~~al~~~a~-iIGINN---Rn-L~t---------------f~vd~~~t~~L~~~ip  207 (254)
T pfam00218       158 ---GMEPLVEVH---NEEE----LERALALGAK-LIGVNN---RN-LKT---------------FEVDLNTTRRLAPMVP  207 (254)
T ss_pred             ---CCEEEEEEC---CHHH----HHHHHHCCCC-EEEECC---CC-HHH---------------HHCCHHHHHHHHHHCC
T ss_conf             ---886798868---9999----9999848997-896327---88-465---------------1005799999995589


Q ss_pred             CCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCC-CHH
Q ss_conf             9748999678899999999998399975452787706-978
Q gi|254780434|r  286 PKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYE-GIS  325 (362)
Q Consensus       286 ~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~-Gp~  325 (362)
                      ++..+|+-.||.+.+|+..+..+|+++|-||+++|-. .|+
T Consensus       208 ~~~~~VsESGI~~~~di~~l~~~G~~~~LIGe~lm~~~dp~  248 (254)
T pfam00218       208 EDVLLVAESGISTPEDVEKLAKHGANAFLVGESLMRAPDVR  248 (254)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHCCCCEEEECHHHHCCCCHH
T ss_conf             89879983899999999999987999999896875799989


No 163
>KOG2334 consensus
Probab=97.65  E-value=0.00026  Score=48.90  Aligned_cols=160  Identities=19%  Similarity=0.168  Sum_probs=104.4

Q ss_pred             CCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCC------CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             21000110454246788776555420675526983033365------322110000234321111224445565531268
Q gi|254780434|r  135 PIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPN------TPGLRSLQKKKNLERLLIHVMQTREEEKIKTGK  208 (362)
Q Consensus       135 pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPN------t~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~  208 (362)
                      .++.-+|.+ +.+-+    .+.++.+...+.-+.+|..||-      .+|...+.+++.+-.+|..++..         .
T Consensus        83 rlilQ~gT~-sa~lA----~e~A~lv~nDvsgidiN~gCpK~fSi~~gmgaalLt~~dkl~~IL~sLvk~---------~  148 (477)
T KOG2334          83 RLILQIGTA-SAELA----LEAAKLVDNDVSGIDINMGCPKEFSIHGGMGAALLTDPDKLVAILYSLVKG---------N  148 (477)
T ss_pred             EEEEEECCC-CHHHH----HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHCCHHHHHHHHHHHHHC---------C
T ss_conf             079983488-68899----999997622444530037999754213477850106888899999999845---------7


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             85178650577774888999998764498299980665553234577544632211356454246899999997408974
Q gi|254780434|r  209 FVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKI  288 (362)
Q Consensus       209 ~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i  288 (362)
                      ++|+-.|+----+.++-.++++.....|+.+|++.-.+.+                 +++-+|.....++.+.+.++. +
T Consensus       149 ~vpvtckIR~L~s~edtL~lv~ri~~tgi~ai~vh~rt~d-----------------~r~~~~~~~~~i~~i~~~~~~-V  210 (477)
T KOG2334         149 KVPVTCKIRLLDSKEDTLKLVKRICATGIAAITVHCRTRD-----------------ERNQEPATKDYIREIAQACQM-V  210 (477)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHCCCCEEEEEEECCC-----------------CCCCCCCCHHHHHHHHHHHCC-C
T ss_conf             6651468984478420799999999628756999864266-----------------677788977999999987166-3


Q ss_pred             EEEEECCCCC---HHHHHHHHH-CCCCEEEECHHHHCCCHHHH
Q ss_conf             8999678899---999999998-39997545278770697899
Q gi|254780434|r  289 AIIGTGGISS---TKDALDKIM-AGANLIQLYSAMIYEGISLP  327 (362)
Q Consensus       289 ~IIg~GGI~s---~~Da~e~l~-aGAs~VQi~Tali~~Gp~~~  327 (362)
                      |||.-||+++   +.|...+.. .|++.|++..+. ..+|.+|
T Consensus       211 ~vi~ng~~~~~e~y~Di~~~~~~~~~~~vmiAR~A-~~n~SiF  252 (477)
T KOG2334         211 PVIVNGGSMDIEQYSDIEDFQEKTGADSVMIARAA-ESNPSIF  252 (477)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHHCCCHHHHHHHH-HCCCCEE
T ss_conf             37615541257763128888998534045534865-2598665


No 164
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; InterPro: IPR005990    Synonyms: Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase     IMP dehydrogenase (1.1.1.205 from EC,IMPDH) catalyzes the rate-limiting reaction of de novo GTP biosynthesis, the NAD-dependent reduction of IMP into XMP .  Inosine 5-phosphate + NAD+ + H2O = xanthosine 5-phosphate + NADH     IMP dehydrogenase is associated with cell proliferation and is a possible target for cancer chemotherapy. Mammalian and bacterial IMPDHs are tetramers of identical chains. There are two IMP dehydrogenase isozymes in humans . IMP dehydrogenase nearly always contains a long insertion that has two CBS domains within it and adopts a TIM barrel structure.; GO: 0003938 IMP dehydrogenase activity, 0006177 GMP biosynthetic process.
Probab=97.63  E-value=0.0014  Score=43.96  Aligned_cols=81  Identities=20%  Similarity=0.315  Sum_probs=54.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             51786505777748889999987644982999806655532345775446322113564542468999999974089748
Q gi|254780434|r  210 VPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIA  289 (362)
Q Consensus       210 ~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~  289 (362)
                      +=+-+=++|=-  .+ .+-+..+.++|+|-|++          ++....+           ...+..|+++|+.+ +++.
T Consensus       228 L~VgAAvg~r~--~D-~~R~~~L~~AGvDv~vi----------DsshGhs-----------~~vl~~ik~~k~~Y-p~~~  282 (476)
T TIGR01302       228 LIVGAAVGTRE--DD-LERAEALVEAGVDVIVI----------DSSHGHS-----------IYVLDSIKKIKKTY-PDLD  282 (476)
T ss_pred             EEEEEEECCCC--CC-HHHHHHHHHCCCCEEEE----------ECCCCCC-----------HHHHHHHHHHHHHC-CEEE
T ss_conf             89998846898--61-89999999659658998----------1665453-----------78999999998638-8057


Q ss_pred             EEEECCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             999678899999999998399975452
Q gi|254780434|r  290 IIGTGGISSTKDALDKIMAGANLIQLY  316 (362)
Q Consensus       290 IIg~GGI~s~~Da~e~l~aGAs~VQi~  316 (362)
                      || .|=|-|.+.|...+.||||.|-|+
T Consensus       283 ii-aGNVaT~~~a~~LI~AgADg~rVG  308 (476)
T TIGR01302       283 II-AGNVATAEQAKALIDAGADGLRVG  308 (476)
T ss_pred             EE-ECCCCCHHHHHHHHHCCCCEEEEC
T ss_conf             99-434411788988985288878983


No 165
>PRK05211 consensus
Probab=97.62  E-value=0.00096  Score=45.04  Aligned_cols=55  Identities=24%  Similarity=0.349  Sum_probs=24.5

Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHH
Q ss_conf             9999999740897489996788999999999983999754527877069789999999
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQ  332 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~  332 (362)
                      ..|+++++.+  .+||--.|||.|-+|+.+++.+|||-|-+.|+. ++.|.+++++.+
T Consensus        55 ~~I~~i~~~~--~~Pl~vGGGIrs~~~i~~ll~~GadkViigs~a-~~np~li~~~~~  109 (248)
T PRK05211         55 SWVSRVAEVI--DIPFCVAGGIKSVEDAREILSFGADKISINSPA-LADPTLITRLAD  109 (248)
T ss_pred             HHHHHHHHHC--CCCEEEECCCCCHHHHHHHHHCCCCEEEECCHH-HHCCHHHHHHHH
T ss_conf             9999999767--985896278013899999998799889989767-619618999998


No 166
>PRK02621 consensus
Probab=97.60  E-value=0.00074  Score=45.79  Aligned_cols=30  Identities=30%  Similarity=0.412  Sum_probs=14.8

Q ss_pred             CEEECCCCCCCHHHHHHHHHCCCCEEECCCC
Q ss_conf             7485346888677988874036752410200
Q gi|254780434|r   57 PLGMAAGYDKNAEVPIELLKLGFGFVEIGTV   87 (362)
Q Consensus        57 PiglAaG~dk~~~~~~~l~~~G~G~v~~kti   87 (362)
                      |+-++.|. ++.+.++.++++|+.-|+++|.
T Consensus        76 pi~vGGGI-rs~e~~~~ll~~GadkVii~s~  105 (254)
T PRK02621         76 PLTVGGGI-SSLEGIKELLRAGADKVSLNSA  105 (254)
T ss_pred             CEEEECCE-EEHHHHHHHHHCCCCEEEECCH
T ss_conf             58996335-3579999999749998999886


No 167
>PRK01659 consensus
Probab=97.59  E-value=0.00087  Score=45.33  Aligned_cols=89  Identities=22%  Similarity=0.195  Sum_probs=59.3

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHH
Q ss_conf             89999987644982999806655532345775446322113564542468999999974089748999678899999999
Q gi|254780434|r  225 LDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALD  304 (362)
Q Consensus       225 i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e  304 (362)
                      -.++|+.-.+.|+|-+++.+-..+               ..|   ++.-...|+++.+.+  .+||.-.|||.|-+|+.+
T Consensus        32 P~~~ak~~~~~Gad~ihivDld~a---------------~~g---~~~n~~~I~~i~~~~--~ipi~vGGGIrs~e~~~~   91 (252)
T PRK01659         32 PVEIAAAYNEAGADELVFLDITAT---------------HEG---RKTMVDVVEKVAAKV--FIPLTVGGGISSVKDMKR   91 (252)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCC---------------CCC---CHHHHHHHHHHHHHC--CCCEEEECCEECHHHHHH
T ss_conf             999999999879999999946766---------------568---864899999999756--974799633200688889


Q ss_pred             HHHCCCCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             998399975452787706978999999999
Q gi|254780434|r  305 KIMAGANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       305 ~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                      ++.+|||-|-+.|+. ++.|.+++++.+..
T Consensus        92 ~l~~GadkViigs~a-~~n~~~i~~~~~~~  120 (252)
T PRK01659         92 LLRAGADKVSINSAA-VLRPELITEGADHF  120 (252)
T ss_pred             HHHCCCCEEEECHHH-HHCHHHHHHHHHHC
T ss_conf             874488559831777-52915321467646


No 168
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=97.59  E-value=0.0036  Score=41.20  Aligned_cols=45  Identities=27%  Similarity=0.343  Sum_probs=37.3

Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             99999997408974899967889999999999839997545278770
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      ..++.++.-+ ++++++.+|||. .+.+.+|+.+|+.+|.++|.++-
T Consensus       142 ~ylkal~~p~-p~i~~~ptGGV~-~~n~~~yl~ag~~~vg~Gs~l~~  186 (210)
T PRK07455        142 DYIKSLQGPL-GHIPLIPTGGVT-LENAQAFIQAGAIAVGLSSQLFP  186 (210)
T ss_pred             HHHHHHHCCC-CCCCEEECCCCC-HHHHHHHHHCCCEEEEECHHHCC
T ss_conf             9999986548-999388789989-88899999689979998846189


No 169
>pfam03437 BtpA BtpA family. The BtpA protein is tightly associated with the thylakoid membranes, where it stabilizes the reaction centre proteins of photosystem I.
Probab=97.57  E-value=0.0037  Score=41.05  Aligned_cols=197  Identities=14%  Similarity=0.189  Sum_probs=107.8

Q ss_pred             HHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCHH
Q ss_conf             79888740367524102001368789988626884255541000024777778899987641000121000110454246
Q gi|254780434|r   69 EVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKD  148 (362)
Q Consensus        69 ~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~~  148 (362)
                      +..+.+.+.|+-++.+--.--.|-.-+       .  +...+-+|       ..+..++++.- +.|+|||+-.|.. ..
T Consensus        33 ~ea~~l~~~GvDgvivEN~~D~Py~~~-------~--~~etvaam-------t~i~~~v~~~~-~iP~GvnvL~nd~-~a   94 (254)
T pfam03437        33 SDAMALEEGGFDAVILENYGDAPYLKT-------V--GPETVAAM-------TVIAGEVKSDV-SIPLGINVLRNDA-VA   94 (254)
T ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCC-------C--CHHHHHHH-------HHHHHHHHHHC-CCCEEEEEECCCC-HH
T ss_conf             999999977998899806899777467-------7--66989999-------99999998744-8873677761785-89


Q ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE----EECCCCCCHHH
Q ss_conf             78877655542067552698303336532211000023432111122444556553126885178----65057777488
Q gi|254780434|r  149 FILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIF----LKISPDLSEEE  224 (362)
Q Consensus       149 ~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~----vKLsPd~~~~~  224 (362)
                      ++    ..  .....+||+-+|.=|=-     ...+...++.....+...|..  ..  ..+.||    +|-++.+.+..
T Consensus        95 al----ai--A~a~ga~FIRv~~~~g~-----~~~d~G~~~~~a~~~~r~R~~--l~--a~v~i~aDV~~Kh~~~l~~~~  159 (254)
T pfam03437        95 AL----AI--AYAVGADFIRVNVLTGV-----AASDQGILEGNAGELARYRKL--LP--SRIKILADVHVKHAVHLGNRD  159 (254)
T ss_pred             HH----HH--HHHHCCCEEEECCEECE-----EECCCCCCCCCHHHHHHHHHH--CC--CCCEEEEEECCCCCCCCCCCC
T ss_conf             99----99--99829976987137653-----335775315538999999997--19--995899755001254579999


Q ss_pred             HHHHHHHHHHC-CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHH
Q ss_conf             89999987644-98299980665553234577544632211356454246899999997408974899967889999999
Q gi|254780434|r  225 LDDIAVEVLSH-KVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDAL  303 (362)
Q Consensus       225 i~~ia~~a~~~-g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~  303 (362)
                      +.+.++.+.+. ++||++++.+..                  |   .+..+..+..+++..  ++|++-..||. .+-+.
T Consensus       160 ~~~~~~~~~~~~~aDaiivTG~~T------------------G---~~~~~~~l~~vk~~~--~~PvlvGSGvt-~~Ni~  215 (254)
T pfam03437       160 IESAVLDTIERGLADAVILSGKTT------------------G---GEVDLEELKLAKETV--PVPVLVGSGVN-LENLE  215 (254)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCC------------------C---CCCCHHHHHHHHHHC--CCCEEEECCCC-HHHHH
T ss_conf             899999999826898999787302------------------7---999999999999626--99889957989-88999


Q ss_pred             HHHHCCCCEEEECHHHHCCC
Q ss_conf             99983999754527877069
Q gi|254780434|r  304 DKIMAGANLIQLYSAMIYEG  323 (362)
Q Consensus       304 e~l~aGAs~VQi~Tali~~G  323 (362)
                      +++.. ||.+-|+|.|-..|
T Consensus       216 ~~l~~-ADG~IVGS~~K~~G  234 (254)
T pfam03437       216 ELWSI-ADGFIVGTSIKKGG  234 (254)
T ss_pred             HHHHH-CCEEEEEHHEEECC
T ss_conf             99987-89999842230588


No 170
>PRK13597 imidazole glycerol phosphate synthase subunit HisF; Provisional
Probab=97.55  E-value=0.0016  Score=43.60  Aligned_cols=56  Identities=25%  Similarity=0.366  Sum_probs=24.2

Q ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHH
Q ss_conf             89999999740897489996788999999999983999754527877069789999999
Q gi|254780434|r  274 TIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQ  332 (362)
Q Consensus       274 l~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~  332 (362)
                      +..|+.+.+.+  .+||--.|||.|-+|+.+++.+|||-|-++|+. ++.|.+++++.+
T Consensus        64 ~~~I~~i~~~~--~vpiqvGGGIrs~e~~~~ll~~GadkViigS~a-~~np~~i~~~~~  119 (252)
T PRK13597         64 LDVVARVAERV--FIPLTVGGGVRSLEDARKLLLSGADKVSVNSAA-VRRPELIRELAD  119 (252)
T ss_pred             HHHHHHHHHHC--CCCEEEECCCCCHHHHHHHHHCCCCEEEECHHH-HHCCHHHHHHHH
T ss_conf             99999998626--982898477130899999985698779832666-749378999998


No 171
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=97.54  E-value=0.0018  Score=43.13  Aligned_cols=45  Identities=24%  Similarity=0.422  Sum_probs=37.3

Q ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHH
Q ss_conf             89999999740897489996788999999999983999754527877
Q gi|254780434|r  274 TIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMI  320 (362)
Q Consensus       274 l~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali  320 (362)
                      ...++.++.-+ ++++++.+|||. .+.+-+|+.+||.+|.+++.++
T Consensus       143 ~~yikal~~p~-p~~~~~ptGGV~-~~N~~~~l~aG~~~vgvGs~l~  187 (209)
T PRK06552        143 PSFISAIKGPL-PQVNIMVTGGVS-LDNVKDWFAAGADAVGIGGELN  187 (209)
T ss_pred             HHHHHHHHCCC-CCCCEEECCCCC-HHHHHHHHHCCCCEEEECHHHC
T ss_conf             99999986648-999288638999-8889999987998899865770


No 172
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism]
Probab=97.53  E-value=0.0047  Score=40.39  Aligned_cols=163  Identities=17%  Similarity=0.160  Sum_probs=83.9

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCCEEECCC-CCHHHHHHHHHHHHHH-CCCCCEEEEECCCCCCCCCCCCCCHH-HHHH
Q ss_conf             2477777889998764100012100011045-4246788776555420-67552698303336532211000023-4321
Q gi|254780434|r  114 GFNNAGYHTVFSRLSKIQPTSPIGINLGANK-DSKDFILDYVSGIRLF-FTIASYFTINISSPNTPGLRSLQKKK-NLER  190 (362)
Q Consensus       114 Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~-~s~~~~~dy~~~~~~~-~~~aD~iEiNiSCPNt~g~~~~~~~~-~l~~  190 (362)
                      |+.-.|++.+.. ++ ...+.|+|=-|-.+. +++-.+.-+.+-++++ ..++|.+-+.-.+-.        .++ .+++
T Consensus        49 giR~~gv~dIka-i~-~~v~vPIIGIiKrd~~~s~v~ITptlkeVd~L~~~Ga~IIA~DaT~R~--------RP~~~~~~  118 (229)
T COG3010          49 GIRIEGVEDIKA-IR-AVVDVPIIGIIKRDYPDSPVRITPTLKEVDALAEAGADIIAFDATDRP--------RPDGDLEE  118 (229)
T ss_pred             EEEECCHHHHHH-HH-HHCCCCEEEEEECCCCCCCCEECCCHHHHHHHHHCCCCEEEEECCCCC--------CCCCHHHH
T ss_conf             686120656999-98-617887688880589999935566189999999779909996255687--------98435999


Q ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC--CC
Q ss_conf             1112244455655312688517865057777488899999876449829998066555323457754463221135--64
Q gi|254780434|r  191 LLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSG--SP  268 (362)
Q Consensus       191 ~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG--~~  268 (362)
                      ++...          .....=+.+-.|   +   +++ +..|.+.|+|-|-   ||.+              |+-+  ..
T Consensus       119 ~i~~~----------k~~~~l~MAD~S---t---~ee-~l~a~~~G~D~IG---TTLs--------------GYT~~~~~  164 (229)
T COG3010         119 LIARI----------KYPGQLAMADCS---T---FEE-GLNAHKLGFDIIG---TTLS--------------GYTGYTEK  164 (229)
T ss_pred             HHHHH----------HCCCCEEEECCC---C---HHH-HHHHHHCCCCEEE---CCCC--------------CCCCCCCC
T ss_conf             99973----------357947873259---8---888-8889973996782---2420--------------14689987


Q ss_pred             CCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHH
Q ss_conf             542468999999974089748999678899999999998399975452787706978
Q gi|254780434|r  269 LFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGIS  325 (362)
Q Consensus       269 i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~  325 (362)
                      ....-..+++++.+   .+.++|+=|.+.|+++|.+-+..||++|-|+||. -+ |+
T Consensus       165 ~~~pDf~lvk~l~~---~~~~vIAEGr~~tP~~Ak~a~~~Ga~aVvVGsAI-TR-p~  216 (229)
T COG3010         165 PTEPDFQLVKQLSD---AGCRVIAEGRYNTPEQAKKAIEIGADAVVVGSAI-TR-PE  216 (229)
T ss_pred             CCCCCHHHHHHHHH---CCCEEEEECCCCCHHHHHHHHHHCCEEEEECCCC-CC-HH
T ss_conf             78972899999986---7993995178799999999997188089987433-78-79


No 173
>PRK04281 consensus
Probab=97.53  E-value=0.0014  Score=44.00  Aligned_cols=87  Identities=15%  Similarity=0.124  Sum_probs=49.4

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHH
Q ss_conf             99999876449829998066555323457754463221135645424689999999740897489996788999999999
Q gi|254780434|r  226 DDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDK  305 (362)
Q Consensus       226 ~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~  305 (362)
                      .++|+.-.+.|+|-+++.+-...               ..|.   +.-+..|+++.+.+  .+||--.|||.|-+|+.++
T Consensus        33 ~~~ak~~~~~GadelhivDld~a---------------~~~~---~~~~~~I~~i~~~~--~vpi~vGGGIrs~e~~~~l   92 (254)
T PRK04281         33 VEAAKRYNGEGADELTFLDITAS---------------SDNR---DTILHIIEEVAGQV--FIPLTVGGGVRTVADIRRL   92 (254)
T ss_pred             HHHHHHHHHCCCCEEEEEECCCC---------------CCCC---HHHHHHHHHHHHHC--CCCEEEECCEEECHHHHHH
T ss_conf             99999999869999999968898---------------7775---30899999998507--9628997775451889999


Q ss_pred             HHCCCCEEEECHHHHCCCHHHHHHHHHH
Q ss_conf             9839997545278770697899999999
Q gi|254780434|r  306 IMAGANLIQLYSAMIYEGISLPKRIIQG  333 (362)
Q Consensus       306 l~aGAs~VQi~Tali~~Gp~~~~~I~~~  333 (362)
                      +.+|||-|-++|+.+ +.|.+++++.+.
T Consensus        93 l~~GadkViigs~a~-~np~~l~~~~~~  119 (254)
T PRK04281         93 LNAGADKVSINTAAV-TRPDLIDEAAGF  119 (254)
T ss_pred             HHCCCCEEEECHHHH-HCCHHHHHHHHH
T ss_conf             976998899777676-492676767875


No 174
>pfam01081 Aldolase KDPG and KHG aldolase. This family includes the following members: 4-hydroxy-2-oxoglutarate aldolase (KHG-aldolase) Phospho-2-dehydro-3-deoxygluconate aldolase (KDPG-aldolase)
Probab=97.50  E-value=0.0021  Score=42.78  Aligned_cols=59  Identities=17%  Similarity=0.167  Sum_probs=43.9

Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCCCHHH
Q ss_conf             99999997408974899967889999999999839997545278770697899999999999999838997789
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFEN  348 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~si~e  348 (362)
                      ..++.++.-+ ++++++.+|||.- +++.+|+.+||.+|.++|.++-+             ++++++.|+.|++
T Consensus       137 ~~lkal~~p~-p~~~f~ptGGv~~-~N~~~yl~~g~v~~~~GS~l~~~-------------~li~~~d~~~It~  195 (196)
T pfam01081       137 PAIKALAGPF-PQVRFCPTGGIHP-ANVRDYLALPNILCVGGSWLVPA-------------SLIQKGDWDRITA  195 (196)
T ss_pred             HHHHHHHCCC-CCCEEEEECCCCH-HHHHHHHHCCCEEEEECHHHCCH-------------HHHHCCCHHHHHC
T ss_conf             9999985779-9986998079898-88999996898699989364898-------------8987199877643


No 175
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional
Probab=97.47  E-value=0.0017  Score=43.37  Aligned_cols=30  Identities=33%  Similarity=0.478  Sum_probs=14.5

Q ss_pred             CEEECCCCCCCHHHHHHHHHCCCCEEECCCC
Q ss_conf             7485346888677988874036752410200
Q gi|254780434|r   57 PLGMAAGYDKNAEVPIELLKLGFGFVEIGTV   87 (362)
Q Consensus        57 PiglAaG~dk~~~~~~~l~~~G~G~v~~kti   87 (362)
                      |+-++.|. ++-+.++.++++|+--|+++|.
T Consensus        76 pi~vGGGI-rs~e~~~~ll~~GadkViigs~  105 (253)
T PRK01033         76 PLCYGGGI-KTVEQAKRIFSLGVEKVSISTA  105 (253)
T ss_pred             CEEEECCC-CCHHHHHHHHHCCCCEEEECCH
T ss_conf             88986881-2168889998679866999987


No 176
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ. This clade of sequences is highly similar to the HisF protein, but generally represents the second HisF homolog in the genome where the other is an authentic HisF observed in the context of a complete histidine biosynthesis operon. The similarity between these WbuZ sequences and true HisFs is such that often the closest match by BLAST of a WbuZ is a HisF. Only by making a multiple sequence alignment is the homology relationship among the WbuZ sequences made apparent. WbuZ genes are invariably observed in the presence of a homolog of the HisH protein (designated WbuY) and a proposed N-acetyl sugar amidotransferase designated in WbuX in E. coli, IfnA in P. aeriginosa and PseA in C. jejuni. Similarly, this trio of genes is invariably found in the context of saccharide biosynthesis loci. It has been shown that the WbuYZ homologs are not essential components of the activity expressed by WbuX, leading to the proposal that these to pr
Probab=97.47  E-value=0.0019  Score=42.98  Aligned_cols=89  Identities=18%  Similarity=0.168  Sum_probs=68.0

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHH
Q ss_conf             89999987644982999806655532345775446322113564542468999999974089748999678899999999
Q gi|254780434|r  225 LDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALD  304 (362)
Q Consensus       225 i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e  304 (362)
                      -.++++...+.|+|-+.+.+-..+               ..|   .+.-...|+++.+.+  .+||--.|||.|-+|+.+
T Consensus        32 P~~~ak~~~~~g~d~lhivDld~a---------------~~~---~~~n~~~I~~i~~~~--~ipi~vGGGIrs~e~~~~   91 (232)
T TIGR03572        32 PVNAARIYNAKGADELIVLDIDAS---------------KRG---REPLFELISNLAEEC--FMPLTVGGGIRSLEDAKK   91 (232)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCC---------------CCC---CCCHHHHHHHHHHHC--CCCEEEEECEEEHHHHHH
T ss_conf             999999999869999999968764---------------348---821799999999972--985899713303899999


Q ss_pred             HHHCCCCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             998399975452787706978999999999
Q gi|254780434|r  305 KIMAGANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       305 ~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                      ++.+||+-|-++|+. ++.|.+++++.+..
T Consensus        92 ll~~GadkViigs~a-~~~p~~~~~~~~~~  120 (232)
T TIGR03572        92 LLSLGADKVSINTAA-LENPDLIEEAARRF  120 (232)
T ss_pred             HHHCCCCEEEECHHH-HHCCHHHHHHHHHC
T ss_conf             997699689934545-21935778999986


No 177
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional
Probab=97.46  E-value=0.0015  Score=43.77  Aligned_cols=34  Identities=26%  Similarity=0.345  Sum_probs=23.4

Q ss_pred             CCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCC
Q ss_conf             99748534688867798887403675241020013
Q gi|254780434|r   55 SNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTP   89 (362)
Q Consensus        55 ~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~   89 (362)
                      .=|+-++.|. ++-+.++.++++|+.-|+++|...
T Consensus        74 ~~pi~vGGGI-rs~e~~~~ll~~GadkVvigs~a~  107 (253)
T PRK02083         74 FIPLTVGGGI-RSVEDARRLLRAGADKVSINSAAV  107 (253)
T ss_pred             CCCEEEECCC-CCHHHHHHHHHCCCCEEEECCHHH
T ss_conf             9877851762-138987689877987899998465


No 178
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional
Probab=97.45  E-value=0.0032  Score=41.53  Aligned_cols=87  Identities=18%  Similarity=0.168  Sum_probs=55.4

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHH
Q ss_conf             99999876449829998066555323457754463221135645424689999999740897489996788999999999
Q gi|254780434|r  226 DDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDK  305 (362)
Q Consensus       226 ~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~  305 (362)
                      .++|+...+.|++-+.+..-..       .         .|.   +....+|+++.+.+  .+||--.|||.|-+|+.++
T Consensus        32 ~~~a~~~~~~Ga~~lhvvDLda-------a---------~g~---~~N~~~I~~i~~~~--~~piqvGGGIrs~e~~~~~   90 (231)
T PRK13586         32 LKIAEELYNEGYDSIHVVDLDA-------A---------EGK---GDNEEYIKRICKIG--FSWIQVGGGIRDVEKAERL   90 (231)
T ss_pred             HHHHHHHHHCCCCEEEEEECCC-------C---------CCC---CCHHHHHHHHHHHC--CCCEEEECCCCCHHHHHHH
T ss_conf             9999999987999899996715-------6---------899---84399999999745--9857985671769999999


Q ss_pred             HHCCCCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             98399975452787706978999999999
Q gi|254780434|r  306 IMAGANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       306 l~aGAs~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                      +.+||+-|-++|+. ++.|.++.++.+..
T Consensus        91 l~~Ga~kViigS~a-~~np~~~~~~~~~~  118 (231)
T PRK13586         91 LSYDCSAIVMSTLP-FTNPDTFRRIVAGI  118 (231)
T ss_pred             HHCCCCEEEECHHH-HHCHHHHHHHHHHH
T ss_conf             97799889976888-76959999999984


No 179
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional
Probab=97.41  E-value=0.0048  Score=40.32  Aligned_cols=81  Identities=23%  Similarity=0.277  Sum_probs=53.6

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHH
Q ss_conf             89999987644982999806655532345775446322113564542468999999974089748999678899999999
Q gi|254780434|r  225 LDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALD  304 (362)
Q Consensus       225 i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e  304 (362)
                      ..+.++...+ ++..+++++  +++++           -++|-       ..   +.+.. .+.|+|++|||.+.+|..+
T Consensus       145 ~~~~~~~~~~-~~~~ii~td--I~~dG-----------t~~G~-------~~---~~~~~-~~~~iiasGGv~s~~Dl~~  199 (228)
T PRK04128        145 VEDAYKMLRN-YVNRFIYTS--IERDG-----------TLTGI-------EN---IERFW-GDEEFIYAGGVSSIEDVKK  199 (228)
T ss_pred             HHHHHHHHHH-HCCCEEEEE--ECCCC-----------CCCCH-------HH---HHHHC-CCCCEEEECCCCCHHHHHH
T ss_conf             9999999986-384537631--26543-----------00388-------99---99861-6896898789899999999


Q ss_pred             HHHCCCCEEEECHHHHCCCHHHHHHHH
Q ss_conf             998399975452787706978999999
Q gi|254780434|r  305 KIMAGANLIQLYSAMIYEGISLPKRII  331 (362)
Q Consensus       305 ~l~aGAs~VQi~Tali~~Gp~~~~~I~  331 (362)
                      ...+|++.|-+++|+ |+|---+++++
T Consensus       200 l~~~g~~gvivG~Al-~~g~i~l~e~~  225 (228)
T PRK04128        200 LAEIGFSGAIIGKAL-YEGRISLEELL  225 (228)
T ss_pred             HHHCCCCEEEEEHHH-HCCCCCHHHHH
T ss_conf             996799899998538-56997899994


No 180
>PRK00830 consensus
Probab=97.40  E-value=0.0014  Score=43.88  Aligned_cols=88  Identities=16%  Similarity=0.210  Sum_probs=55.5

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHH
Q ss_conf             99999876449829998066555323457754463221135645424689999999740897489996788999999999
Q gi|254780434|r  226 DDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDK  305 (362)
Q Consensus       226 ~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~  305 (362)
                      .+.|+.-.+.|+|-+++.+-..               ...|.   +.-...|+++++.+  .+||--.|||.|-+|+.++
T Consensus        37 ~~~ak~~~~~gadelhivDld~---------------a~~g~---~~~~~~I~~i~~~~--~~pi~vGGGIrs~e~~~~l   96 (273)
T PRK00830         37 VELAKRYYEDGADELVFLDITA---------------SHEGR---ATMIDVIERTAEEV--FIPLTVGGGIRSIEDIRQI   96 (273)
T ss_pred             HHHHHHHHHCCCCEEEEEEEEC---------------CCCCC---CCHHHHHHHHHHHC--CCCEEEECCEEECCCHHHH
T ss_conf             9999999987999899995324---------------64688---42799999999866--9958960884377328999


Q ss_pred             HHCCCCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             98399975452787706978999999999
Q gi|254780434|r  306 IMAGANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       306 l~aGAs~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                      +.+|||-|-++|+++. .|.+++++.+..
T Consensus        97 l~~GadkVvIgS~a~~-np~~v~~~~~~f  124 (273)
T PRK00830         97 LRAGADKVSVNTAAVK-NPEFIREASDIF  124 (273)
T ss_pred             HHCCCCEEECHHHHHH-CCHHHHHHHHHC
T ss_conf             9769863983798985-907789999876


No 181
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated
Probab=97.39  E-value=0.0027  Score=42.02  Aligned_cols=87  Identities=17%  Similarity=0.129  Sum_probs=45.4

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHH
Q ss_conf             99999876449829998066555323457754463221135645424689999999740897489996788999999999
Q gi|254780434|r  226 DDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDK  305 (362)
Q Consensus       226 ~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~  305 (362)
                      .++|+.-.+.|++-+.+..-.               |-..|.   +.....|+.+.+.+  .+||--.|||.|-+|+.++
T Consensus        32 ~~~A~~~~~~Ga~~lhvvDLd---------------~A~~g~---~~n~~~I~~i~~~~--~~pi~vGGGIrs~e~~~~~   91 (241)
T PRK00748         32 LAQAQAWQDQGAEWLHLVDLD---------------GAFAGR---PVNLELIEAIVAAV--DIPVQLGGGIRDLETVEAY   91 (241)
T ss_pred             HHHHHHHHHCCCCEEEEEECC---------------CCCCCC---CCHHHHHHHHHHHC--CCCEEEECCCCCHHHHHHH
T ss_conf             999999998799989999785---------------420288---20799999999867--9999982770749999999


Q ss_pred             HHCCCCEEEECHHHHCCCHHHHHHHHHH
Q ss_conf             9839997545278770697899999999
Q gi|254780434|r  306 IMAGANLIQLYSAMIYEGISLPKRIIQG  333 (362)
Q Consensus       306 l~aGAs~VQi~Tali~~Gp~~~~~I~~~  333 (362)
                      +.+||+-|-++|+. ++.|.+++++.+.
T Consensus        92 l~~GadkVvigS~a-~~n~~~i~~~~~~  118 (241)
T PRK00748         92 LDAGVARVIIGTAA-VKNPELVKEACKK  118 (241)
T ss_pred             HHCCCCEEEECCHH-HHCHHHHHHHHHH
T ss_conf             97697758864710-3396899999862


No 182
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein; InterPro: IPR005992    This family of proteins, often annotated as a putative IMP dehydrogenase, are related to IMP dehydrogenase and GMP reductase. Most species with a member of this family belong to the high GC Gram-positive bacteria..
Probab=97.39  E-value=0.0026  Score=42.11  Aligned_cols=213  Identities=16%  Similarity=0.246  Sum_probs=126.9

Q ss_pred             CCCCCCCEEEECCEECCCCEEECCCCCC--CHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCC
Q ss_conf             7889631168887335997485346888--67798887403675241020013687899886268842555410000247
Q gi|254780434|r   39 VHSDPRLNTKVAGISLSNPLGMAAGYDK--NAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFN  116 (362)
Q Consensus        39 ~~~~~~L~~~~~Gl~~~nPiglAaG~dk--~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~  116 (362)
                      ...+.|..=++.-.+|.=|| +|+-.|-  +-++.=.+.++|                           .=+.+|.-||.
T Consensus        28 dpk~v~t~W~iDAy~felP~-~a~p~Davvsp~~ai~lg~lG---------------------------gLGV~N~EGL~   79 (376)
T TIGR01304        28 DPKDVDTAWQIDAYRFELPF-LAHPMDAVVSPEFAIELGELG---------------------------GLGVLNLEGLW   79 (376)
T ss_pred             CCCCCCCCCCCCEEEECCCC-CCCCCCCCCCHHHHHHHHHCC---------------------------CCEEEECCHHH
T ss_conf             70002100102312324650-116654424769999987225---------------------------43154110231


Q ss_pred             CCC--HHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             777--788999876410001210001104542467887765554206755269830333653221100002343211112
Q gi|254780434|r  117 NAG--YHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIH  194 (362)
Q Consensus       117 N~G--~~~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~  194 (362)
                      .+.  .+.++.++-...          ..  .. .-..+...+++++  |.=                -++|.+.+   .
T Consensus        80 tRh~D~~~~ld~i~~~~----------~~--~P-~~~~a~R~LQELy--AaP----------------l~~eLl~~---r  125 (376)
T TIGR01304        80 TRHEDPEPLLDKIAEAD----------KE--DP-DQAEATRLLQELY--AAP----------------LKPELLGK---R  125 (376)
T ss_pred             HHHCCHHHHHHHHHHHH----------HC--CC-CHHHHHHHHHHHH--HCC----------------CCHHHHHH---H
T ss_conf             11137789999999875----------15--88-4789988889986--367----------------98647899---9


Q ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             24445565531268851786505777748889999987644982999806655532345775446322113564542468
Q gi|254780434|r  195 VMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKST  274 (362)
Q Consensus       195 v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al  274 (362)
                      +.+.|+      .. .=.-|.|||.    +..+++..+.++|+|=+++=-|+++-.++....         |.     +|
T Consensus       126 i~~vr~------aG-~i~Av~lsPq----~~~~~a~~vv~AG~DLLvIqgT~vSaehv~~e~---------~E-----~L  180 (376)
T TIGR01304       126 IAEVRD------AG-VITAVRLSPQ----NASKLAPVVVEAGADLLVIQGTVVSAEHVSSES---------GE-----PL  180 (376)
T ss_pred             HHHHHH------CC-CEEEEEECCH----HHHHHHHHHHHHCCCEEEEHHHHHHHEEECCCC---------CC-----CH
T ss_conf             999972------68-4899986653----167888999971730042001232010046888---------87-----21


Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEEC--H-HHHC--C--------CHHHHHHHHHHHHHHHHHC
Q ss_conf             999999974089748999678899999999998399975452--7-8770--6--------9789999999999999983
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLY--S-AMIY--E--------GISLPKRIIQGLSDFLNKE  341 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~--T-ali~--~--------Gp~~~~~I~~~L~~~l~~~  341 (362)
                      ++...+ +.+  ++|+| +||+.+.+-++++|++||-.|-|+  + +-..  +        -+..+-+.-..=.+||++-
T Consensus       181 nLk~fi-~eL--DvPVv-~Ggv~~Y~~ALhLMRtGAagvlVGfgG~ga~~T~~~vLG~~VpmATAiAD~AAARrDYLdEt  256 (376)
T TIGR01304       181 NLKKFI-QEL--DVPVV-AGGVVTYTTALHLMRTGAAGVLVGFGGPGAATTTREVLGIEVPMATAIADVAAARRDYLDET  256 (376)
T ss_pred             HHHHHH-HHC--CCCEE-ECCCCCHHHHHHHHHHCCEEEEECCCCCCCCCCCCCCCEECCCCHHHHHHHHHHHHHHHHCC
T ss_conf             488897-548--98878-83853088999986301137886457887342466534210672678999997301133306


Q ss_pred             C
Q ss_conf             8
Q gi|254780434|r  342 N  342 (362)
Q Consensus       342 G  342 (362)
                      |
T Consensus       257 G  257 (376)
T TIGR01304       257 G  257 (376)
T ss_pred             C
T ss_conf             8


No 183
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF). Imidazole glycerol phosphate synthase (IGPS) catalyzes the fifth step of histidine biosynthesis, the formation of the imidazole ring. IGPS converts N1-(5'-phosphoribulosyl)-formimino-5-aminoimidazole-4-carboxamide ribonucleotide (PRFAR) to imidazole glycerol phosphate (ImGP) and 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR). This conversion involves two tightly coupled reactions in distinct active sites of IGPS. The two catalytic domains can be fused, like in fungi and plants, or peformed by a heterodimer (HisH-glutaminase and HisF-cyclase), like in bacteria.
Probab=97.38  E-value=0.0016  Score=43.58  Aligned_cols=34  Identities=26%  Similarity=0.333  Sum_probs=24.8

Q ss_pred             CCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCC
Q ss_conf             99748534688867798887403675241020013
Q gi|254780434|r   55 SNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTP   89 (362)
Q Consensus        55 ~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~   89 (362)
                      .-|+-++.|. ++.+.++.++++|+.-|+++|...
T Consensus        71 ~~pi~vGGGI-rs~~~~~~~l~~GadkVvigs~~~  104 (243)
T cd04731          71 FIPLTVGGGI-RSLEDARRLLRAGADKVSINSAAV  104 (243)
T ss_pred             CCCEEEEEEE-EEHHHHHHHHHCCCCEEEECCCCC
T ss_conf             9868998506-647999999977997899898442


No 184
>pfam01884 PcrB PcrB family. This family contains proteins that are related to PcrB. The function of these proteins is unknown.
Probab=97.36  E-value=0.00044  Score=47.32  Aligned_cols=54  Identities=24%  Similarity=0.142  Sum_probs=44.1

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHH
Q ss_conf             246899999997408974899967889999999999839997545278770697899
Q gi|254780434|r  271 LKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLP  327 (362)
Q Consensus       271 ~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~  327 (362)
                      +....+++..++..  ++++|-.|||.|.++|.++..||||.|-++|. +++.|..-
T Consensus       168 ~vp~~vi~~~~~~~--~~~LivGGGIrs~e~A~~~~~aGAD~IVvGn~-iee~~d~~  221 (231)
T pfam01884       168 PVPEEVIAVKKVLD--DARLIVGGGIKSGEKAKEMARAGADVIVTGNV-IEEKGDRE  221 (231)
T ss_pred             CCCHHHHHHHHCCC--CCCEEEECCCCCHHHHHHHHHCCCCEEEECCC-EEECCCHH
T ss_conf             98999999996468--97689969979999999999779999997971-44177699


No 185
>PRK03220 consensus
Probab=97.35  E-value=0.0038  Score=40.98  Aligned_cols=33  Identities=27%  Similarity=0.332  Sum_probs=21.0

Q ss_pred             CCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCC
Q ss_conf             9748534688867798887403675241020013
Q gi|254780434|r   56 NPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTP   89 (362)
Q Consensus        56 nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~   89 (362)
                      -|+-++.|. ++.+.++.++++|+.-|+++|...
T Consensus        76 ~pi~vGGGI-rs~e~~~~ll~~GadkVvigs~a~  108 (257)
T PRK03220         76 IPLTVGGGV-RTVEDVDSLLRAGADKVSVNTAAI  108 (257)
T ss_pred             CCEEEECCC-CCHHHHHHHHHCCCCEEECHHHHH
T ss_conf             648984785-879999999981975087206677


No 186
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism]
Probab=97.34  E-value=0.016  Score=36.71  Aligned_cols=213  Identities=18%  Similarity=0.229  Sum_probs=117.0

Q ss_pred             CEEEECCEECCCCEEECCCCCCCHHHHHHHHH-CCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHH
Q ss_conf             11688873359974853468886779888740-36752410200136878998862688425554100002477777889
Q gi|254780434|r   45 LNTKVAGISLSNPLGMAAGYDKNAEVPIELLK-LGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTV  123 (362)
Q Consensus        45 L~~~~~Gl~~~nPiglAaG~dk~~~~~~~l~~-~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~  123 (362)
                      -.-++.|.+|.+.+.+..|=-++-+.++.... .|.   ++=||..+           |.          ....+|-+.+
T Consensus         6 d~l~i~g~~f~SRLllGTgky~s~~~~~~av~asg~---~ivTvAlR-----------R~----------~~~~~~~~~~   61 (262)
T COG2022           6 DMLTIAGKTFDSRLLLGTGKYPSPAVLAEAVRASGS---EIVTVALR-----------RV----------NATRPGGDGI   61 (262)
T ss_pred             CCEEECCEEEEEEEEEECCCCCCHHHHHHHHHHCCC---CEEEEEEE-----------EE----------CCCCCCCCHH
T ss_conf             522244746531588724789998999999997278---66999988-----------62----------1578885308


Q ss_pred             HHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEE-CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99876410001210001104542467887765554206755269830-33365322110000234321111224445565
Q gi|254780434|r  124 FSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTIN-ISSPNTPGLRSLQKKKNLERLLIHVMQTREEE  202 (362)
Q Consensus       124 ~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiN-iSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~  202 (362)
                      ++.|...  ++.+--|-.+-.+.++++. -+++.++... .|.+-+- ++++.|     ++ |+.++    -+ +.-+..
T Consensus        62 l~~l~~~--~~~~LPNTaGc~taeEAv~-tArlARE~~~-t~wiKlEVi~d~~t-----Ll-PD~~e----tl-~Aae~L  126 (262)
T COG2022          62 LDLLIPL--GVTLLPNTAGCRTAEEAVR-TARLAREALG-TNWIKLEVIGDEKT-----LL-PDPIE----TL-KAAEQL  126 (262)
T ss_pred             HHHHHHC--CCEECCCCCCCCCHHHHHH-HHHHHHHHCC-CCEEEEEEECCCCC-----CC-CCHHH----HH-HHHHHH
T ss_conf             8774113--8676787645588999999-9999999706-98489999368765-----48-87578----99-999999


Q ss_pred             HHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             53126885178650577774888999998764498299980665553234577544632211356454246899999997
Q gi|254780434|r  203 KIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQ  282 (362)
Q Consensus       203 ~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~  282 (362)
                      ...  .    |+=| |+.+++  .-+++.+++.|+..+--         +..+. .      ||..  .....++..+++
T Consensus       127 v~e--G----F~Vl-PY~~dD--~v~arrLee~GcaavMP---------l~aPI-G------Sg~G--~~n~~~l~iiie  179 (262)
T COG2022         127 VKE--G----FVVL-PYTTDD--PVLARRLEEAGCAAVMP---------LGAPI-G------SGLG--LQNPYNLEIIIE  179 (262)
T ss_pred             HHC--C----CEEE-ECCCCC--HHHHHHHHHCCCEEECC---------CCCCC-C------CCCC--CCCHHHHHHHHH
T ss_conf             867--9----8885-036887--89999998649668633---------56656-6------7867--578899999997


Q ss_pred             HCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC-CCHH
Q ss_conf             408974899967889999999999839997545278770-6978
Q gi|254780434|r  283 RVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY-EGIS  325 (362)
Q Consensus       283 ~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~-~Gp~  325 (362)
                      +.  ++|+|---||-++.||..-|..|+|+|-+-||.-- +.|-
T Consensus       180 ~a--~VPviVDAGiG~pSdAa~aMElG~DaVL~NTAiA~A~DPv  221 (262)
T COG2022         180 EA--DVPVIVDAGIGTPSDAAQAMELGADAVLLNTAIARAKDPV  221 (262)
T ss_pred             HC--CCCEEEECCCCCHHHHHHHHHHCCCEEEHHHHHHCCCCHH
T ss_conf             38--9988986798976688999860554323256766037869


No 187
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional
Probab=97.32  E-value=0.0023  Score=42.47  Aligned_cols=194  Identities=16%  Similarity=0.178  Sum_probs=103.6

Q ss_pred             EECCEECCCCE-E-ECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHH
Q ss_conf             88873359974-8-534688867798887403675241020013687899886268842555410000247777788999
Q gi|254780434|r   48 KVAGISLSNPL-G-MAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFS  125 (362)
Q Consensus        48 ~~~Gl~~~nPi-g-lAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~  125 (362)
                      =+.-+|-.+|- | +...+| -.+.-+.+.+.|+.++.+=|   +       ++.|.                |....+.
T Consensus        52 vIAEiKraSPSkG~I~~~~d-p~~iA~~Ye~~GA~aISVLT---e-------~~~F~----------------Gsl~dL~  104 (695)
T PRK13802         52 VIAEIKRASPSKGHLSDIPD-PAALAREYEKGGASAISVLT---E-------GRKFL----------------GSLDDFD  104 (695)
T ss_pred             EEEEEECCCCCCCCCCCCCC-HHHHHHHHHHCCCEEEEEEC---C-------CCCCC----------------CCHHHHH
T ss_conf             99986069998787688899-99999999987984999825---8-------67679----------------8999999


Q ss_pred             HHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             87641000121000110454246788776555420675526983033365322110000234321111224445565531
Q gi|254780434|r  126 RLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIK  205 (362)
Q Consensus       126 ~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~  205 (362)
                      .+++. .+.|+.-        .|.+.|-.+..+.-.-+||++=|=+++         -+++.|..++.....-       
T Consensus       105 ~vr~~-v~lPvLR--------KDFIvD~yQI~EAr~~GADaILLIva~---------L~~~~L~~l~~~a~~L-------  159 (695)
T PRK13802        105 KVRAA-VHIPVLR--------KDFIVTDYQIFEARAHGADLVLLIVAA---------LDDAQLKHLLDLAHEL-------  159 (695)
T ss_pred             HHHHH-CCCCEEE--------CCEECCHHHHHHHHHCCCCHHHHHHHH---------CCHHHHHHHHHHHHHC-------
T ss_conf             99985-8998570--------233063999999998287889999986---------6999999999999986-------


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             26885178650577774888999998764498299980665553234577544632211356454246899999997408
Q gi|254780434|r  206 TGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVG  285 (362)
Q Consensus       206 ~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~  285 (362)
                         ..-.+|-+-   +.   .+ ++.+.++|++ |+-+|-   |+ +.+               +.+-+..-.+++..++
T Consensus       160 ---Gm~~LVEVH---~~---~E-l~rAl~~ga~-iIGINn---Rn-L~T---------------f~vD~~~~~~Lap~iP  209 (695)
T PRK13802        160 ---NMTVLVETH---TR---EE-IERARKAGAK-VIGINA---RN-LKN---------------LKVDVNKYNELAADLP  209 (695)
T ss_pred             ---CCEEEEEEC---CH---HH-HHHHHHCCCC-EEEEEC---CC-CCC---------------CEECHHHHHHHHHHCC
T ss_conf             ---991799978---99---99-9999847999-899878---98-864---------------2287799999984689


Q ss_pred             CCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCC
Q ss_conf             97489996788999999999983999754527877069
Q gi|254780434|r  286 PKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEG  323 (362)
Q Consensus       286 ~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~G  323 (362)
                      .++..++-.||.+++|+..+-.+|||+|-|+-+++-.+
T Consensus       210 ~~~v~VAESGI~~~~Dv~~~a~aGadAvLVGEalvta~  247 (695)
T PRK13802        210 DDVIKVAESGVFGAVEVEDYARAGADAVLVGEGVATAD  247 (695)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHCCCCEEEECCHHHCCC
T ss_conf             98579956899998999999977999999780341589


No 188
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional
Probab=97.24  E-value=0.021  Score=36.05  Aligned_cols=201  Identities=18%  Similarity=0.199  Sum_probs=106.5

Q ss_pred             CCCEEECCCCCCCHHHHHHHHHCC--CCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             997485346888677988874036--752410200136878998862688425554100002477777889998764100
Q gi|254780434|r   55 SNPLGMAAGYDKNAEVPIELLKLG--FGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQP  132 (362)
Q Consensus        55 ~nPiglAaG~dk~~~~~~~l~~~G--~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~  132 (362)
                      ++++.+|.=++.--+.++-+..++  ...+++|+-.                     +     -+.|.+ +.++|++.. 
T Consensus         3 ~~~l~vALD~~~~~~a~~l~~~l~~~i~~iKiG~~l---------------------~-----~~~G~~-~i~~l~~~~-   54 (215)
T PRK13813          3 DSRIILALDVYDREEALKIAEELSDYVDAIKVNWPL---------------------I-----LASGLS-IIRELKQYT-   54 (215)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHCCCCEEEEECHHH---------------------H-----HHCCHH-HHHHHHHHC-
T ss_conf             888799961799999999999847756099989799---------------------8-----754999-999999858-


Q ss_pred             CCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             01210001104542467887765554206755269830333653221100002343211112244455655312688517
Q gi|254780434|r  133 TSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPI  212 (362)
Q Consensus       133 ~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi  212 (362)
                        |++.-. +..+.++...-+++.+-+  ..+|+++++-+++.          +-+..    ..+...    +....+=+
T Consensus        55 --~If~Dl-K~~DIpnTv~~~~~~~~~--~ga~~vTvh~~~g~----------~~i~~----a~~~~~----~~~~~v~~  111 (215)
T PRK13813         55 --PVIADL-KVADIPNTNRLICEKVFE--AGADGIIVHGFTGR----------DSLKA----VVEAAK----RYGKKVFV  111 (215)
T ss_pred             --CEEEEE-EECCCHHHHHHHHHHHHH--CCCCEEEEECCCCH----------HHHHH----HHHHHH----HCCCCEEE
T ss_conf             --907998-624463799999999996--29999999256889----------99999----999876----41984599


Q ss_pred             EEECCC----CCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             865057----7774888999998764498299980665553234577544632211356454246899999997408974
Q gi|254780434|r  213 FLKISP----DLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKI  288 (362)
Q Consensus       213 ~vKLsP----d~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i  288 (362)
                      ...|+-    +...+....+++.+.+.|++|+++.-+.                           ..-+..+|+.++.++
T Consensus       112 v~~ls~~g~~~~~~~~~~~~~~~a~~~g~~Gvv~~~~~---------------------------~~~~~~ir~~~~~~~  164 (215)
T PRK13813        112 VVEMSHPGALEFINPVADKLAKLANEAGAFGVVAPATR---------------------------PERVRAIRRRLGDDL  164 (215)
T ss_pred             EEEECCCCHHHHHHHHHHHHHHHHHHCCCCEEEECCCC---------------------------HHHHHHHHHHCCCCC
T ss_conf             99846877465699999999999998699989978988---------------------------799999998628874


Q ss_pred             EEEEECCCCC-HHHHHHHHHCCCCEEEECHHHHC-CCH-HHHHHHHHHH
Q ss_conf             8999678899-99999999839997545278770-697-8999999999
Q gi|254780434|r  289 AIIGTGGISS-TKDALDKIMAGANLIQLYSAMIY-EGI-SLPKRIIQGL  334 (362)
Q Consensus       289 ~IIg~GGI~s-~~Da~e~l~aGAs~VQi~Tali~-~Gp-~~~~~I~~~L  334 (362)
                      .++ +.||.- +.+..+.+.+|||.+=|+.+..- +.| ..+++|.+++
T Consensus       165 ~iv-tPGI~~~~~~~~~ai~~Gad~iVVGR~It~A~dP~~aa~~i~~~i  212 (215)
T PRK13813        165 KII-SPGIGAQGGKASDAIKAGADYVIVGRSIYNAADPREAAKKIREEI  212 (215)
T ss_pred             EEE-CCCCCCCCCCHHHHHHHCCCEEEECCCCCCCCCHHHHHHHHHHHH
T ss_conf             698-576167999989999818999998943358999999999999986


No 189
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed
Probab=97.23  E-value=0.006  Score=39.68  Aligned_cols=137  Identities=14%  Similarity=0.143  Sum_probs=80.7

Q ss_pred             CCCCCCEEECCCCCHHHHHHHHHHHHHH-CCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             0121000110454246788776555420-675526983033365322110000234321111224445565531268851
Q gi|254780434|r  133 TSPIGINLGANKDSKDFILDYVSGIRLF-FTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVP  211 (362)
Q Consensus       133 ~~pi~vsI~~~~~s~~~~~dy~~~~~~~-~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~P  211 (362)
                      +.||++-|= .. +   .+|...+++.+ ..+...+|+-++.|+..        +    .+..+++.           .|
T Consensus         9 ~~plvaIlR-~~-~---~~~a~~~~~al~~~Gi~~iEVTl~tp~a~--------~----~I~~l~~~-----------~~   60 (206)
T PRK09140          9 KLPLIAILR-GI-T---PDEALAHVGALIEAGFRAIEIPLNSPDPF--------D----SIAALVKA-----------LG   60 (206)
T ss_pred             HCCEEEEEE-CC-C---HHHHHHHHHHHHHCCCCEEEEECCCCCHH--------H----HHHHHHHH-----------CC
T ss_conf             599799995-89-9---99999999999986998899917997699--------9----99999996-----------79


Q ss_pred             --EEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             --786505777748889999987644982999806655532345775446322113564542468999999974089748
Q gi|254780434|r  212 --IFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIA  289 (362)
Q Consensus       212 --i~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~  289 (362)
                        +.+-..-=++    .+-++.+.++|++.++-=++                           ..+.++..++.   +++
T Consensus        61 ~~~~iGAGTVlt----~e~~~~ai~aGA~FiVSP~~---------------------------~~~vi~~a~~~---~i~  106 (206)
T PRK09140         61 DDALIGAGTVLS----PEQVDRLADAGGRLIVTPNI---------------------------DPEVIRRAVAY---GMT  106 (206)
T ss_pred             CCEEEEEEECCC----HHHHHHHHHCCCCEEECCCC---------------------------CHHHHHHHHHC---CCC
T ss_conf             865998620467----99999999859999999999---------------------------89999999982---996


Q ss_pred             EEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             999678899999999998399975452787706978999999999
Q gi|254780434|r  290 IIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       290 IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                        -.=|++|+.++...+.+||++|.++-+-.+ ||..++.+..-+
T Consensus       107 --~iPG~~TPsEi~~A~~~Ga~~vKlFPA~~~-Gp~~ikal~~p~  148 (206)
T PRK09140        107 --VMPGVATPTEAFAALRAGADALKLFPASQL-GPAGIKALRAVL  148 (206)
T ss_pred             --CCCCCCCHHHHHHHHHCCCCEEEECCHHCC-CHHHHHHHHCCC
T ss_conf             --527859999999999859871565751105-999999986438


No 190
>PRK05283 deoxyribose-phosphate aldolase; Provisional
Probab=97.17  E-value=0.024  Score=35.56  Aligned_cols=80  Identities=21%  Similarity=0.304  Sum_probs=48.8

Q ss_pred             EEEEEC---CCCCCHHH-HHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH-HHHHHHH-HC
Q ss_conf             178650---57777488-899999876449829998066555323457754463221135645424689-9999997-40
Q gi|254780434|r  211 PIFLKI---SPDLSEEE-LDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTI-ALAKIRQ-RV  284 (362)
Q Consensus       211 Pi~vKL---sPd~~~~~-i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~-~i~~i~~-~~  284 (362)
                      ++.+|+   +..+++++ +...++.+.++|+|.|-   |         +.+      .++..-.+-+.+ +.+.+++ ..
T Consensus       132 ~~~LKVIlET~~L~~~e~I~~As~~a~~aGADFVK---T---------STG------k~~~gAT~e~v~~M~~aI~~~~~  193 (258)
T PRK05283        132 NVLLKVIIETGELKDEALIRKASEIAIKAGADFIK---T---------STG------KVPVNATLEAARIMLEVIRDMGV  193 (258)
T ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHCCCEEE---C---------CCC------CCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             84389997403478589999999999996979888---8---------999------89999799999999999998645


Q ss_pred             CCCEEEEEECCCCCHHHHHHHHHC
Q ss_conf             897489996788999999999983
Q gi|254780434|r  285 GPKIAIIGTGGISSTKDALDKIMA  308 (362)
Q Consensus       285 ~~~i~IIg~GGI~s~~Da~e~l~a  308 (362)
                      ++++-+-.+|||.+.+||..|+..
T Consensus       194 G~~vGvKasGGIrt~~dA~~yl~L  217 (258)
T PRK05283        194 GKTVGFKPAGGVRTAEDAAQYLAL  217 (258)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHH
T ss_conf             886567625886899999999999


No 191
>pfam04131 NanE Putative N-acetylmannosamine-6-phosphate epimerase. This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilisation pathway found mainly in pathogenic bacteria.
Probab=97.16  E-value=0.0066  Score=39.37  Aligned_cols=129  Identities=16%  Similarity=0.169  Sum_probs=77.7

Q ss_pred             HCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             06755269830333653221100002343211112244455655312688517865057777488899999876449829
Q gi|254780434|r  160 FFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEG  239 (362)
Q Consensus       160 ~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dG  239 (362)
                      +..+||.+-+.-.  +  -.|    |+.+.+++..+++.          ..++++-.|   +   +++ +..+.+.|+|-
T Consensus        61 ~~aGadiIA~DaT--~--R~R----P~~~~~lv~~i~~~----------~~l~MAD~s---t---~ee-a~~A~~~G~D~  115 (192)
T pfam04131        61 ANAGADIIALDGT--D--RPR----PVDIESFIKRIKEK----------GQLAMADCS---T---FEE-GLNAHKLGVDI  115 (192)
T ss_pred             HHCCCCEEEEECC--C--CCC----CCCHHHHHHHHHHH----------CCEEEEECC---C---HHH-HHHHHHCCCCE
T ss_conf             9859999998467--8--989----75899999999981----------998899749---9---999-99999859999


Q ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHH
Q ss_conf             99806655532345775446322113564542468999999974089748999678899999999998399975452787
Q gi|254780434|r  240 IIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAM  319 (362)
Q Consensus       240 iv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tal  319 (362)
                      |.   ||.+  +.....    .+  .+|     -+++++++.+.   ++|+|+=|+|.|++++.+.+.+||++|-|+|| 
T Consensus       116 I~---TTL~--GYT~~t----~~--~~p-----D~~ll~~l~~~---~~pvIaEGri~tPe~a~~a~~~GA~aVVVGsA-  175 (192)
T pfam04131       116 VG---TTLS--GYTGGS----NP--AEP-----DFQLVKTLSEA---GCFVIAEGRYNTPELAKKAIEIGADAVTVGSA-  175 (192)
T ss_pred             EE---CCCC--CCCCCC----CC--CCC-----CHHHHHHHHHC---CCCEEEECCCCCHHHHHHHHHCCCCEEEECCC-
T ss_conf             98---2325--578999----99--999-----78999999868---99399857989999999999839989998965-


Q ss_pred             HCCCHHHH-HHHHHHH
Q ss_conf             70697899-9999999
Q gi|254780434|r  320 IYEGISLP-KRIIQGL  334 (362)
Q Consensus       320 i~~Gp~~~-~~I~~~L  334 (362)
                      +-+ |..+ ++-.+.+
T Consensus       176 ITr-P~~IT~~F~~ai  190 (192)
T pfam04131       176 ITR-LEEITQWFIEAI  190 (192)
T ss_pred             CCC-HHHHHHHHHHHH
T ss_conf             379-899999999997


No 192
>TIGR00007 TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; InterPro: IPR006063   1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (5.3.1.16 from EC), also known as Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase or HisA, catalyses the fourth step in histidine biosynthesis. HisA from Lactococcus lactis was found to be inactive . The putative HisA from Thermotoga maritima, is a conspicuous outlier to the set of all other HisA, including experimental HisA from the bacterium E. coli and the Archaeaon Methanococcus voltae. Neighbor joining shows HisA from Thermotoga maritima to be within the HisA family (with HisF as an outgroup) but with a long branch. ; GO: 0003949 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity, 0000105 histidine biosynthetic process.
Probab=97.16  E-value=0.0047  Score=40.37  Aligned_cols=90  Identities=21%  Similarity=0.258  Sum_probs=63.9

Q ss_pred             HHHHHHHHHHH-CCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHH
Q ss_conf             88999998764-49829998066555323457754463221135645424689999999740897489996788999999
Q gi|254780434|r  224 ELDDIAVEVLS-HKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDA  302 (362)
Q Consensus       224 ~i~~ia~~a~~-~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da  302 (362)
                      +..++|+.-.+ .|+.-|.+..-    +           |-..|   .+.-+..|+++.+.+..++.|  -|||.|-++|
T Consensus        29 ~P~~~A~~~~~~~GA~~iHvVDL----D-----------GA~~g---~~~N~~~i~~I~~~~~~~vQv--GGGIRs~e~v   88 (241)
T TIGR00007        29 DPVEAAKKWEEFQGAKRIHVVDL----D-----------GALEG---GPVNLEVIKKIVEELGVPVQV--GGGIRSLEDV   88 (241)
T ss_pred             CHHHHHHHHHHCCCCCEEEEEEC----C-----------HHHCC---CCCHHHHHHHHHHHCCCCEEE--CCCCCCHHHH
T ss_conf             98999999984169715999845----1-----------00068---620078999999861851798--1751688999


Q ss_pred             HHHHHCCCCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             99998399975452787706978999999999
Q gi|254780434|r  303 LDKIMAGANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       303 ~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                      .+++.+|.+-|=++|+. ++-|.+++++.++.
T Consensus        89 ~~ll~~Gv~RVI~GT~A-~~~~~~v~~~~~~~  119 (241)
T TIGR00007        89 EKLLDLGVDRVIIGTAA-VENPDLVKELLKEY  119 (241)
T ss_pred             HHHHHCCCCEEEEEEEE-ECCHHHHHHHHHHH
T ss_conf             99997398579973322-10869999999984


No 193
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional
Probab=97.15  E-value=0.0069  Score=39.27  Aligned_cols=36  Identities=25%  Similarity=0.374  Sum_probs=24.4

Q ss_pred             CCCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCC
Q ss_conf             5997485346888677988874036752410200136
Q gi|254780434|r   54 LSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPH   90 (362)
Q Consensus        54 ~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~   90 (362)
                      +.-|+-++.|. ++.+.++.++++|+.-++++|.+.+
T Consensus        74 ~~~pi~vGGGI-rs~~~i~~~l~~Ga~kvvigs~~~~  109 (240)
T PRK13585         74 TDVSIQLGGGI-RSVEDAASLLDLGVDRVILGTAAIE  109 (240)
T ss_pred             CCCCEEEECCC-CCHHHHHHHHHCCCCEEEECCCCHH
T ss_conf             79778997885-8799999999769989993981131


No 194
>PRK08745 ribulose-phosphate 3-epimerase; Provisional
Probab=97.15  E-value=0.026  Score=35.38  Aligned_cols=206  Identities=19%  Similarity=0.235  Sum_probs=120.7

Q ss_pred             ECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCE
Q ss_conf             53468886779888740367524102001368789988626884255541000024777778899987641000121000
Q gi|254780434|r   60 MAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGIN  139 (362)
Q Consensus        60 lAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~vs  139 (362)
                      ++|-+.+-.+.++.+.+.|..++-+                  ..-|+-.+..++|.   . .+++.+++...+.|+=+-
T Consensus        11 l~ad~~~L~~ei~~l~~~g~d~iHi------------------DImDG~FVpN~t~g---~-~~i~~ir~~~~~~plDvH   68 (223)
T PRK08745         11 LSADFARLGEEVDNVLKAGADWVHF------------------DVMDNHYVPNLTIG---P-MVCQALRKHGITAPIDVH   68 (223)
T ss_pred             HHCCHHHHHHHHHHHHHCCCCEEEE------------------ECCCCCCCCCCCCC---H-HHHHHHHHHCCCCCEEEE
T ss_conf             5159999999999999769998998------------------27679707755709---5-999999961899753778


Q ss_pred             EECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             11045424678877655542067552698303336532211000023432111122444556553126885178650577
Q gi|254780434|r  140 LGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPD  219 (362)
Q Consensus       140 I~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd  219 (362)
                      ++.+.     .+.|.+.+.+  .++|++.+-.-|.+           .+.+.+..+++.          .+-..+-|.|+
T Consensus        69 LMv~~-----P~~~i~~~~~--aGad~i~~H~Ea~~-----------~~~~~i~~ik~~----------g~k~GlalnP~  120 (223)
T PRK08745         69 LMVEP-----VDRIVPDFAD--AGATTISFHPEASR-----------HVHRTIQLIKSH----------GCQAGLVLNPA  120 (223)
T ss_pred             EEECC-----HHHHHHHHHH--CCCCEEEEEECCCC-----------CHHHHHHHHHHC----------CCCEEEEECCC
T ss_conf             98339-----8999999997--39978999606442-----------999999999983----------98446774699


Q ss_pred             CCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH---CCCCEEEEEECCC
Q ss_conf             7748889999987644982999806655532345775446322113564542468999999974---0897489996788
Q gi|254780434|r  220 LSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQR---VGPKIAIIGTGGI  296 (362)
Q Consensus       220 ~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~---~~~~i~IIg~GGI  296 (362)
                      .+.+.+..++.     -+|.|.+-            ...  . |.+|....+.++.-|+++|+.   .+.++.|---|||
T Consensus       121 T~~~~l~~~l~-----~~D~VliM------------tV~--P-Gf~GQ~f~~~~l~KI~~l~~~~~~~~~~~~I~VDGGI  180 (223)
T PRK08745        121 TPVDILDWVLP-----ELDLVLVM------------SVN--P-GFGGQAFIPSALDKLRAIRKKIDALGKPIRLEIDGGV  180 (223)
T ss_pred             CCHHHHHHHHH-----HCCEEEEE------------EEC--C-CCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             98799999886-----47989998------------756--9-9887545688999999999999864999459997887


Q ss_pred             CCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             999999999983999754527877069789999999999999
Q gi|254780434|r  297 SSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFL  338 (362)
Q Consensus       297 ~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l  338 (362)
                      .. +-+-+...+|||.+=.+|+ +|+.+. .++..+.|++..
T Consensus       181 ~~-~ti~~l~~aGad~~V~GSa-iF~~~d-~~~~i~~lr~~~  219 (223)
T PRK08745        181 KA-DNIGAIAAAGADTFVAGSA-IFNAPD-YAQVIAQMRAAV  219 (223)
T ss_pred             CH-HHHHHHHHCCCCEEEECHH-HHCCCC-HHHHHHHHHHHH
T ss_conf             98-9999999869999997417-757999-999999999999


No 195
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water. IGPS is active as a separate monomer in most organisms, but is also found fused to other enzymes as part of a bifunctional or multifunctional enzyme involved in tryptophan biosynthesis.
Probab=97.11  E-value=0.0095  Score=38.32  Aligned_cols=192  Identities=19%  Similarity=0.284  Sum_probs=97.3

Q ss_pred             ECCEECCCCE-EE-CCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHH
Q ss_conf             8873359974-85-346888677988874036752410200136878998862688425554100002477777889998
Q gi|254780434|r   49 VAGISLSNPL-GM-AAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSR  126 (362)
Q Consensus        49 ~~Gl~~~nPi-gl-AaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~  126 (362)
                      +.-+|-++|- |. ...+| -.+..+.+.+.|+.++.+=|   +       |.+|.                |.-..++.
T Consensus        14 IaEiKr~SPS~G~i~~~~d-~~~~A~~Y~~~GA~aiSVLT---e-------~~~F~----------------Gs~~~L~~   66 (217)
T cd00331          14 IAEVKRASPSKGLIREDFD-PVEIAKAYEKAGAAAISVLT---E-------PKYFQ----------------GSLEDLRA   66 (217)
T ss_pred             EEEEECCCCCCCCCCCCCC-HHHHHHHHHHCCCCEEEEEC---C-------CCCCC----------------CCHHHHHH
T ss_conf             9762269999885678899-99999999977981899955---7-------77779----------------88999999


Q ss_pred             HHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             76410001210001104542467887765554206755269830333653221100002343211112244455655312
Q gi|254780434|r  127 LSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKT  206 (362)
Q Consensus       127 l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~  206 (362)
                      +++. .+.|+--        .|.+.|-.+..+...-+||++-|-.++         .+++.+.+++......        
T Consensus        67 v~~~-~~~PiLr--------KDFIid~~QI~ea~~~GAdaiLLI~~~---------L~~~~l~~l~~~a~~l--------  120 (217)
T cd00331          67 VREA-VSLPVLR--------KDFIIDPYQIYEARAAGADAVLLIVAA---------LDDEQLKELYELAREL--------  120 (217)
T ss_pred             HHHH-CCCCEEE--------CCCCCCHHHHHHHHHCCCCCHHHHHHH---------CCHHHHHHHHHHHHHH--------
T ss_conf             9984-7998674--------232176999999998199878798885---------4999999999999994--------


Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             68851786505777748889999987644982999806655532345775446322113564542468999999974089
Q gi|254780434|r  207 GKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGP  286 (362)
Q Consensus       207 ~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~  286 (362)
                        ..-++|-+.   +.+++    +.+.+.+++ ++.+|.   |+ +..               +...+..-.++.+.+++
T Consensus       121 --gl~~LvEvh---~~~El----~~a~~~~a~-iIGINn---Rd-L~t---------------~~vd~~~~~~L~~~ip~  171 (217)
T cd00331         121 --GMEVLVEVH---DEEEL----ERALALGAK-IIGINN---RD-LKT---------------FEVDLNTTERLAPLIPK  171 (217)
T ss_pred             --CCEEEEEEC---CHHHH----HHHHHCCCC-EEEECC---CC-CHH---------------CEECHHHHHHHHHHCCC
T ss_conf             --982798858---99999----999957998-784216---77-123---------------03478999999964898


Q ss_pred             CEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCC
Q ss_conf             748999678899999999998399975452787706
Q gi|254780434|r  287 KIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYE  322 (362)
Q Consensus       287 ~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~  322 (362)
                      +..+|+-+||.+.+|+..+..+|+++|-|+|++|..
T Consensus       172 ~~~~IsESGI~~~~di~~l~~~G~d~~LIG~sLm~~  207 (217)
T cd00331         172 DVILVSESGISTPEDVKRLAEAGADAVLIGESLMRA  207 (217)
T ss_pred             CCEEEECCCCCCHHHHHHHHHCCCCEEEECHHHHCC
T ss_conf             988998279999999999998799999989788679


No 196
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase; InterPro: IPR005994    Guanosine monophosphate reductase (1.7.1.7 from EC) catalyzes the irreversible and NADPH-dependent reductive deamination of GMP into IMP.  NADPH + guanosine 5-phosphate = NADP+ + inosine 5-phosphate + NH3      It converts nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and maintains intracellular balance of A and G nucleotides. A deep split separates two families of GMP reductase. This family is found in a variety of bacterial lineages. .
Probab=97.11  E-value=0.023  Score=35.76  Aligned_cols=215  Identities=17%  Similarity=0.221  Sum_probs=114.7

Q ss_pred             CCCCCCCEEEECCEECCCCEEECCCC-CCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCC
Q ss_conf             78896311688873359974853468-88677988874036752410200136878998862688425554100002477
Q gi|254780434|r   39 VHSDPRLNTKVAGISLSNPLGMAAGY-DKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNN  117 (362)
Q Consensus        39 ~~~~~~L~~~~~Gl~~~nPiglAaG~-dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N  117 (362)
                      .+++-|.++++...+|+=||+.|-=- --+-.....+.+-++=++                 ++|+.++           
T Consensus        18 srs~~dt~~~lG~~~fklPv~Panmqt~~~e~~a~~la~~~yfy~-----------------mhrf~~~-----------   69 (321)
T TIGR01306        18 SRSECDTSVRLGKKKFKLPVVPANMQTIIDEKLAKSLAENGYFYI-----------------MHRFDEE-----------   69 (321)
T ss_pred             CCCCCCCEEEECCEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEE-----------------EEECCCH-----------
T ss_conf             022444046665612101112236788888999999851695799-----------------9814701-----------


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             77788999876410001210001104542467887765554206755269830333653221100002343211112244
Q gi|254780434|r  118 AGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQ  197 (362)
Q Consensus       118 ~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~  197 (362)
                       --..+.+++...  +..-.+|+|.-    +.--||+..+.+-.-.-.|+++.+.--|         .+.+-+.+..++ 
T Consensus        70 -~r~~fik~m~~~--Gl~~sisvGvk----~~ey~f~~~l~~~~l~Pe~~tidiahGh---------~~~vi~mi~h~k-  132 (321)
T TIGR01306        70 -ARIPFIKDMQER--GLFASISVGVK----KAEYEFVEKLAEEKLIPEYITIDIAHGH---------SNSVIEMIKHIK-  132 (321)
T ss_pred             -HHHHHHHHHHHC--CCEEEEEECCH----HHHHHHHHHHHHCCCCCCEEEEEEECCC---------HHHHHHHHHHHH-
T ss_conf             -126899988747--85466520200----3568999998742678615788740363---------378999999998-


Q ss_pred             HHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCC-CCCCCCCCC--CCCCCCCCCCHHHH
Q ss_conf             455655312688517865057777488899999876449829998066555323-457754463--22113564542468
Q gi|254780434|r  198 TREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKG-VQCSDNHEQ--DGGLSGSPLFLKST  274 (362)
Q Consensus       198 ~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~-~~~~~~~~~--~GGlSG~~i~~~al  274 (362)
                                +++|=-.=++-|...   ++-++.++.+|+|+--+.-.    |+ ++....+.+  +||.-        +
T Consensus       133 ----------~~~P~~fviaGnvGt---Pe~vrelenaGadatkvGiG----PG~vCitk~ktGfGtGGWq--------l  187 (321)
T TIGR01306       133 ----------THLPDSFVIAGNVGT---PEAVRELENAGADATKVGIG----PGKVCITKIKTGFGTGGWQ--------L  187 (321)
T ss_pred             ----------HHCCCCEEEECCCCC---CHHHHHHHHCCCCCEEECCC----CCCEEEEEEECCCCCCHHH--------H
T ss_conf             ----------748841687546788---25567665337641132247----8736898640255761589--------9


Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC--CCHH
Q ss_conf             99999997408974899967889999999999839997545278770--6978
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY--EGIS  325 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~--~Gp~  325 (362)
                      ..+++..+..  +-|||+-|||.+--|..+-++-||+.|+++|-|.-  +-|+
T Consensus       188 aal~~C~kaa--~kP~iadGGirthGdiaksirfGa~mvmiGslfa~h~esPG  238 (321)
T TIGR01306       188 AALRWCAKAA--RKPIIADGGIRTHGDIAKSIRFGASMVMIGSLFAGHEESPG  238 (321)
T ss_pred             HHHHHHHHHH--CCCEEECCCCCCCHHHHHHHHHCCHHHHHHHHHHCCCCCCC
T ss_conf             9999988863--68703158523300344555531043123345420246875


No 197
>pfam00977 His_biosynth Histidine biosynthesis protein. Proteins involved in steps 4 and 6 of the histidine biosynthesis pathway are contained in this family. Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes. The enzymes in this Pfam entry are called His6 and His7 in eukaryotes and HisA and HisF in prokaryotes. The structure of HisA is known to be a TIM barrel fold. In some archaeal HisA proteins the TIM barrel is composed of two tandem repeats of a half barrel. This family belong to the common phosphate binding site TIM barrel family.
Probab=97.11  E-value=0.0083  Score=38.74  Aligned_cols=56  Identities=27%  Similarity=0.268  Sum_probs=27.2

Q ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHH
Q ss_conf             89999999740897489996788999999999983999754527877069789999999
Q gi|254780434|r  274 TIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQ  332 (362)
Q Consensus       274 l~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~  332 (362)
                      ...++++.+.+  .+||.-.|||.|-+|+.+++.+||+-|-++|.. ++.|.+++++.+
T Consensus        62 ~~~i~~i~~~~--~~pi~vgGGIrs~e~~~~~l~~Ga~kvvigs~~-~~~~~~~~~~~~  117 (229)
T pfam00977        62 LDLIEEIAEEV--FIPVQVGGGIRSLEDAERLLSAGADKVIIGTAA-VKNPELIKEAAE  117 (229)
T ss_pred             HHHHHHHHHHC--CCCEEEECCEEEHHHHHHHHHCCCCEEEECCCH-HHCHHHHHHHHH
T ss_conf             99999999866--987899645611899999997699899958604-309378999999


No 198
>PRK07695 transcriptional regulator TenI; Provisional
Probab=97.09  E-value=0.0052  Score=40.06  Aligned_cols=93  Identities=22%  Similarity=0.370  Sum_probs=61.8

Q ss_pred             HHHHHHHHHHCCCCEEEEEC--CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHH
Q ss_conf             89999987644982999806--6555323457754463221135645424689999999740897489996788999999
Q gi|254780434|r  225 LDDIAVEVLSHKVEGIIVSN--TTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDA  302 (362)
Q Consensus       225 i~~ia~~a~~~g~dGiv~~N--T~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da  302 (362)
                      +.+ +..+.+.|+|=+.+.-  .|...++                 ..|..+..++++.+.+  ++|+++.|||.. +++
T Consensus       105 ~~e-~~~a~~~gaDYi~~Gpif~T~tK~~-----------------~~~~G~~~l~~~~~~~--~iPvvAIGGI~~-~ni  163 (202)
T PRK07695        105 LEE-AIQAEKNGADYVVYGHVFPTDCKKG-----------------VPARGLEELSEIARAL--SIPVIAIGGITP-ENT  163 (202)
T ss_pred             HHH-HHHHHHCCCCEEEECCCCCCCCCCC-----------------CCCCCHHHHHHHHHHC--CCCEEEECCCCH-HHH
T ss_conf             999-9999776999699725412688889-----------------8878999999999867--999899869899-999


Q ss_pred             HHHHHCCCCEEEECHHHHC-CCH-HHHHHHHHHHHHHH
Q ss_conf             9999839997545278770-697-89999999999999
Q gi|254780434|r  303 LDKIMAGANLIQLYSAMIY-EGI-SLPKRIIQGLSDFL  338 (362)
Q Consensus       303 ~e~l~aGAs~VQi~Tali~-~Gp-~~~~~I~~~L~~~l  338 (362)
                      -+.+.+||+-|-+.|+++- ..| ..++++++.+++|-
T Consensus       164 ~~v~~~Ga~giAvis~I~~a~dp~~~~~~l~~~i~~~~  201 (202)
T PRK07695        164 RDVLAAGVSGIAVMSGIFSSSNPYSKAKRYKESIRKWA  201 (202)
T ss_pred             HHHHHCCCCEEEEHHHHHCCCCHHHHHHHHHHHHHHHH
T ss_conf             99998299999971897769999999999999999862


No 199
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=97.08  E-value=0.03  Score=34.97  Aligned_cols=46  Identities=22%  Similarity=0.312  Sum_probs=38.0

Q ss_pred             HHHHHHHHHCCCCEEEEEECCCC-CHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             99999997408974899967889-999999999839997545278770
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGIS-STKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~-s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      ..++.++.-+ ++++++.+|||. |.+.+.+|+.+||.+|.++|.++-
T Consensus       148 ~~lkal~~p~-p~~~~~PtGGV~ps~~N~~~~l~ag~~~vG~GS~l~~  194 (223)
T PRK07114        148 EFVKAIKGPM-PWTSIMPTGGVEPTEENLKSWFKAGATCVGMGSKLFP  194 (223)
T ss_pred             HHHHHHHCCC-CCCCEEECCCCCCCHHHHHHHHHCCCEEEEECHHHCC
T ss_conf             9999984649-9996887999887355099999689979998846389


No 200
>PRK06857 consensus
Probab=97.07  E-value=0.0072  Score=39.13  Aligned_cols=45  Identities=20%  Similarity=0.199  Sum_probs=37.0

Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             99999997408974899967889999999999839997545278770
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      ..++.++.-+ ++++++.+|||.- +++.+|+.+|+-++..+|.++-
T Consensus       141 ~~lkal~~p~-p~~~~~ptGGV~~-~N~~~yl~~~~v~~~gGS~l~~  185 (209)
T PRK06857        141 NMLKALLAPY-PNLQIMPTGGINP-SNIKDYLAIPNVVACGGTWMVP  185 (209)
T ss_pred             HHHHHHHCCC-CCCEEEECCCCCH-HHHHHHHCCCCEEEEECHHHCC
T ss_conf             9999986538-9980996489888-7899998599889998936589


No 201
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism]
Probab=97.07  E-value=0.0091  Score=38.43  Aligned_cols=63  Identities=22%  Similarity=0.235  Sum_probs=40.8

Q ss_pred             HHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCH---HHHHHHHHHHHHHHHH
Q ss_conf             9999997408974899967889999999999839997545278770697---8999999999999998
Q gi|254780434|r  276 ALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGI---SLPKRIIQGLSDFLNK  340 (362)
Q Consensus       276 ~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp---~~~~~I~~~L~~~l~~  340 (362)
                      +++.+..- -+++.++-+|||+. ..+.+|+.+|+.+|.++|.+.-++.   +...+|.+-.+++++.
T Consensus       143 ~~ka~~gP-~~~v~~~pTGGVs~-~N~~~yla~gv~avG~Gs~l~~~~~~~~~~~~~i~~~a~~~~~~  208 (211)
T COG0800         143 MLKALAGP-FPQVRFCPTGGVSL-DNAADYLAAGVVAVGLGSWLVPKDLIAAGDWDRITELAREAVAL  208 (211)
T ss_pred             HHHHHCCC-CCCCEEEECCCCCH-HHHHHHHHCCCEEEECCCCCCCHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             99987389-99985854698787-77999971780599547442673555314499999999999998


No 202
>KOG2550 consensus
Probab=97.07  E-value=0.0077  Score=38.93  Aligned_cols=127  Identities=14%  Similarity=0.180  Sum_probs=68.0

Q ss_pred             HHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCC-CHHHHHHHHHHHHHCCC
Q ss_conf             20675526983033365322110000234321111224445565531268851786505777-74888999998764498
Q gi|254780434|r  159 LFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDL-SEEELDDIAVEVLSHKV  237 (362)
Q Consensus       159 ~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~-~~~~i~~ia~~a~~~g~  237 (362)
                      ...+++|++.|.-|-=|         ....-+.+.-+++        ...+..|+.   -|. +    .+-++.+..+|+
T Consensus       259 l~~aGvdvviLDSSqGn---------S~~qiemik~iK~--------~yP~l~Via---GNVVT----~~qa~nLI~aGa  314 (503)
T KOG2550         259 LVQAGVDVVILDSSQGN---------SIYQLEMIKYIKE--------TYPDLQIIA---GNVVT----KEQAANLIAAGA  314 (503)
T ss_pred             HHHCCCCEEEEECCCCC---------CHHHHHHHHHHHH--------HCCCCEEEC---CCEEE----HHHHHHHHHCCC
T ss_conf             66348868999668885---------0457999999986--------688863431---65533----888999987367


Q ss_pred             CEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECH
Q ss_conf             29998066555323457754463221135645424689999999740897489996788999999999983999754527
Q gi|254780434|r  238 EGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYS  317 (362)
Q Consensus       238 dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~T  317 (362)
                      ||+-+.=-.++   +++-......    |+| .-.+...+++.....  .+|+|+-|||.+.-++.+.+.+|||.|++++
T Consensus       315 DgLrVGMGsGS---iCiTqevma~----Grp-Q~TAVy~va~~A~q~--gvpviADGGi~~~Ghi~KAl~lGAstVMmG~  384 (503)
T KOG2550         315 DGLRVGMGSGS---ICITQKVMAC----GRP-QGTAVYKVAEFANQF--GVPCIADGGIQNVGHVVKALGLGASTVMMGG  384 (503)
T ss_pred             CEEEECCCCCC---EEEECEEEEC----CCC-CCCCHHHHHHHHHHC--CCCEECCCCCCCCHHHHHHHHCCCHHHHCCC
T ss_conf             60575255675---0545301232----677-620032699999764--9965506875873177888753850631041


Q ss_pred             HH
Q ss_conf             87
Q gi|254780434|r  318 AM  319 (362)
Q Consensus       318 al  319 (362)
                      -+
T Consensus       385 lL  386 (503)
T KOG2550         385 LL  386 (503)
T ss_pred             HH
T ss_conf             10


No 203
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional
Probab=97.03  E-value=0.021  Score=36.05  Aligned_cols=65  Identities=22%  Similarity=0.270  Sum_probs=48.8

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC-CCHHHHHHHHHHHHHHHHH
Q ss_conf             4246899999997408974899967889999999999839997545278770-6978999999999999998
Q gi|254780434|r  270 FLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY-EGISLPKRIIQGLSDFLNK  340 (362)
Q Consensus       270 ~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~-~Gp~~~~~I~~~L~~~l~~  340 (362)
                      .|..+..++++++.+  ++|+++.|||.. +.+-+.+.+||+-|-|.||++- +.|...   .+.|.+.|.+
T Consensus       277 ~p~Gl~~l~~~~~~~--~iPvvAIGGI~~-~N~~~v~~aGa~gvAVisAI~~A~DP~~a---a~~ll~~l~~  342 (345)
T PRK02615        277 APAGLEYLKYARKEA--NIPWFAIGGIDK-SNISEVLQAGADRVAVVRAIMNAEDPKQA---TQELLEQLSR  342 (345)
T ss_pred             CCCCHHHHHHHHHHC--CCCEEEECCCCH-HHHHHHHHCCCCEEEEEHHHHCCCCHHHH---HHHHHHHHHC
T ss_conf             878999999999837--999999999699-99999998599999982285579999999---9999999730


No 204
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit; InterPro: IPR004651 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes. Proteins involved in steps 4 and 6 of the histidine biosynthesis pathway are contained in one family. These enzymes are called His6 and His7 in eukaryotes and HisA and HisF in prokaryotes. HisA is a phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (), involved in the fourth step of histidine biosynthesis. The bacterial HisF protein is a cyclase which catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate during the sixth step of histidine biosynthesis. The yeast His7 protein is a bifunctional protein which catalyzes an amido-transferase reaction that generates imidazole-glycerol phosphate and 5-aminoimidazol-4-carboxamide. The latter is the ribonucleotide used for purine biosynthesis. The enzyme also catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate, and is involved in the fifth and sixth steps in histidine biosynthesis.    This family describes the histidine biosynthesis protein, HisF. ; GO: 0000107 imidazoleglycerol-phosphate synthase activity, 0000105 histidine biosynthetic process, 0005737 cytoplasm, 0009382 imidazoleglycerol-phosphate synthase complex.
Probab=97.03  E-value=0.0039  Score=40.95  Aligned_cols=92  Identities=17%  Similarity=0.212  Sum_probs=71.4

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHH
Q ss_conf             88999998764498299980665553234577544632211356454246899999997408974899967889999999
Q gi|254780434|r  224 ELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDAL  303 (362)
Q Consensus       224 ~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~  303 (362)
                      +..++|+.=.+-|||=+|--|=|-+.+   .+ ..           +..-+.+|+++.+.+  -+|+-=.|||.+-+|+.
T Consensus        43 DPVeLA~~Y~~eGADELVFLDITAS~e---cP-l~-----------R~~m~~Vv~r~Ae~V--fiPlTVGGGI~~~eD~~  105 (312)
T TIGR00735        43 DPVELAQRYDEEGADELVFLDITASSE---CP-LG-----------RETMIDVVERTAEKV--FIPLTVGGGIKSIEDVK  105 (312)
T ss_pred             CHHHHHHHHHHCCCCEEEECCCCCCCC---CC-CC-----------CCCHHHHHHHHHHHC--CCCEEECCCCCCHHHCC
T ss_conf             823789998762895898514113666---78-88-----------801167888875214--52222168888432045


Q ss_pred             -----------HHHHCCCCEEEECHHHHCCCHHHHHHHHHH
Q ss_conf             -----------999839997545278770697899999999
Q gi|254780434|r  304 -----------DKIMAGANLIQLYSAMIYEGISLPKRIIQG  333 (362)
Q Consensus       304 -----------e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~  333 (362)
                                 .+|.||||=|-|-|+.++. |.++.+.-+-
T Consensus       106 GtkiPalevas~~L~aGADKvSiNTaAv~~-P~li~e~a~~  145 (312)
T TIGR00735       106 GTKIPALEVASKLLRAGADKVSINTAAVKN-PELISEAADR  145 (312)
T ss_pred             CCCCCHHHHHHHHHHCCCCEEEECCHHHHC-CHHHHHHHHC
T ss_conf             644427899999985489846328467508-4478998732


No 205
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed
Probab=97.02  E-value=0.034  Score=34.63  Aligned_cols=200  Identities=18%  Similarity=0.227  Sum_probs=100.7

Q ss_pred             CCCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHC
Q ss_conf             59974853468886779888740367524102001368789988626884255541000024777778899987641000
Q gi|254780434|r   54 LSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPT  133 (362)
Q Consensus        54 ~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~  133 (362)
                      +++|+.+|.=++..-+.++....+|---                 .++.+  +--+     |.+.|.+ +++.|++.  +
T Consensus         1 mk~~livAlD~~~~~~~~~l~~~l~~~i-----------------~~~Ki--g~~l-----~~~~G~~-~i~~l~~~--g   53 (231)
T PRK00230          1 MDDRLIVALDFPSKEEALAFLDQLDPAV-----------------LFVKV--GMEL-----FTAGGPQ-FVRELKQR--G   53 (231)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHCCCC-----------------CEEEE--CHHH-----HHHCCHH-HHHHHHHC--C
T ss_conf             9998899964899999999999717755-----------------29998--9899-----8641899-99999977--9


Q ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHHHCC-CCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             12100011045424678877655542067-55269830333653221100002343211112244455655312688517
Q gi|254780434|r  134 SPIGINLGANKDSKDFILDYVSGIRLFFT-IASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPI  212 (362)
Q Consensus       134 ~pi~vsI~~~~~s~~~~~dy~~~~~~~~~-~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi  212 (362)
                      .+++.-. +..+-++.+..   .++.+.. .+|++.+..++-          .+-+.    +..+....    .....-+
T Consensus        54 ~~iFlDl-Kl~DIpnTv~~---~~~~i~~~g~d~vtvH~~~G----------~~~l~----a~~~~~~~----~~~~~kl  111 (231)
T PRK00230         54 FKVFLDL-KLHDIPNTVAK---AVRAAAKLGVDMVTVHASGG----------ARMMA----AAREGLEP----GGSRPLL  111 (231)
T ss_pred             CCEEEEE-ECCCCCHHHHH---HHHHHHHCCCCEEEEECCCC----------HHHHH----HHHHHHHH----CCCCCEE
T ss_conf             9689872-02265458999---99999857998999825785----------99999----99998871----4898759


Q ss_pred             E-E-ECCC------------CCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             8-6-5057------------777488899999876449829998066555323457754463221135645424689999
Q gi|254780434|r  213 F-L-KISP------------DLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALA  278 (362)
Q Consensus       213 ~-v-KLsP------------d~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~  278 (362)
                      + | -|+.            +...+.+..+++.+.++|+||++++-                              .-+.
T Consensus       112 l~Vt~LTS~~~~~l~~~~~~~~~~~~v~~~a~~a~~~g~dGiVcs~------------------------------~e~~  161 (231)
T PRK00230        112 IAVTVLTSMDEEDLAELGINLSLEEQVLRLAKLAQEAGLDGVVCSA------------------------------QEAA  161 (231)
T ss_pred             EEEEEECCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCEEECCH------------------------------HHHH
T ss_conf             9999623689889986675789999999999999996998486388------------------------------8999


Q ss_pred             HHHHHCCCCEEEEEECCCC-------------CHHHHHHHHHCCCCEEEECHHHHC-CCH-HHHHHHHHHHHH
Q ss_conf             9997408974899967889-------------999999999839997545278770-697-899999999999
Q gi|254780434|r  279 KIRQRVGPKIAIIGTGGIS-------------STKDALDKIMAGANLIQLYSAMIY-EGI-SLPKRIIQGLSD  336 (362)
Q Consensus       279 ~i~~~~~~~i~IIg~GGI~-------------s~~Da~e~l~aGAs~VQi~Tali~-~Gp-~~~~~I~~~L~~  336 (362)
                      .+|+.+++++-++ +-||.             |+++|   +.+|||.+-|+.+..- +.| ..+++|.+++..
T Consensus       162 ~ir~~~~~~~~iv-TPGIr~~~~~~~DQ~rv~TP~~A---i~~GAD~iVVGR~I~~s~dP~~a~~~I~~ei~~  230 (231)
T PRK00230        162 ALREATGPDFLLV-TPGIRPAGSDAGDQKRVMTPAQA---IAAGSDYIVVGRPITQAEDPAAALEAILAELAG  230 (231)
T ss_pred             HHHHHCCCCCEEE-CCCCCCCCCCCCCCCCCCCHHHH---HHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             9986459871898-67727788875674656899999---987999999898456899999999999999855


No 206
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]
Probab=97.02  E-value=0.0099  Score=38.21  Aligned_cols=192  Identities=20%  Similarity=0.261  Sum_probs=86.7

Q ss_pred             CCCC--HHHHHHHHHCCCC-EEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHH-HHCCCCCCE
Q ss_conf             8886--7798887403675-24102001368789988626884255541000024777778899987641-000121000
Q gi|254780434|r   64 YDKN--AEVPIELLKLGFG-FVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKI-QPTSPIGIN  139 (362)
Q Consensus        64 ~dk~--~~~~~~l~~~G~G-~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~-~~~~pi~vs  139 (362)
                      .|..  .+.++.+.+.|.- .++.|| |-+-      |.   +            .-+....+.+...+. ....|+++.
T Consensus        22 vD~~a~~~lv~~li~~Gv~gi~~~Gt-tGE~------~~---L------------s~eEr~~v~~~~v~~~~grvpviaG   79 (299)
T COG0329          22 VDEEALRRLVEFLIAAGVDGLVVLGT-TGES------PT---L------------TLEERKEVLEAVVEAVGGRVPVIAG   79 (299)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCC-CCCC------HH---C------------CHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             39999999999999849988997986-6572------21---6------------9999999999999996897778986


Q ss_pred             EECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC-
Q ss_conf             1104542467887765554206755269830333653221100002343211112244455655312688517865057-
Q gi|254780434|r  140 LGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISP-  218 (362)
Q Consensus       140 I~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsP-  218 (362)
                      ++.|. +.+++ ++.+.+++++  +|++-+   -|..-..   -..+++.....++.+.         ..+|+++==-| 
T Consensus        80 ~g~~~-t~eai-~lak~a~~~G--ad~il~---v~PyY~k---~~~~gl~~hf~~ia~a---------~~lPvilYN~P~  140 (299)
T COG0329          80 VGSNS-TAEAI-ELAKHAEKLG--ADGILV---VPPYYNK---PSQEGLYAHFKAIAEA---------VDLPVILYNIPS  140 (299)
T ss_pred             CCCCC-HHHHH-HHHHHHHHCC--CCEEEE---ECCCCCC---CCHHHHHHHHHHHHHH---------CCCCEEEEECCC
T ss_conf             28777-99999-9999999709--999998---4897889---8979999999999985---------189989997875


Q ss_pred             ----CCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC-CEEEEEE
Q ss_conf             ----77748889999987644982999806655532345775446322113564542468999999974089-7489996
Q gi|254780434|r  219 ----DLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGP-KIAIIGT  293 (362)
Q Consensus       219 ----d~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~-~i~IIg~  293 (362)
                          |++.+.+..+++   --.+-||=-  +               .    |      .+..+..++...+. ++ ++.+
T Consensus       141 ~tg~~l~~e~i~~la~---~~nivgiKd--~---------------~----g------d~~~~~~~~~~~~~~~f-~v~~  189 (299)
T COG0329         141 RTGVDLSPETIARLAE---HPNIVGVKD--S---------------S----G------DLDRLEEIIAALGDRDF-IVLS  189 (299)
T ss_pred             CCCCCCCHHHHHHHHC---CCCEEEEEE--C---------------C----C------CHHHHHHHHHHCCCCCE-EEEE
T ss_conf             2489999999999827---898899984--7---------------8----8------99999999986487662-8982


Q ss_pred             CCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHH
Q ss_conf             788999999999983999754527877069789999999
Q gi|254780434|r  294 GGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQ  332 (362)
Q Consensus       294 GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~  332 (362)
                      |   ..+.++..+.+||+-+-..++-+.  |....++.+
T Consensus       190 G---~d~~~~~~~~~G~~G~is~~~N~~--p~~~~~l~~  223 (299)
T COG0329         190 G---DDELALPALLLGADGVISVTANVA--PELAVELYR  223 (299)
T ss_pred             C---CHHHHHHHHHCCCCEEEECCCHHC--HHHHHHHHH
T ss_conf             6---658888998677985884100127--999999999


No 207
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional
Probab=97.01  E-value=0.012  Score=37.70  Aligned_cols=95  Identities=14%  Similarity=0.159  Sum_probs=62.9

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHH
Q ss_conf             99999876449829998066555323457754463221135645424689999999740897489996788999999999
Q gi|254780434|r  226 DDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDK  305 (362)
Q Consensus       226 ~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~  305 (362)
                      .+.+..+.+.|+|=|... ..      ... .+        +.-.+..+..+++.++..  ++|+++.|||. .+.+.+.
T Consensus       121 ~~~A~~A~e~GADYv~fG-~~------~~~-~k--------~~a~~~~l~~l~~~~~~~--~iP~VAIGGIt-~~n~~~v  181 (221)
T PRK06512        121 RHGAMEVGELQPDYLFFG-KL------GAD-NK--------PEAHPRNLSLAEWWAEMI--EIPCIVQAGSD-LASIVEV  181 (221)
T ss_pred             HHHHHHHHHCCCCEEEEC-CC------CCC-CC--------CCCCCCCHHHHHHHHHCC--CCCEEEECCCC-HHHHHHH
T ss_conf             999999997399857657-87------888-89--------988754258999999747--99989982789-9999999


Q ss_pred             HHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             983999754527877069789999999999999983
Q gi|254780434|r  306 IMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKE  341 (362)
Q Consensus       306 l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~  341 (362)
                      +.+|||.|-+.|+++ ..+. ...-.++|.++|++.
T Consensus       182 ~~aGad~vAVisaI~-~a~D-p~~A~~~l~~llde~  215 (221)
T PRK06512        182 AETGAEFVALGRAVF-DAHD-PPLAVAEANALLDEK  215 (221)
T ss_pred             HHHCCCEEEEHHHHH-CCCC-HHHHHHHHHHHHHCC
T ss_conf             981998998859960-8999-999999999987332


No 208
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed
Probab=97.00  E-value=0.01  Score=38.09  Aligned_cols=193  Identities=16%  Similarity=0.210  Sum_probs=106.1

Q ss_pred             EECCEECCCCEE--ECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHH
Q ss_conf             888733599748--534688867798887403675241020013687899886268842555410000247777788999
Q gi|254780434|r   48 KVAGISLSNPLG--MAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFS  125 (362)
Q Consensus        48 ~~~Gl~~~nPig--lAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~  125 (362)
                      =++-++-++|-.  +...+|. .+..+.+.+.|+.++.+=|   +       |++|.                |.-..++
T Consensus        52 iIAEiKraSPS~G~i~~~~dp-~~~A~~Y~~~GA~aiSVLT---e-------~~~F~----------------Gs~~~L~  104 (261)
T PRK00278         52 VIAEVKKASPSKGVIREDFDP-VEIAKAYEEGGAACLSVLT---D-------ERFFQ----------------GSFEYLR  104 (261)
T ss_pred             EEEEECCCCCCCCCCCCCCCH-HHHHHHHHHCCCCEEEEEE---C-------CCCCC----------------CCHHHHH
T ss_conf             995545789999986887999-9999999977996899951---3-------03248----------------8799999


Q ss_pred             HHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             87641000121000110454246788776555420675526983033365322110000234321111224445565531
Q gi|254780434|r  126 RLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIK  205 (362)
Q Consensus       126 ~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~  205 (362)
                      ..++. .+.|+--        .|.+.|-.+..+...-+||++=|=.++         -+++.+.+++......       
T Consensus       105 ~vr~~-~~lPiLr--------KDFIid~~QI~ea~~~GADaiLLI~~~---------L~~~~l~~l~~~a~~l-------  159 (261)
T PRK00278        105 AARAA-VSLPVLR--------KDFIIDPYQIYEARAAGADAILLIVAA---------LDDEQLKELLDLAHEL-------  159 (261)
T ss_pred             HHHHH-CCCCEEE--------EHEECCHHHHHHHHHCCCCCHHHHHHH---------CCHHHHHHHHHHHHHH-------
T ss_conf             99986-6998772--------010176999999998189857898875---------5899999999999982-------


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             26885178650577774888999998764498299980665553234577544632211356454246899999997408
Q gi|254780434|r  206 TGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVG  285 (362)
Q Consensus       206 ~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~  285 (362)
                         ..-++|-+.   +.   .+ ++.+.+.+++ ++.+|.   |+ +.+               +...+..-.++...++
T Consensus       160 ---gl~~LvEvh---~~---~E-l~~a~~~~a~-iIGINn---Rn-L~t---------------~~vd~~~~~~L~~~ip  209 (261)
T PRK00278        160 ---GLDVLVEVH---DE---EE-LERALKLGAP-LIGINN---RN-LKT---------------FEVDLDTTERLAPLIP  209 (261)
T ss_pred             ---CCEEEEEEC---CH---HH-HHHHHHCCCC-EEEEEC---CC-CHH---------------CEECHHHHHHHHHHCC
T ss_conf             ---990797768---99---99-9999847998-898746---77-112---------------0037899999996489


Q ss_pred             CCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCC
Q ss_conf             9748999678899999999998399975452787706
Q gi|254780434|r  286 PKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYE  322 (362)
Q Consensus       286 ~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~  322 (362)
                      .+..+|+-.||.+.+|+..+..+|+++|-|++++|-.
T Consensus       210 ~~~~~VsESGI~~~~d~~~l~~~G~davLIGeslm~~  246 (261)
T PRK00278        210 KDRLLVSESGIFTPEDLKRLAKAGADAFLVGESLMRA  246 (261)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHCCCCEEEECHHHHCC
T ss_conf             9988997999999999999997799999989787679


No 209
>cd04732 HisA HisA.  Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase catalyzes the fourth step in histidine biosynthesis, an isomerisation of the aminoaldose moiety of ProFAR to the aminoketose of PRFAR (N-(5'-phospho-D-1'-ribulosylformimino)-5-amino-1-(5''-phospho-ribosyl)-4-imidazolecarboxamide). In bacteria and archaea, ProFAR isomerase is encoded by the HisA gene.
Probab=96.97  E-value=0.012  Score=37.70  Aligned_cols=34  Identities=32%  Similarity=0.411  Sum_probs=19.6

Q ss_pred             CCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCC
Q ss_conf             99748534688867798887403675241020013
Q gi|254780434|r   55 SNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTP   89 (362)
Q Consensus        55 ~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~   89 (362)
                      .-|+-++.|. ++.+.++.+.++|+--++++|.+.
T Consensus        73 ~~pi~vGGGI-rs~~~~~~l~~~Ga~kvvi~s~~~  106 (234)
T cd04732          73 GIPVQVGGGI-RSLEDIERLLDLGVSRVIIGTAAV  106 (234)
T ss_pred             CCCEEECCCC-CCHHHHHHHHHCCCCEEEECCCHH
T ss_conf             9568973771-759999999864887189714011


No 210
>PRK06843 inositol-5-monophosphate dehydrogenase; Validated
Probab=96.97  E-value=0.012  Score=37.69  Aligned_cols=32  Identities=13%  Similarity=0.214  Sum_probs=20.1

Q ss_pred             HCCCH--HHHHHHHHHHHHHHHHCCCCCHHHHHC
Q ss_conf             70697--899999999999999838997789616
Q gi|254780434|r  320 IYEGI--SLPKRIIQGLSDFLNKENEVNFENIRG  351 (362)
Q Consensus       320 i~~Gp--~~~~~I~~~L~~~l~~~G~~si~e~iG  351 (362)
                      -|+|+  .++..+..+|+.-|.--|-+||+|+.-
T Consensus       347 p~~G~v~~~~~~l~gglrs~m~y~Ga~~i~el~~  380 (404)
T PRK06843        347 PYSGKLKDILTQLKGGLMSGMGYLGAATISDLKI  380 (404)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHH
T ss_conf             7888889999999989987062857775999974


No 211
>TIGR00674 dapA dihydrodipicolinate synthase; InterPro: IPR005263   Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants. The enzyme catalyses the condensation of L-aspartate-beta-semialdehyde and pyruvate to dihydropicolinic acid via a ping-pong mechanism in which pyruvate binds to the enzyme by forming a Schiff-base with a lysine residue . Three other proteins are structurally related to DHDPS and probably also act via a similar catalytic mechanism. These are Escherichia coli N-acetylneuraminate lyase (4.1.3.3 from EC, IPR005264 from INTERPRO) (gene nanA), which catalyzes the condensation of N-acetyl-D-mannosamine and pyruvate to form N-acetylneuraminate; Sinorhizobium meliloti protein mosA , which is involved in the biosynthesis of the rhizopine 3-O-methyl-scyllo-inosamine; and E. coli hypothetical protein yjhH. The sequences of DHDPS from different sources are well-conserved. The structure takes the form of a homotetramer, in which 2 monomers are related by an approximate 2-fold symmetry . Each monomer comprises 2 domains: an 8-fold alpha-/beta-barrel, and a C-terminal alpha-helical domain. The fold resembles that of N-acetylneuraminate lyase. The active site lysine is located in the barrel domain, and has access via 2 channels on the C-terminal side of the barrel.   This family represents a subclass of dihydrodipicolinate synthase. ; GO: 0008840 dihydrodipicolinate synthase activity, 0019877 diaminopimelate biosynthetic process.
Probab=96.92  E-value=0.009  Score=38.48  Aligned_cols=51  Identities=16%  Similarity=0.183  Sum_probs=37.9

Q ss_pred             HHHHHHHHHHHCC-CCEEEEEECCCCCHHHH--HHHHHCCCCEEEECHHHHCCCHHHHHHHH
Q ss_conf             6899999997408-97489996788999999--99998399975452787706978999999
Q gi|254780434|r  273 STIALAKIRQRVG-PKIAIIGTGGISSTKDA--LDKIMAGANLIQLYSAMIYEGISLPKRII  331 (362)
Q Consensus       273 al~~i~~i~~~~~-~~i~IIg~GGI~s~~Da--~e~l~aGAs~VQi~Tali~~Gp~~~~~I~  331 (362)
                      ++..+.++++..+ +++.|      .||+|+  .+++..||.=|=--++-+.  |..+++++
T Consensus       164 ~l~~~~~i~~~~p~~dF~v------lsGDD~l~l~~~~~Gg~GVISV~~N~~--P~~~~emv  217 (288)
T TIGR00674       164 NLERISEIKAITPDDDFVV------LSGDDALTLPILALGGKGVISVTSNVA--PKLMKEMV  217 (288)
T ss_pred             CHHHHHHHHHHCCCCCEEE------EECCCCHHHHHHHHCCCEEEEHHHHHH--HHHHHHHH
T ss_conf             8899999998668985388------847861136999818961673005556--89999999


No 212
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional
Probab=96.92  E-value=0.01  Score=38.08  Aligned_cols=83  Identities=23%  Similarity=0.292  Sum_probs=59.8

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             88517865057777488899999876449829998066555323457754463221135645424689999999740897
Q gi|254780434|r  208 KFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPK  287 (362)
Q Consensus       208 ~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~  287 (362)
                      .++-+.+-++.   .++..+.++.+.++|+|-|++- |         ...      -|     ...+++++++++.+ ++
T Consensus       225 grL~VgAAVg~---~~~~~eRa~~Lv~aGvDvlvID-t---------AhG------hs-----~~v~~~ik~ik~~~-p~  279 (499)
T PTZ00314        225 KQLLVGAAIST---REEDKERAAALIDAGVDVLVLD-S---------SQG------NS-----IYQIDFIKWIKSTY-PH  279 (499)
T ss_pred             CCEEEEEEECC---CCCHHHHHHHHHHCCCCEEEEE-C---------CCC------CC-----HHHHHHHHHHHHHC-CC
T ss_conf             87899999478---8048999999998699899981-6---------887------72-----78999999988527-98


Q ss_pred             EEEEEECCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             48999678899999999998399975452
Q gi|254780434|r  288 IAIIGTGGISSTKDALDKIMAGANLIQLY  316 (362)
Q Consensus       288 i~IIg~GGI~s~~Da~e~l~aGAs~VQi~  316 (362)
                      ++|| +|.|.|++-+.+.+.||||.|-|+
T Consensus       280 v~vI-aGNVaT~~~a~~Li~aGAD~vkVG  307 (499)
T PTZ00314        280 LEVI-AGNVVTQDQAKNLIDAGADGIRIG  307 (499)
T ss_pred             CCEE-EEEECHHHHHHHHHHCCCCEEEEC
T ss_conf             8467-643310999999997499879975


No 213
>pfam00478 IMPDH IMP dehydrogenase / GMP reductase domain. This family is involved in biosynthesis of guanosine nucleotide. Members of this family contain a TIM barrel structure. In the inosine monophosphate dehydrogenases 2 CBS domains pfam00571 are inserted in the TIM barrel. This family is a member of the common phosphate binding site TIM barrel family.
Probab=96.90  E-value=0.012  Score=37.72  Aligned_cols=79  Identities=15%  Similarity=0.235  Sum_probs=56.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             78650577774888999998764498299980665553234577544632211356454246899999997408974899
Q gi|254780434|r  212 IFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAII  291 (362)
Q Consensus       212 i~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~II  291 (362)
                      +.+-+++   .++..+.++.+.++|+|-|++ .|         ...      .|     ...++.|+++++.++ +++||
T Consensus       214 VgAAVG~---~~~~~eRa~~Lv~aGvDvivI-Dt---------AhG------hs-----~~vi~~ik~ik~~~p-~~~iI  268 (467)
T pfam00478       214 VGAAVGT---RDDDLERAEALVEAGVDVIVI-DS---------AHG------HS-----EYVLEMIKWIKKKYP-DLDVI  268 (467)
T ss_pred             EEEEECC---CHHHHHHHHHHHHCCCCEEEE-EC---------CCC------CC-----HHHHHHHHHHHHCCC-CCCEE
T ss_conf             9998067---865999999998769988997-34---------454------41-----889999999874078-77378


Q ss_pred             EECCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             9678899999999998399975452
Q gi|254780434|r  292 GTGGISSTKDALDKIMAGANLIQLY  316 (362)
Q Consensus       292 g~GGI~s~~Da~e~l~aGAs~VQi~  316 (362)
                       .|.|-|++.+.+.+.||||.|-|+
T Consensus       269 -aGNVaT~e~a~~Li~aGAD~vKVG  292 (467)
T pfam00478       269 -AGNVVTAEAARELIDAGADAVKVG  292 (467)
T ss_pred             -EEEECCHHHHHHHHHHCCCEEEEC
T ss_conf             -510058999999997077757755


No 214
>PRK08883 ribulose-phosphate 3-epimerase; Provisional
Probab=96.89  E-value=0.043  Score=33.88  Aligned_cols=210  Identities=21%  Similarity=0.303  Sum_probs=123.1

Q ss_pred             CEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             74853468886779888740367524102001368789988626884255541000024777778899987641000121
Q gi|254780434|r   57 PLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPI  136 (362)
Q Consensus        57 PiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi  136 (362)
                      |=+++|-+.+-.+.++++.+.|+.++-+                  ..-|+-.+..++|   |. .+++.+++...+.|+
T Consensus         4 pSil~ad~~~L~~ei~~l~~~g~d~lHi------------------DIMDG~FVPNitf---g~-~~v~~ir~~~t~~~~   61 (220)
T PRK08883          4 PSILSADFARLGEDVEKVLAAGADVVHF------------------DVMDNHYVPNLTF---GA-PICKALRDYGITAPI   61 (220)
T ss_pred             HHHHHCCHHHHHHHHHHHHHCCCCEEEE------------------ECCCCCCCCCCCC---CH-HHHHHHHHHCCCCCE
T ss_conf             7764329999999999999769998998------------------1778985886566---98-999999965899875


Q ss_pred             CCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             00011045424678877655542067552698303336532211000023432111122444556553126885178650
Q gi|254780434|r  137 GINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKI  216 (362)
Q Consensus       137 ~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKL  216 (362)
                      =+-++.+. -+..+++|.      ..++|.+.+-+-+           .+...+.+..+++.        .  +-..+-|
T Consensus        62 DvHLMv~~-P~~~i~~~~------~aGad~I~~H~Ea-----------~~~~~~~i~~Ik~~--------g--~k~Glal  113 (220)
T PRK08883         62 DVHLMVKP-VDRIIPDFA------KAGASMITFHVEA-----------SEHVDRTLQLIKEH--------G--CQAGVVL  113 (220)
T ss_pred             EEEEEECC-HHHHHHHHH------HCCCCEEEECCCC-----------CCCHHHHHHHHHHC--------C--CCEEEEE
T ss_conf             78998338-888899999------7599889985776-----------54999999999985--------9--9668884


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC---CCCEEEEEE
Q ss_conf             57777488899999876449829998066555323457754463221135645424689999999740---897489996
Q gi|254780434|r  217 SPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRV---GPKIAIIGT  293 (362)
Q Consensus       217 sPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~---~~~i~IIg~  293 (362)
                      .|+.+.+.+..++..     +|.+.+- |           ..   -|.+|....|.++..|+++|+..   +.++.|---
T Consensus       114 nP~T~~~~l~~~l~~-----~D~VLvM-t-----------V~---PGf~GQ~f~~~~l~Ki~~l~~~~~~~~~~~~I~VD  173 (220)
T PRK08883        114 NPATPLAHLEYIMDK-----VDLILLM-S-----------VN---PGFGGQSFIPHTLDKLRAVRKMIDASGRDIRLEID  173 (220)
T ss_pred             CCCCCHHHHHHHHHH-----CCEEEEE-E-----------EC---CCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             799987999999974-----6979998-7-----------45---89887545577999999999988744998079998


Q ss_pred             CCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHH
Q ss_conf             7889999999999839997545278770697899999999999999
Q gi|254780434|r  294 GGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLN  339 (362)
Q Consensus       294 GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~  339 (362)
                      |||.. +-+-+...+|||.+=.+|+ +|+.+. .++..+.|++-+.
T Consensus       174 GGI~~-~ti~~l~~aGad~~V~GS~-iF~~~d-~~~~i~~lr~~~~  216 (220)
T PRK08883        174 GGVKV-DNIREIAEAGADMFVAGSA-IFGQPD-YKAVIDEMRAELA  216 (220)
T ss_pred             CCCCH-HHHHHHHHCCCCEEEECHH-HHCCCC-HHHHHHHHHHHHH
T ss_conf             98789-9999999879999996826-748999-9999999999999


No 215
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA). HBPHA catalyzes HBP to salicyaldehyde and pyruvate. This reaction is part of the degradative pathways for naphthalene and naphthalenesulfonates by bacteria. CBPHA is homologous to HBPHA and catalyzes the cleavage of CBP to 2-carboxylbenzaldehyde and pyruvate during the degradation of phenanthrene. They are member of the DHDPS family of Schiff-base-dependent class I aldolases.
Probab=96.89  E-value=0.016  Score=36.75  Aligned_cols=113  Identities=10%  Similarity=0.028  Sum_probs=52.8

Q ss_pred             CHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHH-HHHCCCCCCEEECCCC
Q ss_conf             677988874036752410200136878998862688425554100002477777889998764-1000121000110454
Q gi|254780434|r   67 NAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSK-IQPTSPIGINLGANKD  145 (362)
Q Consensus        67 ~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~-~~~~~pi~vsI~~~~~  145 (362)
                      -.+.++.+.+.|..++++-.-|-+-..                     |..+....+.+...+ .....|+++.++.+. 
T Consensus        31 l~~lv~~li~~Gv~gl~~~GttGE~~~---------------------Ls~~Er~~v~~~~~e~~~gr~pvi~G~~~~~-   88 (309)
T cd00952          31 TARLVERLIAAGVDGILTMGTFGECAT---------------------LTWEEKQAFVATVVETVAGRVPVFVGATTLN-   88 (309)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCHHHH---------------------CCHHHHHHHHHHHHHHHCCCCEEEECCCCCH-
T ss_conf             999999999769998997923500434---------------------8799999999999998389850996057505-


Q ss_pred             CHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC
Q ss_conf             2467887765554206755269830333653221100002343211112244455655312688517865057
Q gi|254780434|r  146 SKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISP  218 (362)
Q Consensus       146 s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsP  218 (362)
                      +.+.+ +..+.++++  +||++-+  .+|..-.    .+.+.+.....++.+.        ...+||++==-|
T Consensus        89 t~~ai-~~a~~a~~~--Gad~~lv--~~P~y~~----~~~~~l~~~~~~ia~a--------~~~lPiilYn~P  144 (309)
T cd00952          89 TRDTI-ARTRALLDL--GADGTML--GRPMWLP----LDVDTAVQFYRDVAEA--------VPEMAIAIYANP  144 (309)
T ss_pred             HHHHH-HHHHHHHHC--CCCEEEE--CCCCCCC----CCHHHHHHHHHHHHHH--------CCCCCEEEEECC
T ss_conf             99999-999999846--9899998--8885889----9999999999999986--------789988999686


No 216
>TIGR01163 rpe ribulose-phosphate 3-epimerase; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5.1.3.1 from EC) (also known as pentose-5-phosphate 3-epimerase or PPE) is the enzyme that converts D-ribulose 5-phosphate into D-xylulose 5-phosphate in Calvin's reductive pentose phosphate cycle. In Alcaligenes eutrophus two copies of the gene coding for PPE are known , one is chromosomally encoded P40117 from SWISSPROT, the other one is on a plasmid Q04539 from SWISSPROT. PPE has been found in a wide range of bacteria, archaebacteria, fungi and plants. All the proteins have from 209 to 241 amino acid residues. The enzyme has a TIM barrel structure.; GO: 0004750 ribulose-phosphate 3-epimerase activity, 0005975 carbohydrate metabolic process.
Probab=96.88  E-value=0.044  Score=33.85  Aligned_cols=200  Identities=19%  Similarity=0.288  Sum_probs=119.2

Q ss_pred             CEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCC--CCHHHHHHHHHHHHHCC
Q ss_conf             7485346888677988874036752410200136878998862688425554100002477--77788999876410001
Q gi|254780434|r   57 PLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNN--AGYHTVFSRLSKIQPTS  134 (362)
Q Consensus        57 PiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N--~G~~~~~~~l~~~~~~~  134 (362)
                      |=+|||=|-+=+|.+++..++|+-++=+==-     .|+             .+     ||  -|.. +++.|++...+.
T Consensus         4 PSILsADf~rLgee~~~v~~AGaD~iH~DVM-----DGH-------------FV-----PNlT~Gp~-v~~~~r~~g~~~   59 (216)
T TIGR01163         4 PSILSADFARLGEEVKAVEEAGADLIHVDVM-----DGH-------------FV-----PNLTFGPP-VLEALRKYGTKL   59 (216)
T ss_pred             CHHHHCCHHHHHHHHHHHHHCCCCEEEEEEC-----CCC-------------CC-----CCCCCCHH-HHHHHHHHCCCC
T ss_conf             1255504777999999999669978998624-----797-------------17-----71002778-999887407952


Q ss_pred             CCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             21000110454246788776555420675526983033365322110000234321111224445565531268851786
Q gi|254780434|r  135 PIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFL  214 (362)
Q Consensus       135 pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~v  214 (362)
                      |+=|=+|-..     .++|.+.+-+.  +||++.+=+           .+...+.++|+.+++.         .-+| .+
T Consensus        60 P~DVHLMv~~-----pd~~~~~Fa~a--GA~~I~vH~-----------Ea~~h~~R~l~~Ik~~---------G~~A-G~  111 (216)
T TIGR01163        60 PIDVHLMVEN-----PDRYIEDFAEA--GADIITVHA-----------EATEHIHRLLQLIKEL---------GAKA-GI  111 (216)
T ss_pred             CEEEEECCCC-----HHHHHHHHHHH--CCCEEEEEC-----------CCCCCHHHHHHHHHHC---------CCCE-EE
T ss_conf             1266303578-----57778899970--899899843-----------7762679999999971---------8970-68


Q ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC-----CCCEE
Q ss_conf             5057777488899999876449829998066555323457754463221135645424689999999740-----89748
Q gi|254780434|r  215 KISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRV-----GPKIA  289 (362)
Q Consensus       215 KLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~-----~~~i~  289 (362)
                      =+.|.++.+-+..+...     +|.|-+            ....++   .||.-=-|.+++-|+++|+..     +.++.
T Consensus       112 v~NP~TPl~~~~~~L~~-----~D~VLl------------MSVnPG---FgGQkFIP~~~~Kir~~R~~id~~~~~~~~~  171 (216)
T TIGR01163       112 VLNPATPLEALEYVLED-----VDLVLL------------MSVNPG---FGGQKFIPETLEKIRELRKMIDKLELGLSIL  171 (216)
T ss_pred             EECCCCCHHHHHHHHHH-----CCEEEE------------EEEECC---CCCCCCHHHHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             86799998789989876-----298998------------876079---9884110578999999999998602799558


Q ss_pred             EEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCH--HHHHHH
Q ss_conf             99967889999999999839997545278770697--899999
Q gi|254780434|r  290 IIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGI--SLPKRI  330 (362)
Q Consensus       290 IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp--~~~~~I  330 (362)
                      |===|||.. +-+.+--.||||.+=.+|+ +|+.+  ..-..|
T Consensus       172 ieVDGGv~~-~ni~~~~~AGAD~~VaGSa-iF~~~s~d~~~~i  212 (216)
T TIGR01163       172 IEVDGGVNE-DNIAEVAEAGADILVAGSA-IFGADSLDYKEAI  212 (216)
T ss_pred             EEECCCCCH-HHHHHHHHCCCCEEEEEEE-EECCCCCCHHHHH
T ss_conf             997179897-6799999758989998310-2088866879999


No 217
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism]
Probab=96.87  E-value=0.045  Score=33.77  Aligned_cols=207  Identities=19%  Similarity=0.256  Sum_probs=120.0

Q ss_pred             CCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             97485346888677988874036752410200136878998862688425554100002477777889998764100012
Q gi|254780434|r   56 NPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSP  135 (362)
Q Consensus        56 nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~p  135 (362)
                      .|=.+||-+.+-++.++++.+.|...+-+-                  .-|+-.++.+.|   |.+ +++.+++ ..+.|
T Consensus         7 apSILsaD~~~l~~el~~~~~agad~iH~D------------------VMDghFVPNiTf---Gp~-~v~~l~~-~t~~p   63 (220)
T COG0036           7 APSILSADFARLGEELKALEAAGADLIHID------------------VMDGHFVPNITF---GPP-VVKALRK-ITDLP   63 (220)
T ss_pred             EEEHHHCCHHHHHHHHHHHHHCCCCEEEEE------------------CCCCCCCCCCCC---CHH-HHHHHHH-CCCCC
T ss_conf             415642777679999999997699879996------------------457876787334---899-9998863-68973


Q ss_pred             CCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             10001104542467887765554206755269830333653221100002343211112244455655312688517865
Q gi|254780434|r  136 IGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLK  215 (362)
Q Consensus       136 i~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vK  215 (362)
                      +-|-++...     .++|.+.+-+.  +||++.+-.-           +...+.+.++.+++.          .+-..+-
T Consensus        64 ~DvHLMV~~-----p~~~i~~fa~a--gad~It~H~E-----------~~~~~~r~i~~Ik~~----------G~kaGv~  115 (220)
T COG0036          64 LDVHLMVEN-----PDRYIEAFAKA--GADIITFHAE-----------ATEHIHRTIQLIKEL----------GVKAGLV  115 (220)
T ss_pred             EEEEEECCC-----HHHHHHHHHHH--CCCEEEEEEC-----------CCCCHHHHHHHHHHC----------CCEEEEE
T ss_conf             589973289-----89999999981--9998999712-----------776899999999975----------9857799


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC--CEEEEEE
Q ss_conf             05777748889999987644982999806655532345775446322113564542468999999974089--7489996
Q gi|254780434|r  216 ISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGP--KIAIIGT  293 (362)
Q Consensus       216 LsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~--~i~IIg~  293 (362)
                      |-|..+.+.+..++..     +|-+.+            ....+   |.+|..-.|-++..|+++|+....  ++.|---
T Consensus       116 lnP~Tp~~~i~~~l~~-----vD~Vll------------MsVnP---GfgGQ~Fi~~~l~Ki~~lr~~~~~~~~~~IeVD  175 (220)
T COG0036         116 LNPATPLEALEPVLDD-----VDLVLL------------MSVNP---GFGGQKFIPEVLEKIRELRAMIDERLDILIEVD  175 (220)
T ss_pred             ECCCCCHHHHHHHHHH-----CCEEEE------------EEECC---CCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             7899977899989865-----789999------------85779---986631479999999999997402477599996


Q ss_pred             CCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHH
Q ss_conf             7889999999999839997545278770697899999999999
Q gi|254780434|r  294 GGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSD  336 (362)
Q Consensus       294 GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~  336 (362)
                      |||. .+-+-+...||||.+=.+|+ +|++.... .-.+.+..
T Consensus       176 GGI~-~~t~~~~~~AGad~~VaGSa-lF~~~d~~-~~i~~~~~  215 (220)
T COG0036         176 GGIN-LETIKQLAAAGADVFVAGSA-LFGADDYK-ATIRELRG  215 (220)
T ss_pred             CCCC-HHHHHHHHHCCCCEEEEEEE-EECCCCHH-HHHHHHHH
T ss_conf             8969-88899999739999999777-86781199-99999998


No 218
>pfam00701 DHDPS Dihydrodipicolinate synthetase family. This family has a TIM barrel structure.
Probab=96.82  E-value=0.018  Score=36.44  Aligned_cols=187  Identities=17%  Similarity=0.234  Sum_probs=91.2

Q ss_pred             HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHH-HHHHCCCCCCEEECCCCC
Q ss_conf             7798887403675241020013687899886268842555410000247777788999876-410001210001104542
Q gi|254780434|r   68 AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLS-KIQPTSPIGINLGANKDS  146 (362)
Q Consensus        68 ~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~-~~~~~~pi~vsI~~~~~s  146 (362)
                      ...++.+.+.|.-++++..-|-+-         +.+            .......+++... ....+.||++.++.+. +
T Consensus        25 ~~~i~~l~~~Gv~gi~v~GstGE~---------~~L------------s~~Er~~v~~~~~~~~~~~~pvi~gv~~~s-t   82 (289)
T pfam00701        25 RKLIEFLINKGADGLFVGGTTGES---------FTL------------STEEHEQLIEITVDEAKGRIPVIAGTGSNS-T   82 (289)
T ss_pred             HHHHHHHHHCCCCEEEECEECCCC---------CCC------------CHHHHHHHHHHHHHHCCCCCEEEECCCCCC-H
T ss_conf             999999997799999978364031---------138------------899999999999998199862863788878-9


Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCC-----C
Q ss_conf             46788776555420675526983033365322110000234321111224445565531268851786505777-----7
Q gi|254780434|r  147 KDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDL-----S  221 (362)
Q Consensus       147 ~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~-----~  221 (362)
                      .+. .++.+.++++  ++|++-+  ..|....    .+.+.+.+....+.+         .+.+||++=--|..     +
T Consensus        83 ~~~-i~~a~~A~~~--Gad~i~v--~pP~y~~----~~~~~i~~~~~~va~---------a~~lPi~iYn~P~~tg~~l~  144 (289)
T pfam00701        83 REA-IHLAQLAEAA--GADGVLA--VTPYYNK----PSQEGLYQHFKAIAA---------ATDLPVILYNVPSRTGQDLT  144 (289)
T ss_pred             HHH-HHHHHHHHHC--CCCEEEE--CCCCCCC----CCHHHHHHHHHHHHH---------CCCCCEEEEECCCCCCCCCC
T ss_conf             999-9999999974--9997887--7998889----999999999999983---------15997799715654033679


Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEC-CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHH
Q ss_conf             48889999987644982999806-65553234577544632211356454246899999997408974899967889999
Q gi|254780434|r  222 EEELDDIAVEVLSHKVEGIIVSN-TTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTK  300 (362)
Q Consensus       222 ~~~i~~ia~~a~~~g~dGiv~~N-T~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~  300 (362)
                      .+.+.+++    +  ...|+.+- ++                   |      ....+.++++..++++.+.. |   ...
T Consensus       145 ~~~l~~L~----~--~~~i~giK~ss-------------------~------~~~~~~~~~~~~~~~~~v~~-G---~d~  189 (289)
T pfam00701       145 PETIERLA----E--CPNVVGVKDAV-------------------G------DLERMENIRKRAGPDFTILS-G---DDE  189 (289)
T ss_pred             HHHHHHHH----C--CCCEEEEEECC-------------------C------CHHHHHHHHHHCCCCCEEEC-C---CHH
T ss_conf             99999982----6--89989999699-------------------8------99999999996699824506-9---489


Q ss_pred             HHHHHHHCCCCEEEECHHHHCCCHHHHHHHH
Q ss_conf             9999998399975452787706978999999
Q gi|254780434|r  301 DALDKIMAGANLIQLYSAMIYEGISLPKRII  331 (362)
Q Consensus       301 Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~  331 (362)
                      -.++.+.+||+-...+++.++  |..+.+|.
T Consensus       190 ~~~~~l~~Ga~G~i~~~~n~~--P~~~~~i~  218 (289)
T pfam00701       190 TALSYLSLGADGVISVTSNIA--PKLMRDIY  218 (289)
T ss_pred             HHHHHHHCCCCEEEEEHHHHC--HHHHHHHH
T ss_conf             999998668987998415405--99999999


No 219
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase; InterPro: IPR010946   This entry represents geranylgeranylglyceryl phosphate synthase which catalyses the first committed step in the synthesis of ether-linked membrane lipids in archaea ..
Probab=96.79  E-value=0.0027  Score=42.05  Aligned_cols=47  Identities=32%  Similarity=0.508  Sum_probs=41.9

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEE
Q ss_conf             3564542468999999974089748999678899999999998399975
Q gi|254780434|r  265 SGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLI  313 (362)
Q Consensus       265 SG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~V  313 (362)
                      ||.+ +|+..++|+.+|+.. .+++||-.|||.++|=|.+..+||||.+
T Consensus       163 SGAs-~Pv~~e~i~~~k~~~-~~I~LIVGGGIr~~EiA~~~v~aGAd~I  209 (212)
T TIGR01769       163 SGAS-EPVSPETISLVKKKI-SSIPLIVGGGIRSPEIALKIVLAGADVI  209 (212)
T ss_pred             CCCC-CCCCHHHHHHHHHHC-CCCCEEECCCCCCHHHHHHHHHHCCCEE
T ss_conf             7866-678667999999854-8972775277588899999997089826


No 220
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional
Probab=96.78  E-value=0.02  Score=36.18  Aligned_cols=176  Identities=15%  Similarity=0.156  Sum_probs=80.5

Q ss_pred             HHHHHHHHHCCCCEE-ECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHH-HHHHHCCCCCCEEECCCC
Q ss_conf             779888740367524-102001368789988626884255541000024777778899987-641000121000110454
Q gi|254780434|r   68 AEVPIELLKLGFGFV-EIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRL-SKIQPTSPIGINLGANKD  145 (362)
Q Consensus        68 ~~~~~~l~~~G~G~v-~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l-~~~~~~~pi~vsI~~~~~  145 (362)
                      .+.++.+.+.|.-++ +.|| |-+-.      -   +            .-.....+++.. +......||++.++.  +
T Consensus        25 ~~~v~~li~~Gv~gi~v~Gs-tGE~~------~---L------------s~eEr~~v~~~~v~~~~grvpvi~gvg~--~   80 (296)
T PRK03620         25 REHLEWLAPYGAAALFAAGG-TGEFF------S---L------------TPDEYSQVVRAAVEACAGRVPVIAGAGG--G   80 (296)
T ss_pred             HHHHHHHHHCCCCEEEECCC-CCCHH------H---C------------CHHHHHHHHHHHHHHHCCCCEEEECCCC--C
T ss_conf             99999999779998996842-31343------4---8------------9999999999999983897359825775--3


Q ss_pred             CHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCC--CCHH
Q ss_conf             24678877655542067552698303336532211000023432111122444556553126885178650577--7748
Q gi|254780434|r  146 SKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPD--LSEE  223 (362)
Q Consensus       146 s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd--~~~~  223 (362)
                      +.+.+ ++.+.+++++  ||++-+  ..|-...    .+.+.+.+....+.+         ...+||++==.|.  ++.+
T Consensus        81 t~~ai-~la~~A~~~G--adai~v--~pPyy~~----~~~~~l~~~~~~ia~---------a~~lPi~lYn~~~~~~~~~  142 (296)
T PRK03620         81 TAQAI-EYAQAAERAG--ADGILL--LPPYLTE----APQEGLAAHVEAVCK---------STDLGVIVYNRDNAVLTAD  142 (296)
T ss_pred             HHHHH-HHHHHHHHCC--CCEEEE--CCCCCCC----CCHHHHHHHHHHHHH---------HCCCCEEEECCCCCCCCHH
T ss_conf             79999-9999999829--998996--6986789----999999999999998---------3189977517888776999


Q ss_pred             HHHHHHHHHHHC-CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCH-HH
Q ss_conf             889999987644-9829998066555323457754463221135645424689999999740897489996788999-99
Q gi|254780434|r  224 ELDDIAVEVLSH-KVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISST-KD  301 (362)
Q Consensus       224 ~i~~ia~~a~~~-g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~-~D  301 (362)
                      .+.++++   +. ++-||==  +                   ||      .+..+.++.+..++++.++  +|..+. ..
T Consensus       143 ~l~~L~~---~~pnivgiKd--s-------------------s~------d~~~~~~~~~~~~~~~~v~--~G~~~~~~~  190 (296)
T PRK03620        143 TLARLAE---RCPNLIGFKD--G-------------------VG------DIELMVRITRALGDRLLYL--GGLPTAEVF  190 (296)
T ss_pred             HHHHHHH---HCCCEEEEEE--C-------------------CC------CHHHHHHHHHHCCCCEEEE--ECCCHHHHH
T ss_conf             9999997---2898899995--8-------------------68------8999999999769975998--289644788


Q ss_pred             HHHHHHCCCCEEEECH
Q ss_conf             9999983999754527
Q gi|254780434|r  302 ALDKIMAGANLIQLYS  317 (362)
Q Consensus       302 a~e~l~aGAs~VQi~T  317 (362)
                      +..++..||+..-.++
T Consensus       191 ~~~~~~~G~~g~~s~~  206 (296)
T PRK03620        191 AAAYLALGVPTYSSAV  206 (296)
T ss_pred             HHHHHCCCCCEEEECC
T ss_conf             8899628885784030


No 221
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases. The enzyme is involved in glucarate metabolism, and its mechanism presumbly involves a Schiff-base intermediate similar to members of DHDPS family. While in the case of Pseudomonas sp. 5-dehydro-4-deoxy-D-glucarate is degraded by KDGDH to 2,5-dioxopentanoate, in certain species of Enterobacteriaceae it is degraded instead to pyruvate and glycerate.
Probab=96.77  E-value=0.019  Score=36.36  Aligned_cols=179  Identities=15%  Similarity=0.124  Sum_probs=80.2

Q ss_pred             HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHH-HHHHHCCCCCCEEECCCCC
Q ss_conf             779888740367524102001368789988626884255541000024777778899987-6410001210001104542
Q gi|254780434|r   68 AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRL-SKIQPTSPIGINLGANKDS  146 (362)
Q Consensus        68 ~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l-~~~~~~~pi~vsI~~~~~s  146 (362)
                      .+.++.+.+.|.-++.+...|-+-.         .+.            -.....+.+.. +......|+++.++.  ++
T Consensus        24 ~~~i~~l~~~Gv~gi~v~GstGE~~---------~Ls------------~eEr~~v~~~~~~~~~g~~~vi~g~g~--~t   80 (289)
T cd00951          24 RAHVEWLLSYGAAALFAAGGTGEFF---------SLT------------PDEYAQVVRAAVEETAGRVPVLAGAGY--GT   80 (289)
T ss_pred             HHHHHHHHHCCCCEEEECCHHHCCC---------CCC------------HHHHHHHHHHHHHHCCCCCEEEECCCC--HH
T ss_conf             9999999977999999793300621---------289------------999999999999981898517406763--19


Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC--CCCHHH
Q ss_conf             467887765554206755269830333653221100002343211112244455655312688517865057--777488
Q gi|254780434|r  147 KDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISP--DLSEEE  224 (362)
Q Consensus       147 ~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsP--d~~~~~  224 (362)
                      .+. .++.+.+++.  ++|++-+  ..|-...    .+.+.+.+...++.+         ...+||++==.|  +++.+.
T Consensus        81 ~~~-i~la~~a~~~--Gadav~v--~pPy~~~----~~~~~l~~~~~~ia~---------a~~lpi~lYn~~~~~~~~~~  142 (289)
T cd00951          81 ATA-IAYAQAAEKA--GADGILL--LPPYLTE----APQEGLYAHVEAVCK---------STDLGVIVYNRANAVLTADS  142 (289)
T ss_pred             HHH-HHHHHHHHHC--CCCEEEE--CCCCCCC----CCHHHHHHHHHHHHH---------HCCCCEEECCCCCCCCCHHH
T ss_conf             999-9999999975--9999997--6988889----999999999999998---------46998661488776778999


Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHH-HH
Q ss_conf             89999987644982999806655532345775446322113564542468999999974089748999678899999-99
Q gi|254780434|r  225 LDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKD-AL  303 (362)
Q Consensus       225 i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~D-a~  303 (362)
                      +.++++..  -++.||=-  +                   ||      .+..+.++.+..++++.+  .+|..+.+. +.
T Consensus       143 l~~L~~~~--p~i~giK~--s-------------------~~------d~~~~~~~~~~~~~~~~~--~~g~~~~~~~~~  191 (289)
T cd00951         143 LARLAERC--PNLVGFKD--G-------------------VG------DIELMRRIVAKLGDRLLY--LGGLPTAEVFAL  191 (289)
T ss_pred             HHHHHHHC--CCEEEEEE--C-------------------CC------CHHHHHHHHHHCCCCCEE--EECCCCCHHHHH
T ss_conf             99999836--87899997--8-------------------88------999999999975998289--858983379999


Q ss_pred             HHHHCCCCEEEECHH
Q ss_conf             999839997545278
Q gi|254780434|r  304 DKIMAGANLIQLYSA  318 (362)
Q Consensus       304 e~l~aGAs~VQi~Ta  318 (362)
                      .++.+||+..-.+++
T Consensus       192 ~~~~~G~~g~~~~~~  206 (289)
T cd00951         192 AYLAMGVPTYSSAVF  206 (289)
T ss_pred             HHHCCCCEEEEHHHH
T ss_conf             998499849826755


No 222
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional
Probab=96.77  E-value=0.053  Score=33.28  Aligned_cols=48  Identities=13%  Similarity=0.131  Sum_probs=26.7

Q ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCC
Q ss_conf             8999999974089748999678899999999998399975452787706
Q gi|254780434|r  274 TIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYE  322 (362)
Q Consensus       274 l~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~  322 (362)
                      +..-.++...++.+..+|+=-||.|.+|+..+ ..+|+++-|++++|.+
T Consensus       198 l~~t~~l~~~ip~~~~~vsESGI~~~~dv~~l-~~~~~~~LvGe~lmr~  245 (459)
T PRK09427        198 LNRTRELAPLIPADVTVISESGIYTHAQVREL-SPFVNGFLIGSSLMAE  245 (459)
T ss_pred             HHHHHHHHHHCCCCCEEEECCCCCCHHHHHHH-HHHCCEEEECHHHHCC
T ss_conf             79999999768999749973799999999999-8439999978587579


No 223
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=96.75  E-value=0.025  Score=35.52  Aligned_cols=44  Identities=23%  Similarity=0.098  Sum_probs=33.0

Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHH
Q ss_conf             9999999740897489996788999999999983999754527877
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMI  320 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali  320 (362)
                      ..++.++.-+ ++++++.+|||.- +.+.+|+.+++-++-.+|.++
T Consensus       144 ~~lkal~~p~-p~~~~~ptGGV~~-~N~~~yl~~~~v~~vgGs~l~  187 (212)
T PRK06015        144 AFLKALSSPL-AGTFFCPTGGISL-KNARDYLSLPNVVCVGGSWVA  187 (212)
T ss_pred             HHHHHHHCCC-CCCCEEECCCCCH-HHHHHHHCCCCEEEEECHHHC
T ss_conf             9999985779-9998886289898-889999808981999883538


No 224
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-dehydro-4-deoxyglucarate dehydratase not only catalyzes the dehydration of the substrate (diol to ketone + water), but causes the decarboxylation of the intermediate product to yield 2-oxoglutarate semialdehyde (2,5-dioxopentanoate). The gene for the enzyme is usually observed in the vicinity of transporters and dehydratases handling D-galactarate and D-gluconate as well as aldehyde dehydrogenases which convert the product to alpha-ketoglutarate.
Probab=96.72  E-value=0.018  Score=36.53  Aligned_cols=190  Identities=16%  Similarity=0.142  Sum_probs=88.3

Q ss_pred             HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHH-HHHHCCCCCCEEECCCCC
Q ss_conf             7798887403675241020013687899886268842555410000247777788999876-410001210001104542
Q gi|254780434|r   68 AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLS-KIQPTSPIGINLGANKDS  146 (362)
Q Consensus        68 ~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~-~~~~~~pi~vsI~~~~~s  146 (362)
                      .+.++.+.+.|.-++.+..-|-+-..         +            .-.....+.+... ......||++.++.  ++
T Consensus        29 ~~~i~~l~~~Gv~gi~v~GstGE~~~---------L------------s~eEr~~l~~~~~~~~~g~~~vi~gvg~--~t   85 (296)
T TIGR03249        29 RENIEWLLGYGLEALFAAGGTGEFFS---------L------------TPAEYEQVVEIAVSTAKGKVPVYTGVGG--NT   85 (296)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCHHH---------C------------CHHHHHHHHHHHHHHCCCCCEEECCCCH--HH
T ss_conf             99999999779998997830516665---------8------------9999999999999983898415127861--29


Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC--CCCHHH
Q ss_conf             467887765554206755269830333653221100002343211112244455655312688517865057--777488
Q gi|254780434|r  147 KDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISP--DLSEEE  224 (362)
Q Consensus       147 ~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsP--d~~~~~  224 (362)
                      .+++ ++.+-++++  ++|++-+  .+|-...    .+.+.+.+....+.+         ...+||++==-|  +++.+.
T Consensus        86 ~~ai-~la~~a~~~--Gad~v~v--~pPyy~~----~~~~~l~~~f~~ia~---------a~~~pi~lYn~~~~~~~~~~  147 (296)
T TIGR03249        86 SDAI-EIARLAEKA--GADGYLL--LPPYLIN----GEQEGLYAHVEAVCE---------STDLGVIVYQRDNAVLNADT  147 (296)
T ss_pred             HHHH-HHHHHHHHC--CCCEEEE--CCCCCCC----CCHHHHHHHHHHHHH---------HCCCCEEEECCCCCCCCHHH
T ss_conf             9999-999999875--9997897--7998899----999999999999997---------15997787307787879999


Q ss_pred             HHHHHHHHHHC-CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHH-H
Q ss_conf             89999987644-982999806655532345775446322113564542468999999974089748999678899999-9
Q gi|254780434|r  225 LDDIAVEVLSH-KVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKD-A  302 (362)
Q Consensus       225 i~~ia~~a~~~-g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~D-a  302 (362)
                      +.++++   +. ++-||--  +                   ||      .+..+.++.+..++++.+  .+|..+.+. .
T Consensus       148 l~~L~~---~~p~i~giK~--s-------------------~~------d~~~~~~~~~~~~~~~~~--~~g~~~~d~~~  195 (296)
T TIGR03249       148 LERLAD---RCPNLVGFKD--G-------------------IG------DMEQMIEITQRLGDRLGY--LGGMPTAEVTA  195 (296)
T ss_pred             HHHHHH---CCCCEEEEEE--C-------------------CC------CHHHHHHHHHHCCCCCEE--EECCCCHHHHH
T ss_conf             999981---5798799997--7-------------------66------899999999973997279--73897128999


Q ss_pred             HHHHHCCCCEEEECHHHHCCCHHHHHHHHH
Q ss_conf             999983999754527877069789999999
Q gi|254780434|r  303 LDKIMAGANLIQLYSAMIYEGISLPKRIIQ  332 (362)
Q Consensus       303 ~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~  332 (362)
                      ..++.+|++....+++-++  |.+..++.+
T Consensus       196 ~~~~~~G~~g~i~~~~n~~--P~~~~~l~~  223 (296)
T TIGR03249       196 PAYLPLGVTSYSSAIFNFI--PHIARAFYE  223 (296)
T ss_pred             HHHHHCCCCEEEEHHHHHH--HHHHHHHHH
T ss_conf             9999389989962465675--999999999


No 225
>PRK05567 inositol-5'-monophosphate dehydrogenase; Reviewed
Probab=96.71  E-value=0.0087  Score=38.57  Aligned_cols=70  Identities=21%  Similarity=0.338  Sum_probs=53.2

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHH
Q ss_conf             88999998764498299980665553234577544632211356454246899999997408974899967889999999
Q gi|254780434|r  224 ELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDAL  303 (362)
Q Consensus       224 ~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~  303 (362)
                      +..+.++.+.++|+|.|++- |         ...      .|     ...++.++++++.+ ++++|| +|.|.+.+-+.
T Consensus       228 ~~~eRa~~Lv~AGvDvivID-t---------AhG------hs-----~~vi~~ik~ik~~~-~~v~vi-aGNv~T~~~a~  284 (486)
T PRK05567        228 DNEERAEALVKAGVDVLVVD-T---------AHG------HS-----EGVLDRVREIKAKY-PDVQII-AGNVATAEAAR  284 (486)
T ss_pred             CHHHHHHHHHHCCCCEEEEE-C---------CCC------CH-----HHHHHHHHHHHHCC-CCCCEE-EEEECHHHHHH
T ss_conf             18999999997699889950-4---------452------15-----77899999997407-877368-75120199999


Q ss_pred             HHHHCCCCEEEEC
Q ss_conf             9998399975452
Q gi|254780434|r  304 DKIMAGANLIQLY  316 (362)
Q Consensus       304 e~l~aGAs~VQi~  316 (362)
                      +.+.+|||+|-|+
T Consensus       285 ~L~~aGaD~vkVG  297 (486)
T PRK05567        285 ALIEAGADAVKVG  297 (486)
T ss_pred             HHHHCCCCEEEEC
T ss_conf             9997298769965


No 226
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed
Probab=96.70  E-value=0.045  Score=33.80  Aligned_cols=102  Identities=20%  Similarity=0.269  Sum_probs=62.8

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEC--CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             786505777748889999987644982999806--655532345775446322113564542468999999974089748
Q gi|254780434|r  212 IFLKISPDLSEEELDDIAVEVLSHKVEGIIVSN--TTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIA  289 (362)
Q Consensus       212 i~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~N--T~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~  289 (362)
                      .++-+|-.    ...++ ..+.+.|+|-+.+.-  .|...++         .       ..+.....++++.+..  ++|
T Consensus       104 ~iiG~S~h----~~~e~-~~A~~~gaDYi~~Gpvf~T~tK~~---------~-------~~~~g~~~l~~~~~~~--~iP  160 (210)
T PRK00043        104 AIIGVSTH----TLEEA-AAAAAAGADYVGVGPIFPTPTKKD---------A-------KPAVGLELLREAREAI--DIP  160 (210)
T ss_pred             CEEEEECC----CHHHH-HHHHHHCCCEEEECCCCCCCCCCC---------C-------CCCCCHHHHHHHHHHC--CCC
T ss_conf             78998479----99999-999882898388745214798888---------8-------7778999999999847--999


Q ss_pred             EEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHH
Q ss_conf             99967889999999999839997545278770697899999999999999
Q gi|254780434|r  290 IIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLN  339 (362)
Q Consensus       290 IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~  339 (362)
                      +++.||| +.+++.+.+.+||+-|-+.|+++.. +. ++.-.++|.+.++
T Consensus       161 vvAIGGI-~~~ni~~~~~~Ga~giAvis~I~~a-~d-p~~a~~~l~~~~~  207 (210)
T PRK00043        161 IVAIGGI-TPENAAEVLEAGADGVAVVSAITAA-ED-PAAAARALLAAFR  207 (210)
T ss_pred             EEEECCC-CHHHHHHHHHCCCCEEEEEHHHHCC-CC-HHHHHHHHHHHHH
T ss_conf             8998088-9999999998099999970897769-99-9999999999999


No 227
>PRK08104 consensus
Probab=96.69  E-value=0.029  Score=35.10  Aligned_cols=44  Identities=25%  Similarity=0.202  Sum_probs=35.7

Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHH
Q ss_conf             9999999740897489996788999999999983999754527877
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMI  320 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali  320 (362)
                      ..++.++.-+ ++++++.+|||. .+.+.+|+.+|+-++-.+|.++
T Consensus       144 ~~lkal~~p~-p~~~f~ptGGV~-~~N~~~yl~~~~v~~vgGS~l~  187 (212)
T PRK08104        144 KALQAISGPF-SQIRFCPTGGIT-PANYRDYLALKSVLCIGGSWLV  187 (212)
T ss_pred             HHHHHHHCCC-CCCEEEECCCCC-HHHHHHHHHCCCEEEEECHHHC
T ss_conf             9999985558-998189648989-8899999807987999883538


No 228
>cd00452 KDPG_aldolase KDPG and KHG aldolase. This family belongs to the class I adolases whose reaction mechanism involves Schiff base formation between a substrate carbonyl and lysine residue in the active site. 2-keto-3-deoxy-6-phosphogluconate (KDPG) aldolase,  is best known for its role in the Entner-Doudoroff pathway of bacteria, where it catalyzes the reversible cleavage of KDPG to pyruvate and glyceraldehyde-3-phosphate. 2-keto-4-hydroxyglutarate (KHG) aldolase, which has enzymatic specificity toward glyoxylate, forming KHG in the presence of pyruvate, and is capable of regulating glyoxylate levels in the glyoxylate bypass, an alternate pathway when bacteria are grown on acetate carbon sources.
Probab=96.68  E-value=0.053  Score=33.29  Aligned_cols=156  Identities=16%  Similarity=0.216  Sum_probs=86.2

Q ss_pred             HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCH
Q ss_conf             77988874036752410200136878998862688425554100002477777889998764100012100011045424
Q gi|254780434|r   68 AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSK  147 (362)
Q Consensus        68 ~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~  147 (362)
                      .+..+.+.+.|+-.+|+-                             |++++.-..++.+++..++..+|+   ++-.+.
T Consensus        19 ~~~~~al~~~Gi~~iEit-----------------------------l~t~~a~~~i~~l~~~~~~~~iGa---GTV~~~   66 (190)
T cd00452          19 LALAEALIEGGIRAIEIT-----------------------------LRTPGALEAIRALRKEFPEALIGA---GTVLTP   66 (190)
T ss_pred             HHHHHHHHHCCCCEEEEE-----------------------------CCCCHHHHHHHHHHHHCCCCEEEE---CCCCCH
T ss_conf             999999998699889996-----------------------------788029999999998689808965---234779


Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHH
Q ss_conf             67887765554206755269830333653221100002343211112244455655312688517865057777488899
Q gi|254780434|r  148 DFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDD  227 (362)
Q Consensus       148 ~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~  227 (362)
                      +..+      +....+|+|+    -+|+..       +    ++++...          ...+|++--..   |.   .+
T Consensus        67 ~~~~------~a~~aGa~Fi----vsP~~~-------~----~v~~~a~----------~~~~~~iPGv~---Tp---sE  109 (190)
T cd00452          67 EQAD------AAIAAGAQFI----VSPGLD-------P----EVVKAAN----------RAGIPLLPGVA---TP---TE  109 (190)
T ss_pred             HHHH------HHHHCCCCEE----ECCCCC-------H----HHHHHHH----------HCCCCEECCCC---CH---HH
T ss_conf             9999------9998599899----737799-------9----9999999----------82996657879---99---99


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHH
Q ss_conf             99987644982999806655532345775446322113564542468999999974089748999678899999999998
Q gi|254780434|r  228 IAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIM  307 (362)
Q Consensus       228 ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~  307 (362)
                       +..+.++|++-+-++--            .  ..   |       ...++.++.-+ ++++++.+|||.- +++.+|+.
T Consensus       110 -i~~A~~~G~~~vK~FPa------------~--~~---G-------~~~lkal~~pf-p~~~~~ptGGI~~-~N~~~yl~  162 (190)
T cd00452         110 -IMQALELGADIVKLFPA------------E--AV---G-------PAYIKALKGPF-PQVRFMPTGGVSL-DNAAEWLA  162 (190)
T ss_pred             -HHHHHHCCCCEEEECCC------------C--CC---C-------HHHHHHHHCCC-CCCCEEEECCCCH-HHHHHHHH
T ss_conf             -99999879998998955------------1--14---9-------99999985548-9993899679998-88999996


Q ss_pred             CCCCEEEECHHH
Q ss_conf             399975452787
Q gi|254780434|r  308 AGANLIQLYSAM  319 (362)
Q Consensus       308 aGAs~VQi~Tal  319 (362)
                      +|+.+|.+++.+
T Consensus       163 ~gv~avG~g~~l  174 (190)
T cd00452         163 AGVVAVGGGSLL  174 (190)
T ss_pred             CCCEEEEECHHC
T ss_conf             899899954125


No 229
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=96.68  E-value=0.036  Score=34.46  Aligned_cols=132  Identities=11%  Similarity=0.135  Sum_probs=79.2

Q ss_pred             HHHHHHHHH-CCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCE-EEEECCCCCCHHHHHHHH
Q ss_conf             776555420-675526983033365322110000234321111224445565531268851-786505777748889999
Q gi|254780434|r  152 DYVSGIRLF-FTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVP-IFLKISPDLSEEELDDIA  229 (362)
Q Consensus       152 dy~~~~~~~-~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~P-i~vKLsPd~~~~~i~~ia  229 (362)
                      +-...++.+ ..+...+|+-++.|+..        +.    +..+.+.        ....| +.+-..-=++    .+-+
T Consensus        26 ~a~~~~~al~~gGi~~iEITl~tp~a~--------~~----i~~l~~~--------~~~~p~~~iGaGTV~~----~e~~   81 (209)
T PRK06552         26 EALKISLAVIKGGIKAIEVTYTNPFAS--------EV----IKELVER--------YKDDPEVLIGAGTVLD----AVTA   81 (209)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHH--------HH----HHHHHHH--------HCCCCCEEEEEECCCC----HHHH
T ss_conf             999999999987998899967897599--------99----9999998--------1779981898872748----9999


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCC
Q ss_conf             98764498299980665553234577544632211356454246899999997408974899967889999999999839
Q gi|254780434|r  230 VEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAG  309 (362)
Q Consensus       230 ~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aG  309 (362)
                      +.+.++|++.++-=++                           ..+.+...++ .  +++  -.=|++|+.++.+-+.+|
T Consensus        82 ~~a~~aGA~FiVSP~~---------------------------~~~v~~~a~~-~--~i~--~iPG~~TpsEi~~A~~~G  129 (209)
T PRK06552         82 RQAILAGAQFIVSPSF---------------------------NRETAKICNR-Y--QIP--YLPGCMTVTEIVTALEAG  129 (209)
T ss_pred             HHHHHCCCCEEECCCC---------------------------CHHHHHHHHH-C--CCC--EECCCCCHHHHHHHHHCC
T ss_conf             9999859988976999---------------------------8999999998-5--996--417979999999999869


Q ss_pred             CCEEEECHHHHCCCHHHHHHHH----------------HHHHHHHHH
Q ss_conf             9975452787706978999999----------------999999998
Q gi|254780434|r  310 ANLIQLYSAMIYEGISLPKRII----------------QGLSDFLNK  340 (362)
Q Consensus       310 As~VQi~Tali~~Gp~~~~~I~----------------~~L~~~l~~  340 (362)
                      |++|.++-|-.. ||..++.+.                +-+.+||+.
T Consensus       130 a~~vKlFPA~~~-G~~yikal~~p~p~~~~~ptGGV~~~N~~~~l~a  175 (209)
T PRK06552        130 VDIVKLFPGSTV-GPSFISAIKGPLPQVNIMVTGGVSLDNVKDWFAA  175 (209)
T ss_pred             CCEEEECCHHHC-CHHHHHHHHCCCCCCCEEECCCCCHHHHHHHHHC
T ss_conf             995885833324-8999999866489992886389998889999987


No 230
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional
Probab=96.66  E-value=0.034  Score=34.63  Aligned_cols=34  Identities=12%  Similarity=0.330  Sum_probs=24.2

Q ss_pred             CCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCC
Q ss_conf             97485346888677988874036752410200136
Q gi|254780434|r   56 NPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPH   90 (362)
Q Consensus        56 nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~   90 (362)
                      -||=++.|. ++.+.++.++++|+.-|++||...+
T Consensus        77 ~~iqvGGGI-Rs~e~i~~~l~~G~~rViigT~a~~  110 (234)
T PRK13587         77 KDIEVGGGI-RTKSQIMDYFAAGINYCIVGTKGIQ  110 (234)
T ss_pred             CCEEEECCC-CCHHHHHHHHHCCCCEEEECCCCCC
T ss_conf             867984654-7599999999768999998881302


No 231
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated
Probab=96.65  E-value=0.065  Score=32.71  Aligned_cols=186  Identities=23%  Similarity=0.300  Sum_probs=106.9

Q ss_pred             HHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCHHHH
Q ss_conf             88874036752410200136878998862688425554100002477777889998764100012100011045424678
Q gi|254780434|r   71 PIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFI  150 (362)
Q Consensus        71 ~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~~~~  150 (362)
                      .+.....+.-.+|+||           |    +      |-     +.|++ ..+.+++.+++.++.+-. ++-++.+- 
T Consensus        22 a~e~v~~~~diiE~GT-----------P----L------Ik-----~eG~~-aV~~lr~~fP~~~ivAD~-KtmDaG~~-   72 (429)
T PRK07028         22 AKEAVAGGADWIEAGT-----------P----L------IK-----SEGMN-AIRTLRKNFPDLTIVADM-KTMDTGAM-   72 (429)
T ss_pred             HHHHHHCCCCEEEECC-----------H----H------HH-----HHHHH-HHHHHHHHCCCCEEEEEE-EECCCCHH-
T ss_conf             9987415875999176-----------8----8------88-----64189-999999878998698876-40455088-


Q ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             87765554206755269830333653221100002343211112244455655312688517865057777488899999
Q gi|254780434|r  151 LDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAV  230 (362)
Q Consensus       151 ~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~  230 (362)
                      +  +++  .+..+||++++-=.+|+          ..+.   .++...+.       .-+-+.+-|   +.-++..+-++
T Consensus        73 E--a~~--A~~AGADivtVlG~a~d----------~TI~---~aV~aA~k-------~G~~v~vDl---I~v~d~~~ra~  125 (429)
T PRK07028         73 E--VEM--AAKAGADVVCILGVADD----------STIA---DAVRAARK-------YGVLVMADL---INVPDPVKRAV  125 (429)
T ss_pred             H--HHH--HHHCCCCEEEEECCCCH----------HHHH---HHHHHHHH-------CCCEEEEEE---CCCCCHHHHHH
T ss_conf             9--999--98769988999457883----------6999---99999997-------098899985---58998899999


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCC
Q ss_conf             87644982999806655532345775446322113564542468999999974089748999678899999999998399
Q gi|254780434|r  231 EVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGA  310 (362)
Q Consensus       231 ~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGA  310 (362)
                      .+++.|+|-|.+ .|     +++..        .-|.    .++..++++++.+  +++|--.|||.. +.+-+.+.+||
T Consensus       126 el~~lGvd~I~v-H~-----G~D~Q--------~~g~----~p~~~l~~v~~~~--~~~vAVAGGi~~-~t~~~~v~~GA  184 (429)
T PRK07028        126 ELEELGVDIINV-HV-----GIDQQ--------MLGK----DPLELLKKVSEEV--SIPIAAAGGLDA-ETAVKAVEAGA  184 (429)
T ss_pred             HHHHCCCCEEEE-EE-----EECHH--------HCCC----CHHHHHHHHHHHC--CCEEEEECCCCH-HHHHHHHHCCC
T ss_conf             999709988999-76-----23355--------3179----8499999999755--971899668787-76999997599


Q ss_pred             CEEEECHHHHCCC--H-HHHHHHHHHH
Q ss_conf             9754527877069--7-8999999999
Q gi|254780434|r  311 NLIQLYSAMIYEG--I-SLPKRIIQGL  334 (362)
Q Consensus       311 s~VQi~Tali~~G--p-~~~~~I~~~L  334 (362)
                      |.|-++.+. ++-  | +..++|.+.+
T Consensus       185 dIvIVGgaI-~~a~dp~~aAr~ir~ai  210 (429)
T PRK07028        185 DIVIVGGNI-YKSADVTGAARDIREAL  210 (429)
T ss_pred             CEEEECCCC-CCCCCHHHHHHHHHHHH
T ss_conf             899989400-57999799999999997


No 232
>PRK08904 consensus
Probab=96.64  E-value=0.049  Score=33.49  Aligned_cols=44  Identities=20%  Similarity=0.099  Sum_probs=34.5

Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHH
Q ss_conf             9999999740897489996788999999999983999754527877
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMI  320 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali  320 (362)
                      ..++.++.-+ ++++++.+|||. .+.+.+|+.+|+-++-.+|-++
T Consensus       139 ~~lkal~~pf-p~i~~~pTGGV~-~~N~~~yl~~~~v~~vgGS~l~  182 (207)
T PRK08904        139 AMLKALYGPY-ADVRFCPTGGIS-LATAPEYLALPNVLCVGGSWLT  182 (207)
T ss_pred             HHHHHHHCCC-CCCEEEECCCCC-HHHHHHHHHCCCEEEEECHHHC
T ss_conf             9999874659-998088658989-8789999818984999881438


No 233
>PRK08782 consensus
Probab=96.63  E-value=0.02  Score=36.09  Aligned_cols=44  Identities=23%  Similarity=0.203  Sum_probs=33.0

Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHH
Q ss_conf             9999999740897489996788999999999983999754527877
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMI  320 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali  320 (362)
                      ..++.++.-+ ++++++.+|||. .+.+.+|+.+|+-++-.+|.++
T Consensus       146 ~~lkal~~pf-p~~~f~pTGGV~-~~N~~~yl~~~~v~~vgGS~l~  189 (219)
T PRK08782        146 QMLKGLAGPL-SELKLCPTGGIS-ETNAAEFLSQPNVLCIGGSWMV  189 (219)
T ss_pred             HHHHHHHCCC-CCCEEEECCCCC-HHHHHHHHHCCCEEEEECHHHC
T ss_conf             9999984769-998187679989-8789999807993999882538


No 234
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase. IMPDH catalyzes the NAD-dependent oxidation of inosine 5'-monophosphate (IMP) to xanthosine 5' monophosphate (XMP). It is a rate-limiting step in the de novo synthesis of the guanine nucleotides. There is often a CBS domain inserted in the middle of this domain, which is proposed to play a regulatory role. IMPDH is a key enzyme in the regulation of cell proliferation and differentiation. It has been identified as an attractive target for developing chemotherapeutic agents.
Probab=96.62  E-value=0.039  Score=34.16  Aligned_cols=40  Identities=23%  Similarity=0.385  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEE
Q ss_conf             899999997408974899967889999999999839997545
Q gi|254780434|r  274 TIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQL  315 (362)
Q Consensus       274 l~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi  315 (362)
                      ++.++++|+.++ +++|| +|.|.|++-+.+.+.+|||.|-|
T Consensus       123 ~~~ik~ir~~~p-~~~Ii-aGNV~T~e~a~~L~~~GaD~vkV  162 (325)
T cd00381         123 IEMIKFIKKKYP-NVDVI-AGNVVTAEAARDLIDAGADGVKV  162 (325)
T ss_pred             HHHHHHHHHHCC-CCCEE-ECCCCCHHHHHHHHHCCCCEEEE
T ss_conf             999999997689-97568-64566899999998669989997


No 235
>PRK03170 dihydrodipicolinate synthase; Provisional
Probab=96.61  E-value=0.035  Score=34.49  Aligned_cols=188  Identities=15%  Similarity=0.158  Sum_probs=84.9

Q ss_pred             HHHHHHHHHCCCCEEE-CCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHH-HHHCCCCCCEEECCCC
Q ss_conf             7798887403675241-0200136878998862688425554100002477777889998764-1000121000110454
Q gi|254780434|r   68 AEVPIELLKLGFGFVE-IGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSK-IQPTSPIGINLGANKD  145 (362)
Q Consensus        68 ~~~~~~l~~~G~G~v~-~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~-~~~~~pi~vsI~~~~~  145 (362)
                      .+.++.+.+.|.-++. .|| |-+-         +.+..            .....+++...+ ...+.|+++.++.+. 
T Consensus        25 ~~~v~~l~~~Gv~Gi~~~Gs-tGE~---------~~Ls~------------~Er~~v~~~~~~~~~~~~pvi~gv~~~~-   81 (292)
T PRK03170         25 RKLVDYQIANGTDGLVVVGT-TGES---------PTLTH------------EEHEELIRAVVEAVNGRVPVIAGTGSNS-   81 (292)
T ss_pred             HHHHHHHHHCCCCEEEECEE-CCCC---------CCCCH------------HHHHHHHHHHHHHCCCCCEEEECCCCCC-
T ss_conf             99999999779999996832-4141---------12899------------9999999999987389712884378767-


Q ss_pred             CHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC-----CC
Q ss_conf             2467887765554206755269830333653221100002343211112244455655312688517865057-----77
Q gi|254780434|r  146 SKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISP-----DL  220 (362)
Q Consensus       146 s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsP-----d~  220 (362)
                      +.+ ..++++-+++.  +||++-+  ..|..-  +  .+.+.+.+....+.+         ...+||++==-|     ++
T Consensus        82 t~~-~i~~a~~A~~~--Gadav~v--~~P~y~--~--~s~~~l~~~f~~ia~---------~~~~Pi~lYn~P~~tg~~l  143 (292)
T PRK03170         82 TAE-AIELTKFAEKA--GADGALV--VTPYYN--K--PTQEGLYQHFKAIAE---------ATDLPIILYNVPGRTGVDI  143 (292)
T ss_pred             HHH-HHHHHHHHHHC--CCCEEEE--CCCCCC--C--CCHHHHHHHHHHHHH---------CCCCCEEEEECCCCCCCCC
T ss_conf             999-99999989875--9998996--177688--9--999999999999986---------3599769873786327676


Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHH
Q ss_conf             74888999998764498299980665553234577544632211356454246899999997408974899967889999
Q gi|254780434|r  221 SEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTK  300 (362)
Q Consensus       221 ~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~  300 (362)
                      +.+.+.+++    +  .+.|+.+-     +    .         ||      ....+.++.+..++++.+.+  |  +..
T Consensus       144 ~~~~l~~L~----~--~~nv~giK-----d----s---------s~------d~~~~~~~~~~~~~~~~v~~--G--~d~  189 (292)
T PRK03170        144 LPETVARLA----E--HPNIVGIK-----E----A---------TG------DLERVSELRELCPDDFAVYS--G--DDA  189 (292)
T ss_pred             CHHHHHHHH----C--CCCEEEEE-----E----C---------CC------CHHHHHHHHHHCCCCCEEEC--C--CHH
T ss_conf             999999981----7--89989999-----6----9---------99------99999999986698736745--8--489


Q ss_pred             HHHHHHHCCCCEEEECHHHHCCCHHHHHHHHH
Q ss_conf             99999983999754527877069789999999
Q gi|254780434|r  301 DALDKIMAGANLIQLYSAMIYEGISLPKRIIQ  332 (362)
Q Consensus       301 Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~  332 (362)
                      -.++.+.+||+-.-.+++.++  |..+.++.+
T Consensus       190 ~~~~~l~~Ga~G~is~~~n~~--P~~~~~i~~  219 (292)
T PRK03170        190 LALPFLALGGVGVISVTANVA--PKEMAEMCD  219 (292)
T ss_pred             HHHHHHHHCCCEEEEEHHHHH--HHHHHHHHH
T ss_conf             999999943986998447644--899999999


No 236
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=96.58  E-value=0.037  Score=34.32  Aligned_cols=43  Identities=23%  Similarity=0.218  Sum_probs=29.6

Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHH-CCCCEEEECHHHH
Q ss_conf             999999974089748999678899999999998-3999754527877
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKDALDKIM-AGANLIQLYSAMI  320 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~-aGAs~VQi~Tali  320 (362)
                      ..++.++.-+ ++++++.+|||. .+.+.+|+. .++-+|. +|.++
T Consensus       144 ~~lkal~~p~-p~i~~~ptGGV~-~~N~~~yl~~~~v~avg-GS~l~  187 (212)
T PRK05718        144 KMLKALAGPF-SDVRFCPTGGIS-PANYRDYLALPNVLCIG-GSWMV  187 (212)
T ss_pred             HHHHHHHCCC-CCCEEEECCCCC-HHHHHHHHCCCCEEEEE-CHHHC
T ss_conf             9999985658-998288659989-87899998178869998-73528


No 237
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF). The ProFAR isomerase catalyzes the fourth step in histidine biosynthesis, an isomerisation of the aminoaldose moiety of ProFAR to the aminoketose of PRFAR (N-(5'-phospho-D-1'-ribulosylformimino)-5-amino-1-(5''-phospho-ribosyl)-4-imidazolecarboxamide). In bacteria and archaea, ProFAR isomerase is encoded by the HisA gene. The Imidazole glycerol phosphate synthase (IGPS) catalyzes the fifth step of histidine biosynthesis, the formation of the imidazole ring. IGPS converts N1-(5'-phosphoribulosyl)-formimino-5-aminoimidazole-4-carboxamide ribonucleotide (PRFAR) to imidazole glycerol phosphate (ImGP) and 5'-(5-aminoimidazole-4-carboxamide) ribonucleotide (AICAR). This conversion involves two tightly coupled reactions in distinct active sites of IGPS. The two catalytic domains can be fused, like in fungi and pl
Probab=96.58  E-value=0.03  Score=35.00  Aligned_cols=31  Identities=32%  Similarity=0.278  Sum_probs=15.9

Q ss_pred             CCEEECCCCCCCHHHHHHHHHCCCCEEECCCC
Q ss_conf             97485346888677988874036752410200
Q gi|254780434|r   56 NPLGMAAGYDKNAEVPIELLKLGFGFVEIGTV   87 (362)
Q Consensus        56 nPiglAaG~dk~~~~~~~l~~~G~G~v~~kti   87 (362)
                      -|+-+..|. ++-+.++.+++.|+--++++|.
T Consensus        79 ~pi~vGGGI-rs~~~~~~~l~~Gadkvvigs~  109 (233)
T cd04723          79 LGLWVDGGI-RSLENAQEWLKRGASRVIVGTE  109 (233)
T ss_pred             CCEEEECCC-CCHHHHHHHHHCCCCEEECCCH
T ss_conf             988997022-7699999998607201524510


No 238
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis. It catalyzes the aldol condensation of L-aspartate-beta- semialdehyde and pyruvate to dihydropicolinic acid via a Schiff base formation between pyruvate and a lysine residue. The functional enzyme is a homotetramer consisting of a dimer of dimers. DHDPS is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways.
Probab=96.58  E-value=0.037  Score=34.34  Aligned_cols=189  Identities=13%  Similarity=0.135  Sum_probs=86.6

Q ss_pred             HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHH-HHCCCCCCEEECCCCC
Q ss_conf             779888740367524102001368789988626884255541000024777778899987641-0001210001104542
Q gi|254780434|r   68 AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKI-QPTSPIGINLGANKDS  146 (362)
Q Consensus        68 ~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~-~~~~pi~vsI~~~~~s  146 (362)
                      .+.++.+.+.|..++.+..-|-+-         +.+            .-.....+.+...+. ..+.||++.++.+. +
T Consensus        24 ~~~v~~l~~~Gv~gi~v~GstGE~---------~~L------------s~~Er~~l~~~~~~~~~~~~~vi~gv~~~~-t   81 (284)
T cd00950          24 ERLIEFQIENGTDGLVVCGTTGES---------PTL------------SDEEHEAVIEAVVEAVNGRVPVIAGTGSNN-T   81 (284)
T ss_pred             HHHHHHHHHCCCCEEEECEECCCH---------HHC------------CHHHHHHHHHHHHHHCCCCCEEEEECCCCC-H
T ss_conf             999999997699989968435124---------248------------999999999999997189750775078778-9


Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC-----CCC
Q ss_conf             467887765554206755269830333653221100002343211112244455655312688517865057-----777
Q gi|254780434|r  147 KDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISP-----DLS  221 (362)
Q Consensus       147 ~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsP-----d~~  221 (362)
                      .+. .+..+.+++.  +||++-+-  .|....    .+.+.+.+....+.         ....+||++==-|     +++
T Consensus        82 ~~~-i~~a~~A~~~--Gadai~v~--pP~y~~----~s~~~l~~~~~~ia---------~a~~lPi~lYn~P~~tg~~l~  143 (284)
T cd00950          82 AEA-IELTKRAEKA--GADAALVV--TPYYNK----PSQEGLYAHFKAIA---------EATDLPVILYNVPGRTGVNIE  143 (284)
T ss_pred             HHH-HHHHHHHHHC--CCCEEEEC--CCCCCC----CCHHHHHHHHHHHH---------HCCCCCEEEEECCCCCCCCCC
T ss_conf             999-9999999983--99989962--665789----79999999999997---------555997798737641167888


Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHH
Q ss_conf             48889999987644982999806655532345775446322113564542468999999974089748999678899999
Q gi|254780434|r  222 EEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKD  301 (362)
Q Consensus       222 ~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~D  301 (362)
                      .+.+.++++   .-.+.|+-  .+                   ||      ....+.++.+..++++.++.  |  +.+-
T Consensus       144 ~~~l~~L~~---~pnv~giK--~s-------------------s~------d~~~~~~~~~~~~~~~~v~~--G--~d~~  189 (284)
T cd00950         144 PETVLRLAE---HPNIVGIK--EA-------------------TG------DLDRVSELIALCPDDFAVLS--G--DDAL  189 (284)
T ss_pred             HHHHHHHHC---CCCEEEEE--CC-------------------CC------CHHHHHHHHHHCCCCCEEEC--C--CHHH
T ss_conf             899999847---99989998--58-------------------89------89999999986698754644--8--6899


Q ss_pred             HHHHHHCCCCEEEECHHHHCCCHHHHHHHHH
Q ss_conf             9999983999754527877069789999999
Q gi|254780434|r  302 ALDKIMAGANLIQLYSAMIYEGISLPKRIIQ  332 (362)
Q Consensus       302 a~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~  332 (362)
                      .+..+.+||+-.-.+++-++  |..+.+|.+
T Consensus       190 ~~~~l~~Ga~G~i~~~~n~~--P~~~~~l~~  218 (284)
T cd00950         190 TLPFLALGGVGVISVAANVA--PKLMAEMVR  218 (284)
T ss_pred             HHHHHHHCCCEEEEEEHHCC--HHHHHHHHH
T ss_conf             99999954996998531027--899999999


No 239
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=96.57  E-value=0.04  Score=34.13  Aligned_cols=124  Identities=9%  Similarity=0.005  Sum_probs=76.3

Q ss_pred             HHHHHHHHHH-CCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             8776555420-675526983033365322110000234321111224445565531268851786505777748889999
Q gi|254780434|r  151 LDYVSGIRLF-FTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIA  229 (362)
Q Consensus       151 ~dy~~~~~~~-~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia  229 (362)
                      ++....++.+ ..+...+|+-+..|+..        +.+    ..+.+.        ..+  +.+-..-=++    .+-+
T Consensus        25 ~~a~~~~~al~~gGi~~iEiTl~t~~a~--------~~I----~~l~~~--------~p~--~~iGaGTV~~----~e~~   78 (210)
T PRK07455         25 ELGLQMAEAVAAGGMRLIEITWNSDQPA--------ELI----SQLREK--------LPE--CIIGTGTLLT----LEDL   78 (210)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHH--------HHH----HHHHHH--------CCC--CEEEEEECCC----HHHH
T ss_conf             9999999999987998899968998899--------999----999987--------899--6898881878----9999


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCC
Q ss_conf             98764498299980665553234577544632211356454246899999997408974899967889999999999839
Q gi|254780434|r  230 VEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAG  309 (362)
Q Consensus       230 ~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aG  309 (362)
                      +.+.++|++-++--++                           ....+...++ .  ++|  -.=|++|+.++.+.+.+|
T Consensus        79 ~~a~~aGA~FiVSP~~---------------------------~~~vi~~a~~-~--~i~--~iPGv~TpsEi~~A~~~G  126 (210)
T PRK07455         79 EEAIAAGAQFCFTPHV---------------------------DLELIQAAVA-A--DIP--IIPGALTPTEIVTAWQAG  126 (210)
T ss_pred             HHHHHCCCCEEECCCC---------------------------CHHHHHHHHH-C--CCC--EECCCCCHHHHHHHHHCC
T ss_conf             9999869999986888---------------------------8999999998-2--997--658869999999999869


Q ss_pred             CCEEEECHHHHCCCHHHHHHHHH
Q ss_conf             99754527877069789999999
Q gi|254780434|r  310 ANLIQLYSAMIYEGISLPKRIIQ  332 (362)
Q Consensus       310 As~VQi~Tali~~Gp~~~~~I~~  332 (362)
                      |+.|-++-+-...||..++.+..
T Consensus       127 ~~~vKlFPA~~~GG~~ylkal~~  149 (210)
T PRK07455        127 ASCVKVFPVQAVGGADYIKSLQG  149 (210)
T ss_pred             CCEEEECCCHHCCCHHHHHHHHC
T ss_conf             98477505132067999999865


No 240
>cd00452 KDPG_aldolase KDPG and KHG aldolase. This family belongs to the class I adolases whose reaction mechanism involves Schiff base formation between a substrate carbonyl and lysine residue in the active site. 2-keto-3-deoxy-6-phosphogluconate (KDPG) aldolase,  is best known for its role in the Entner-Doudoroff pathway of bacteria, where it catalyzes the reversible cleavage of KDPG to pyruvate and glyceraldehyde-3-phosphate. 2-keto-4-hydroxyglutarate (KHG) aldolase, which has enzymatic specificity toward glyoxylate, forming KHG in the presence of pyruvate, and is capable of regulating glyoxylate levels in the glyoxylate bypass, an alternate pathway when bacteria are grown on acetate carbon sources.
Probab=96.55  E-value=0.052  Score=33.32  Aligned_cols=133  Identities=11%  Similarity=0.146  Sum_probs=81.7

Q ss_pred             HHHHHHHHHH-CCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             8776555420-675526983033365322110000234321111224445565531268851786505777748889999
Q gi|254780434|r  151 LDYVSGIRLF-FTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIA  229 (362)
Q Consensus       151 ~dy~~~~~~~-~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia  229 (362)
                      ++-...++.+ ..+...+|+-++.|+..        +.    +..+++.        ..+  +.+-..-=++    .+-+
T Consensus        16 ~~a~~~~~al~~~Gi~~iEitl~t~~a~--------~~----i~~l~~~--------~~~--~~iGaGTV~~----~~~~   69 (190)
T cd00452          16 EDALALAEALIEGGIRAIEITLRTPGAL--------EA----IRALRKE--------FPE--ALIGAGTVLT----PEQA   69 (190)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHH--------HH----HHHHHHH--------CCC--CEEEECCCCC----HHHH
T ss_conf             9999999999986998899967880299--------99----9999986--------898--0896523477----9999


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCC
Q ss_conf             98764498299980665553234577544632211356454246899999997408974899967889999999999839
Q gi|254780434|r  230 VEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAG  309 (362)
Q Consensus       230 ~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aG  309 (362)
                      +.+.++|++-++.-++                           ....+...++.   ++|  -+=|++|+.++...+.+|
T Consensus        70 ~~a~~aGa~FivsP~~---------------------------~~~v~~~a~~~---~~~--~iPGv~TpsEi~~A~~~G  117 (190)
T cd00452          70 DAAIAAGAQFIVSPGL---------------------------DPEVVKAANRA---GIP--LLPGVATPTEIMQALELG  117 (190)
T ss_pred             HHHHHCCCCEEECCCC---------------------------CHHHHHHHHHC---CCC--EECCCCCHHHHHHHHHCC
T ss_conf             9999859989973779---------------------------99999999982---996--657879999999999879


Q ss_pred             CCEEEECHHHHCCCHHHHHHHH----------------HHHHHHHHHCCC
Q ss_conf             9975452787706978999999----------------999999998389
Q gi|254780434|r  310 ANLIQLYSAMIYEGISLPKRII----------------QGLSDFLNKENE  343 (362)
Q Consensus       310 As~VQi~Tali~~Gp~~~~~I~----------------~~L~~~l~~~G~  343 (362)
                      |+.|.++-+-.+ ||..++.+.                +.+.+||+. |.
T Consensus       118 ~~~vK~FPa~~~-G~~~lkal~~pfp~~~~~ptGGI~~~N~~~yl~~-gv  165 (190)
T cd00452         118 ADIVKLFPAEAV-GPAYIKALKGPFPQVRFMPTGGVSLDNAAEWLAA-GV  165 (190)
T ss_pred             CCEEEECCCCCC-CHHHHHHHHCCCCCCCEEEECCCCHHHHHHHHHC-CC
T ss_conf             998998955114-9999999855489993899679998889999968-99


No 241
>pfam01070 FMN_dh FMN-dependent dehydrogenase.
Probab=96.55  E-value=0.049  Score=33.54  Aligned_cols=87  Identities=20%  Similarity=0.265  Sum_probs=58.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEE-CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             178650577774888999998764498299980-6655532345775446322113564542468999999974089748
Q gi|254780434|r  211 PIFLKISPDLSEEELDDIAVEVLSHKVEGIIVS-NTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIA  289 (362)
Q Consensus       211 Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~-NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~  289 (362)
                      |.|..|-+..+.+...++++.++++|+++++++ |+..       .... + .       -.....-|+++++.++  .|
T Consensus       110 ~~~fQly~~~d~~~~~~~i~ra~~ag~~al~ltvD~~~-------~g~r-~-~-------d~r~~~~i~~l~~~~~--~P  171 (301)
T pfam01070       110 PLWFQLYVPKDRELTEDLLERAEAAGYKALVLTVDTPV-------LGNR-E-R-------DLRNGDDLAWLRDQWK--GP  171 (301)
T ss_pred             CEEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCC-------CCCC-C-C-------CCCCHHHHHHHHHHCC--CC
T ss_conf             76899874588899999999999749997999726876-------5778-5-3-------2043999999998669--98


Q ss_pred             EEEECCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             999678899999999998399975452
Q gi|254780434|r  290 IIGTGGISSTKDALDKIMAGANLIQLY  316 (362)
Q Consensus       290 IIg~GGI~s~~Da~e~l~aGAs~VQi~  316 (362)
                      +|-= ||.|++||.....+|++.+.|.
T Consensus       172 vivK-GI~s~eDA~~a~~~Gv~~I~VS  197 (301)
T pfam01070       172 LVLK-GILSPEDAKRAVEAGVDGIVVS  197 (301)
T ss_pred             EEEE-CCCCHHHHHHHHHCCCCEEEEC
T ss_conf             8998-2899999999998599999964


No 242
>pfam01081 Aldolase KDPG and KHG aldolase. This family includes the following members: 4-hydroxy-2-oxoglutarate aldolase (KHG-aldolase) Phospho-2-dehydro-3-deoxygluconate aldolase (KDPG-aldolase)
Probab=96.52  E-value=0.039  Score=34.20  Aligned_cols=123  Identities=11%  Similarity=0.106  Sum_probs=72.4

Q ss_pred             HHHHHHHHH-CCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             776555420-6755269830333653221100002343211112244455655312688517865057777488899999
Q gi|254780434|r  152 DYVSGIRLF-FTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAV  230 (362)
Q Consensus       152 dy~~~~~~~-~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~  230 (362)
                      +-...++.+ ..+...+|+-+..|+..        +.+    ..+.+.        ...  +.+-..-=++    .+-++
T Consensus        21 ~a~~~~~al~~~Gi~~iEiTl~t~~a~--------~~I----~~l~~~--------~p~--~~iGaGTV~~----~e~~~   74 (196)
T pfam01081        21 DALPLAEALAAGGIRVLEVTLRTPCAL--------DAI----RLLRKN--------RPD--ALVGAGTVLN----AQQLA   74 (196)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCHHHH--------HHH----HHHHHH--------CCC--CEEEEEECCC----HHHHH
T ss_conf             999999999987998899947982799--------999----999964--------999--6799983768----99999


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCC
Q ss_conf             87644982999806655532345775446322113564542468999999974089748999678899999999998399
Q gi|254780434|r  231 EVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGA  310 (362)
Q Consensus       231 ~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGA  310 (362)
                      .+.++|++-++--++                           ....+....+ .  +++  -.=|++|+.++...+.+||
T Consensus        75 ~a~~aGA~FivSP~~---------------------------~~~v~~~a~~-~--~i~--~iPGv~TpsEi~~A~~~G~  122 (196)
T pfam01081        75 EAAEAGAQFVVSPGL---------------------------TADLLKHAVD-V--KIP--LIPGVSTPSEIMLGLDLGL  122 (196)
T ss_pred             HHHHCCCCEEECCCC---------------------------HHHHHHHHHH-C--CCC--EECCCCCHHHHHHHHHCCC
T ss_conf             999749999997876---------------------------3999999997-3--996--6378599999999998799


Q ss_pred             CEEEECHHHHCCCHHHHHHHHH
Q ss_conf             9754527877069789999999
Q gi|254780434|r  311 NLIQLYSAMIYEGISLPKRIIQ  332 (362)
Q Consensus       311 s~VQi~Tali~~Gp~~~~~I~~  332 (362)
                      +.|-++-|-.+-|+..++.+..
T Consensus       123 ~~vKlFPA~~~Gg~~~lkal~~  144 (196)
T pfam01081       123 TRFKFFPAEASGGVPAIKALAG  144 (196)
T ss_pred             CEEEECCCHHCCCHHHHHHHHC
T ss_conf             9899787310184999999857


No 243
>PRK08904 consensus
Probab=96.51  E-value=0.028  Score=35.11  Aligned_cols=135  Identities=12%  Similarity=0.063  Sum_probs=79.3

Q ss_pred             HHHHHHHHHH-CCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             8776555420-675526983033365322110000234321111224445565531268851786505777748889999
Q gi|254780434|r  151 LDYVSGIRLF-FTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIA  229 (362)
Q Consensus       151 ~dy~~~~~~~-~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia  229 (362)
                      ++-..+++.+ ..+...+|+-+..|+..        +.+    ..+.+        ....  +.+-..-=++    .+-+
T Consensus        22 ~~a~~~a~al~~~Gi~~iEiTlrtp~a~--------~~i----~~l~~--------~~p~--~~vGaGTVl~----~e~~   75 (207)
T PRK08904         22 STAVDLSRALVEGGIPTLEITLRTPVGL--------DAI----RLIAK--------EVPN--AIVGAGTVTN----PEQL   75 (207)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHH--------HHH----HHHHH--------HCCC--CEEEEEECCC----HHHH
T ss_conf             9999999999987998899957991399--------999----99998--------6898--7685531368----9999


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCC
Q ss_conf             98764498299980665553234577544632211356454246899999997408974899967889999999999839
Q gi|254780434|r  230 VEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAG  309 (362)
Q Consensus       230 ~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aG  309 (362)
                      +.+.++|++.++.-++            .               ...+...+ ..  ++|  -.=|+.|+.++...+.+|
T Consensus        76 ~~a~~aGA~FiVSP~~------------~---------------~~v~~~a~-~~--~i~--~iPGv~TpsEi~~A~~~G  123 (207)
T PRK08904         76 KAVEDAGAVFAISPGL------------H---------------ESLAKAGH-NS--GIP--LIPGVATPGEIQLALEHG  123 (207)
T ss_pred             HHHHHCCCCEEECCCC------------C---------------HHHHHHHH-HC--CCC--EECCCCCHHHHHHHHHCC
T ss_conf             9999849999984899------------8---------------99999999-83--997--657869999999999879


Q ss_pred             CCEEEECHHHHCCCHHHHHHHHH----------------HHHHHHHHCCC
Q ss_conf             99754527877069789999999----------------99999998389
Q gi|254780434|r  310 ANLIQLYSAMIYEGISLPKRIIQ----------------GLSDFLNKENE  343 (362)
Q Consensus       310 As~VQi~Tali~~Gp~~~~~I~~----------------~L~~~l~~~G~  343 (362)
                      ++.|-++-|-.+.|+..++.+..                .+.+||+..++
T Consensus       124 ~~~vK~FPA~~~GG~~~lkal~~pfp~i~~~pTGGV~~~N~~~yl~~~~v  173 (207)
T PRK08904        124 IDTLKLFPAEVVGGKAMLKALYGPYADVRFCPTGGISLATAPEYLALPNV  173 (207)
T ss_pred             CCEEEECCCHHCCCHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCE
T ss_conf             99899776222088999998746599980886589898789999818984


No 244
>PRK04147 N-acetylneuraminate lyase; Provisional
Probab=96.48  E-value=0.046  Score=33.68  Aligned_cols=198  Identities=15%  Similarity=0.167  Sum_probs=87.2

Q ss_pred             CCCEEECCC-CCCCH--HHHHHHHH-CCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHH-
Q ss_conf             997485346-88867--79888740-36752410200136878998862688425554100002477777889998764-
Q gi|254780434|r   55 SNPLGMAAG-YDKNA--EVPIELLK-LGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSK-  129 (362)
Q Consensus        55 ~nPiglAaG-~dk~~--~~~~~l~~-~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~-  129 (362)
                      .-||- ..| .|.++  +.++.+.+ .|.-++.+..-|-+-         +.+            .-.....+.+...+ 
T Consensus        12 ~TPF~-~dg~iD~~~l~~~v~~~i~~~Gv~Gi~~~GstGE~---------~~L------------s~~Er~~l~~~~~~~   69 (294)
T PRK04147         12 LTPFD-EDGQIDEQGLRQLVRFNIEKQGIDGLYVGGSTGEA---------FLL------------STEERKQVLEIVAEE   69 (294)
T ss_pred             ECCCC-CCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCH---------HHC------------CHHHHHHHHHHHHHH
T ss_conf             36789-68596999999999999987799899979513164---------348------------999999999999998


Q ss_pred             HHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             10001210001104542467887765554206755269830333653221100002343211112244455655312688
Q gi|254780434|r  130 IQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKF  209 (362)
Q Consensus       130 ~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~  209 (362)
                      ...+.||++.++.+. +.+. .+..+.++++  ++|++-+  ..|..-.    ...+.+......+.         ...+
T Consensus        70 ~~~r~pvi~gv~~~s-t~~a-i~~a~~a~~~--Gad~v~~--~pP~y~~----~~~~~i~~~f~~va---------~a~~  130 (294)
T PRK04147         70 AKGKIKLIAQVGSVN-TAEA-QELAKYATEL--GYDAISA--VTPFYYP----FSFEEICDYYREII---------DSAD  130 (294)
T ss_pred             CCCCCEEEECCCCCC-HHHH-HHHHHHHHHC--CCCEEEE--CCCCCCC----CCHHHHHHHHHHHH---------HHCC
T ss_conf             189732763478888-8999-9999999975--9988997--2786778----99899999999998---------5049


Q ss_pred             CEEEEECCC-----CCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             517865057-----777488899999876449829998066555323457754463221135645424689999999740
Q gi|254780434|r  210 VPIFLKISP-----DLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRV  284 (362)
Q Consensus       210 ~Pi~vKLsP-----d~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~  284 (362)
                      +||++==-|     +++.+.+.+++   ..-++.|+=-  +                   ||.      ...+.++++..
T Consensus       131 ~pi~iYn~P~~tg~~~~~~~l~~L~---~~~~i~giK~--s-------------------~~d------~~~~~~i~~~~  180 (294)
T PRK04147        131 NPMIVYNIPALTGVNLSLDQFNELF---TLPKIIGVKQ--T-------------------AGD------LYQLERIRKAF  180 (294)
T ss_pred             CCEEEEECCCCCCCCCCHHHHHHHH---CCCCEEEEEE--C-------------------CCC------HHHHHHHHHHC
T ss_conf             9778875675416788999999995---6899889992--8-------------------899------99999999748


Q ss_pred             CCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHH
Q ss_conf             8974899967889999999999839997545278770697899999
Q gi|254780434|r  285 GPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRI  330 (362)
Q Consensus       285 ~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I  330 (362)
                      ++.. + -+|   +..-..+.+.+||+-+--+++-++  |..+.+|
T Consensus       181 ~~~~-v-~~G---~d~~~~~~~~~Ga~G~i~~~~n~~--p~~~~~l  219 (294)
T PRK04147        181 PDKL-I-YNG---FDEMFLSGLLAGADGAIGSTYNVN--GWRARQI  219 (294)
T ss_pred             CCEE-E-EEC---CHHHHHHHHHCCCCEEEECHHHHH--HHHHHHH
T ss_conf             9849-9-958---658799999879969994479867--8999999


No 245
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional
Probab=96.48  E-value=0.083  Score=31.97  Aligned_cols=167  Identities=14%  Similarity=0.086  Sum_probs=93.7

Q ss_pred             HHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99987641000121000110454246788776555420675526983033365322110000234321111224445565
Q gi|254780434|r  123 VFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEE  202 (362)
Q Consensus       123 ~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~  202 (362)
                      ..+.|++.+++.+|.+-+ +..+++...   .++  .+..+||++.+-=..          ..+.+...+...   +.  
T Consensus        46 ~V~~lr~~~p~k~I~aDl-K~~D~g~~e---a~~--a~~aGAd~vtV~g~a----------~~~Ti~~~~~~A---~~--  104 (216)
T PRK13306         46 AVRVLRALYPDKIIVADT-KIADAGKIL---AKM--AFEAGADWVTVICAA----------HIPTIKAALKVA---KE--  104 (216)
T ss_pred             HHHHHHHHCCCCEEEEEE-EECCCCHHH---HHH--HHHCCCCEEEEECCC----------CHHHHHHHHHHH---HH--
T ss_conf             999999878999799975-323653899---999--997289889995668----------979999999999---98--


Q ss_pred             HHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             53126885178650577774888999998764498299980665553234577544632211356454246899999997
Q gi|254780434|r  203 KIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQ  282 (362)
Q Consensus       203 ~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~  282 (362)
                           ..+.+++-|.-..+    .+.++...+.|++.+++ .+.  ++        .   +.+|....+..+..+++++ 
T Consensus       105 -----~g~~v~vdl~~~~~----~e~a~~~~~lgv~~~i~-H~~--~D--------~---~~~g~~~~~~~~~~ik~l~-  160 (216)
T PRK13306        105 -----FNGEIQIELYGNWT----WEQAQQWRDAGIQQVIY-HRS--RD--------A---ELAGVAWGEKDLNKVKKLS-  160 (216)
T ss_pred             -----HCCEEEEEEECCCC----HHHHHHHHHCCCCEEEE-ECC--HH--------H---HHCCCCCCHHHHHHHHHHH-
T ss_conf             -----09836999737877----88899999769987887-603--22--------4---4246788877899999976-


Q ss_pred             HCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC-CCH-HHHHHHHHHHHHH
Q ss_conf             408974899967889999999999839997545278770-697-8999999999999
Q gi|254780434|r  283 RVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY-EGI-SLPKRIIQGLSDF  337 (362)
Q Consensus       283 ~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~-~Gp-~~~~~I~~~L~~~  337 (362)
                        +..+.|--.||| +.+++.++...|++.|=++++..- +.| ...++|.++++++
T Consensus       161 --~~~~~vaVaGGI-~~~~~~~~~~~~~~ivIVGraIt~a~dP~~aA~~i~~~I~~~  214 (216)
T PRK13306        161 --DMGFKVSVTGGI-VPEDLKLFKGIPIKTFIAGRAIRGAKDPAEAARAFKDEIAKY  214 (216)
T ss_pred             --CCCCEEEECCCC-CHHHHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             --369829985998-989999986279989998852358999999999999999986


No 246
>PRK08104 consensus
Probab=96.38  E-value=0.094  Score=31.61  Aligned_cols=136  Identities=13%  Similarity=0.119  Sum_probs=80.7

Q ss_pred             HHHHHHHHHHH-CCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             88776555420-67552698303336532211000023432111122444556553126885178650577774888999
Q gi|254780434|r  150 ILDYVSGIRLF-FTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDI  228 (362)
Q Consensus       150 ~~dy~~~~~~~-~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~i  228 (362)
                      .++-..+++.+ ..+...+|+-+..|+..        +.+    ..+.+        ....  +.+-..-=++    .+-
T Consensus        26 ~~~a~~la~al~~gGi~~iEiTlrt~~a~--------~~I----~~l~~--------~~p~--~~vGaGTV~~----~e~   79 (212)
T PRK08104         26 LEHAVPLAKALVAGGVRVLEVTLRTPCAL--------EAI----RAIAK--------EVPE--AIVGAGTVLN----PQQ   79 (212)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCHHH--------HHH----HHHHH--------HCCC--CEEEEEECCC----HHH
T ss_conf             99999999999987998899968881499--------999----99998--------6898--5685420267----999


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHC
Q ss_conf             99876449829998066555323457754463221135645424689999999740897489996788999999999983
Q gi|254780434|r  229 AVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMA  308 (362)
Q Consensus       229 a~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~a  308 (362)
                      ++.+.++|++.++.-++                           ...++...+ ..  ++|.  .=|++|+.++...+.+
T Consensus        80 ~~~ai~aGA~FiVSP~~---------------------------~~~v~~~a~-~~--~i~~--iPGv~TpsEi~~A~~~  127 (212)
T PRK08104         80 LAEVTEAGAQFAISPGL---------------------------TEELLKAAT-EG--TIPL--IPGISTVSELMLGMDY  127 (212)
T ss_pred             HHHHHHCCCCEEECCCC---------------------------CHHHHHHHH-HC--CCCE--ECCCCCHHHHHHHHHC
T ss_conf             99999859999984899---------------------------999999999-82--9976--5676999999999987


Q ss_pred             CCCEEEECHHHHCCCHHHHHHHH----------------HHHHHHHHHCCC
Q ss_conf             99975452787706978999999----------------999999998389
Q gi|254780434|r  309 GANLIQLYSAMIYEGISLPKRII----------------QGLSDFLNKENE  343 (362)
Q Consensus       309 GAs~VQi~Tali~~Gp~~~~~I~----------------~~L~~~l~~~G~  343 (362)
                      ||+.|-++-|-.+-|+..++.+.                +-+.+||+..++
T Consensus       128 G~~~vKlFPA~~~gG~~~lkal~~p~p~~~f~ptGGV~~~N~~~yl~~~~v  178 (212)
T PRK08104        128 GLTEFKFFPAEANGGVKALQAISGPFSQIRFCPTGGITPANYRDYLALKSV  178 (212)
T ss_pred             CCCEEEECCCCCCCCHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCE
T ss_conf             999799787621374999999855589981896489898899999807987


No 247
>pfam00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family. This enzyme catalyses the conversion of D-ribulose 5-phosphate into D-xylulose 5-phosphate.
Probab=96.38  E-value=0.095  Score=31.59  Aligned_cols=195  Identities=14%  Similarity=0.224  Sum_probs=112.7

Q ss_pred             CEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             74853468886779888740367524102001368789988626884255541000024777778899987641000121
Q gi|254780434|r   57 PLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPI  136 (362)
Q Consensus        57 PiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi  136 (362)
                      |=+++|-+.+-.+.++++...|+..+-+                  ..-|+-.+..++|.   . .+++.+++. .+.|+
T Consensus         4 pSil~ad~~~l~~~i~~l~~~g~d~iHi------------------DimDG~FVpn~t~g---~-~~i~~ir~~-t~~~~   60 (201)
T pfam00834         4 PSLLSADFAHLGEEIKAVENAGADWLHV------------------DVMDGHFVPNLTIG---P-LVVEALRPL-TELPL   60 (201)
T ss_pred             HHHHHCCHHHHHHHHHHHHHCCCCEEEE------------------ECCCCCCCCCCCCC---H-HHHHHHHHC-CCCCE
T ss_conf             6574168999999999999769998998------------------27679727755558---7-799999863-89963


Q ss_pred             CCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             00011045424678877655542067552698303336532211000023432111122444556553126885178650
Q gi|254780434|r  137 GINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKI  216 (362)
Q Consensus       137 ~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKL  216 (362)
                      =+-++...+     ++|.+.+..  .++|++.+-+-+.           +...+.+..+++.        .  +-..+-|
T Consensus        61 DvHLMv~~P-----~~~i~~~~~--~g~d~i~~H~E~~-----------~~~~~~i~~ik~~--------g--~k~GlAl  112 (201)
T pfam00834        61 DVHLMVEEP-----DRIIPDFAE--AGADIISFHAEAS-----------DHPHRTIQLIKEA--------G--AKAGLVL  112 (201)
T ss_pred             EEEEEEECH-----HHHHHHHHH--CCCCEEEECHHHH-----------HCHHHHHHHHHHC--------C--CEEEEEE
T ss_conf             899998377-----663999987--3998899754441-----------3799999999864--------9--7268885


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC---CCCEEEEEE
Q ss_conf             57777488899999876449829998066555323457754463221135645424689999999740---897489996
Q gi|254780434|r  217 SPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRV---GPKIAIIGT  293 (362)
Q Consensus       217 sPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~---~~~i~IIg~  293 (362)
                      .|+.+.+.+..++.     -+|.+.+- |           .  .. |.+|....+.++.-|+++|+..   +.++.|-.-
T Consensus       113 nP~T~~~~l~~~l~-----~iD~VLvM-t-----------V--~P-Gf~GQ~f~~~~l~KI~~lr~~~~~~~~~~~I~vD  172 (201)
T pfam00834       113 NPATPLDAIEYLLD-----DLDLVLLM-S-----------V--NP-GFGGQSFIPSVLPKIRKVRKMIDEGGLDTLIEVD  172 (201)
T ss_pred             CCCCCCHHHHHHHH-----HCCEEEEE-E-----------E--CC-CCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             69986028887674-----27989998-8-----------6--68-9887645677999999999999826998079998


Q ss_pred             CCCCCHHHHHHHHHCCCCEEEECHHHHCCCH
Q ss_conf             7889999999999839997545278770697
Q gi|254780434|r  294 GGISSTKDALDKIMAGANLIQLYSAMIYEGI  324 (362)
Q Consensus       294 GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp  324 (362)
                      |||.. +.+.+...+|||.+=++|++ |.-|
T Consensus       173 GGIn~-~ti~~l~~~Gad~~V~GSai-F~sp  201 (201)
T pfam00834       173 GGVNL-DNIPQIAEAGADVLVAGSAV-FGAP  201 (201)
T ss_pred             CCCCH-HHHHHHHHCCCCEEEECCEE-CCCC
T ss_conf             98889-99999998799999978002-4598


No 248
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE). This enzyme catalyses the interconversion of D-ribulose 5-phosphate (Ru5P) into D-xylulose 5-phosphate, as part of the Calvin cycle (reductive pentose phosphate pathway) in chloroplasts and in the oxidative pentose phosphate pathway. In the Calvin cycle Ru5P is phosphorylated by phosphoribulose kinase to ribulose-1,5-bisphosphate, which in turn is used by RubisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase) to incorporate CO2 as the central step in carbohydrate synthesis.
Probab=96.36  E-value=0.097  Score=31.52  Aligned_cols=199  Identities=20%  Similarity=0.252  Sum_probs=114.4

Q ss_pred             EECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             85346888677988874036752410200136878998862688425554100002477777889998764100012100
Q gi|254780434|r   59 GMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGI  138 (362)
Q Consensus        59 glAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~v  138 (362)
                      .++|-+..-.+.++++...|+..+-+                  ..-|+-.+..++|.   . .+++.+++.. +.|+=|
T Consensus         6 il~ad~~~l~~~i~~~~~~g~d~lHi------------------DimDG~Fvpn~t~g---~-~~v~~i~~~t-~~~~Dv   62 (211)
T cd00429           6 ILSADFANLGEELKRLEEAGADWIHI------------------DVMDGHFVPNLTFG---P-PVVKALRKHT-DLPLDV   62 (211)
T ss_pred             HHHCCHHHHHHHHHHHHHCCCCEEEE------------------ECCCCCCCCCCCCC---H-HHHHHHHHHC-CCCEEE
T ss_conf             53179999999999999769998999------------------57579727866759---8-9999998757-997058


Q ss_pred             EEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC
Q ss_conf             01104542467887765554206755269830333653221100002343211112244455655312688517865057
Q gi|254780434|r  139 NLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISP  218 (362)
Q Consensus       139 sI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsP  218 (362)
                      -++...+     +.|.+.+...  ++|++.+-+-+-           ....+.+..+++.        .  +-..+-|.|
T Consensus        63 HLMv~~P-----~~~i~~~~~~--g~d~I~~H~E~~-----------~~~~~~i~~ik~~--------g--~~~Glal~p  114 (211)
T cd00429          63 HLMVENP-----ERYIEAFAKA--GADIITFHAEAT-----------DHLHRTIQLIKEL--------G--MKAGVALNP  114 (211)
T ss_pred             EEEECCH-----HHHHHHHHHH--CCCEEEECCCCC-----------CCHHHHHHHHHHC--------C--CCCEEEECC
T ss_conf             9987188-----7769999970--998899864322-----------0899999999973--------9--872357548


Q ss_pred             CCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC---CCEEEEEECC
Q ss_conf             7774888999998764498299980665553234577544632211356454246899999997408---9748999678
Q gi|254780434|r  219 DLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVG---PKIAIIGTGG  295 (362)
Q Consensus       219 d~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~---~~i~IIg~GG  295 (362)
                      +.+.+.+..++..     +|.+.+- |           .  + -|.+|....+.++..|+++++...   .++.|.--||
T Consensus       115 ~T~~~~l~~~l~~-----~D~vliM-t-----------V--~-PGf~GQ~f~~~~~~ki~~l~~~~~~~~~~~~I~vDGG  174 (211)
T cd00429         115 GTPVEVLEPYLDE-----VDLVLVM-S-----------V--N-PGFGGQKFIPEVLEKIRKLRELIPENNLNLLIEVDGG  174 (211)
T ss_pred             CCCHHHHHHHHHH-----HCEEEEE-E-----------E--C-CCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             9998999999975-----1522798-7-----------4--6-8878875456799999999999986499859999678


Q ss_pred             CCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHH
Q ss_conf             89999999999839997545278770697899999
Q gi|254780434|r  296 ISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRI  330 (362)
Q Consensus       296 I~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I  330 (362)
                      |.. +.+-+...+|||.+=++|+ +|+.+...+.|
T Consensus       175 I~~-~~i~~l~~~Gad~~V~GS~-iF~~~d~~~~i  207 (211)
T cd00429         175 INL-ETIPLLAEAGADVLVAGSA-LFGSDDYAEAI  207 (211)
T ss_pred             CCH-HHHHHHHHCCCCEEEECHH-HHCCCCHHHHH
T ss_conf             598-9999999859999997937-75899999999


No 249
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=96.35  E-value=0.047  Score=33.66  Aligned_cols=127  Identities=10%  Similarity=0.019  Sum_probs=73.9

Q ss_pred             HHHHHHHHHHC-CCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             87765554206-75526983033365322110000234321111224445565531268851786505777748889999
Q gi|254780434|r  151 LDYVSGIRLFF-TIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIA  229 (362)
Q Consensus       151 ~dy~~~~~~~~-~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia  229 (362)
                      ++-..+++.+. .+..++|+-+.+||...        .+.    .+.....    .....  +.+-..--++.    +-+
T Consensus        28 e~a~~~a~aL~~gGi~~iEiTlrt~~a~~--------~i~----~l~~~~~----~~~p~--~~iGaGTVl~~----~~~   85 (223)
T PRK07114         28 EVAKKVVKACYDGGVRAFEFTNRGDFAHE--------VFG----ELVKYAA----KECPE--MILGVGSIVDA----ATA   85 (223)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHH--------HHH----HHHHHHH----HHCCC--CEEEEECCCCH----HHH
T ss_conf             99999999999889988999588965899--------999----9999998----66898--08965518899----999


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCC
Q ss_conf             98764498299980665553234577544632211356454246899999997408974899967889999999999839
Q gi|254780434|r  230 VEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAG  309 (362)
Q Consensus       230 ~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aG  309 (362)
                      +.+.++|++.++-=++                           ....+.... ..  ++|  -.=|+.|+.++...+.+|
T Consensus        86 ~~a~~aGA~FiVSP~~---------------------------~~~v~~~~~-~~--~~~--~iPGv~TptEi~~A~~~G  133 (223)
T PRK07114         86 ALYIQLGANFVVGPLF---------------------------NEDIAKVCN-RR--KIP--YSPGCGSVSEIGFAEELG  133 (223)
T ss_pred             HHHHHCCCCEEECCCC---------------------------CHHHHHHHH-HC--CCC--CCCCCCCHHHHHHHHHCC
T ss_conf             9999859989999999---------------------------999999999-83--997--537319999999999879


Q ss_pred             CCEEEECHHHHCCCHHHHHHHHH
Q ss_conf             99754527877069789999999
Q gi|254780434|r  310 ANLIQLYSAMIYEGISLPKRIIQ  332 (362)
Q Consensus       310 As~VQi~Tali~~Gp~~~~~I~~  332 (362)
                      |+.|-++-|- .-||..++.+..
T Consensus       134 ~~~vK~FPa~-~~G~~~lkal~~  155 (223)
T PRK07114        134 CEIVKIFPGD-VYGPEFVKAIKG  155 (223)
T ss_pred             CCEEEECCCC-CCCHHHHHHHHC
T ss_conf             9979889732-359999999846


No 250
>PRK06857 consensus
Probab=96.34  E-value=0.099  Score=31.47  Aligned_cols=145  Identities=10%  Similarity=0.154  Sum_probs=83.6

Q ss_pred             HHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHC-CCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             88999876410001210001104542467887765554206-75526983033365322110000234321111224445
Q gi|254780434|r  121 HTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFF-TIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTR  199 (362)
Q Consensus       121 ~~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~-~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~  199 (362)
                      +.+++.|++.+ =.||.. +    ++   .+|...+++.+. .+...+|+-+..|+..        +.+    ..+.+. 
T Consensus         3 ~~ii~~l~~~~-iipVir-~----~~---~~~a~~~~~al~~gGi~~iEiTlrt~~a~--------~~I----~~l~~~-   60 (209)
T PRK06857          3 EQIIEKLRALK-VVPVIA-I----DD---AEDILPLAKVLAENGLPVAEITFRSAAAA--------EAI----RLLREA-   60 (209)
T ss_pred             HHHHHHHHHCC-EEEEEE-C----CC---HHHHHHHHHHHHHCCCCEEEEECCCCCHH--------HHH----HHHHHH-
T ss_conf             99999999799-799997-5----99---99999999999987998899958993299--------999----999975-


Q ss_pred             HHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             56553126885178650577774888999998764498299980665553234577544632211356454246899999
Q gi|254780434|r  200 EEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAK  279 (362)
Q Consensus       200 ~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~  279 (362)
                             ...  +.+-..-=++    .+-++.+.++|++.++--++                           ...++..
T Consensus        61 -------~p~--~~vGaGTV~~----~e~~~~a~~aGA~FiVSP~~---------------------------~~~v~~~  100 (209)
T PRK06857         61 -------YPD--MLIGAGTVLT----PEQVDAAKEAGADFIVSPGF---------------------------NPNTVKY  100 (209)
T ss_pred             -------CCC--CEEEEEECCC----HHHHHHHHHCCCCEEECCCC---------------------------CHHHHHH
T ss_conf             -------899--4899993767----99999999839999990899---------------------------9999999


Q ss_pred             HHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHH
Q ss_conf             99740897489996788999999999983999754527877069789999999
Q gi|254780434|r  280 IRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQ  332 (362)
Q Consensus       280 i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~  332 (362)
                      .++ .  ++|  -.=|+.|+.++...+.+||+.|-++-+-..-|+..++.+..
T Consensus       101 a~~-~--~i~--~iPGv~TpsEi~~A~~~G~~~vKlFPA~~~gG~~~lkal~~  148 (209)
T PRK06857        101 CQQ-L--NIP--IVPGVNNPSLVEQALEMGLTTLKFFPAEASGGVNMLKALLA  148 (209)
T ss_pred             HHH-C--CCC--EECCCCCHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHC
T ss_conf             997-4--996--54787999999999987999899786621266999999865


No 251
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO). In green plants, glycolate oxidase is one of the key enzymes in photorespiration where it oxidizes glycolate to glyoxylate. LMO catalyzes the oxidation of L-lactate to acetate and carbon dioxide. MDH oxidizes (S)-mandelate to phenylglyoxalate. It is an enzyme in the mandelate pathway that occurs in several strains of Pseudomonas which converts (R)-mandelate to benzoate.
Probab=96.34  E-value=0.092  Score=31.66  Aligned_cols=84  Identities=20%  Similarity=0.201  Sum_probs=60.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             17865057777488899999876449829998066555323457754463221135645424689999999740897489
Q gi|254780434|r  211 PIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAI  290 (362)
Q Consensus       211 Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~I  290 (362)
                      |.|..|=+..+.+...++++.++++|+.+++++=   |-     +..        |.   ..+-+-|+++++.++  .|+
T Consensus       117 ~~wfQLY~~~d~~~~~~li~rA~~aG~~al~lTv---D~-----p~~--------g~---R~~w~~i~~l~~~~~--~p~  175 (299)
T cd02809         117 PRWFQLYVPRDREITEDLLRRAEAAGYKALVLTV---DT-----PVL--------GR---RLTWDDLAWLRSQWK--GPL  175 (299)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEC---CC-----CCC--------CC---CCCHHHHHHHHHHCC--CCE
T ss_conf             8467764369999999999999985999899970---58-----987--------88---799999999998669--987


Q ss_pred             EEECCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             99678899999999998399975452
Q gi|254780434|r  291 IGTGGISSTKDALDKIMAGANLIQLY  316 (362)
Q Consensus       291 Ig~GGI~s~~Da~e~l~aGAs~VQi~  316 (362)
                      |- =||.+++||..-..+|||.+.|.
T Consensus       176 i~-KGi~~~~DA~~a~~~G~dgI~VS  200 (299)
T cd02809         176 IL-KGILTPEDALRAVDAGADGIVVS  200 (299)
T ss_pred             EE-ECCCCHHHHHHHHHCCCCEEEEC
T ss_conf             99-72788999999998599889972


No 252
>cd00408 DHDPS-like Dihydrodipicolinate synthase family. A member of the class I aldolases, which use an active-site lysine which stablilzes a reaction intermediate via Schiff base formation, and have TIM beta/alpha barrel fold. The dihydrodipicolinate synthase family comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways and includes such proteins as N-acetylneuraminate lyase, MosA protein, 5-keto-4-deoxy-glucarate dehydratase, trans-o-hydroxybenzylidenepyruvate hydratase-aldolase, trans-2'-carboxybenzalpyruvate hydratase-aldolase, and 2-keto-3-deoxy- gluconate aldolase. The family is also referred to as the N-acetylneuraminate lyase (NAL) family.
Probab=96.30  E-value=0.071  Score=32.43  Aligned_cols=189  Identities=16%  Similarity=0.162  Sum_probs=91.4

Q ss_pred             HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHH-HHCCCCCCEEECCCCC
Q ss_conf             779888740367524102001368789988626884255541000024777778899987641-0001210001104542
Q gi|254780434|r   68 AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKI-QPTSPIGINLGANKDS  146 (362)
Q Consensus        68 ~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~-~~~~pi~vsI~~~~~s  146 (362)
                      .+.++.+.+.|..++.+..-|-+-         +.+            .-.....+.+...+. ....|+++.++.++  
T Consensus        21 ~~~i~~l~~~Gv~gi~v~G~tGE~---------~~L------------s~~Er~~l~~~~~~~~~~~~pvi~gv~~~s--   77 (281)
T cd00408          21 RRLVEFLIEAGVDGLVVLGTTGEA---------PTL------------TDEERKEVIEAVVEAVAGRVPVIAGVGANS--   77 (281)
T ss_pred             HHHHHHHHHCCCCEEEECEECCCH---------HHC------------CHHHHHHHHHHHHHHCCCCCEEEEECCCCC--
T ss_conf             999999997699989968545243---------138------------999999999999998089850999578788--


Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCC-----C
Q ss_conf             46788776555420675526983033365322110000234321111224445565531268851786505777-----7
Q gi|254780434|r  147 KDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDL-----S  221 (362)
Q Consensus       147 ~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~-----~  221 (362)
                      -+...++.+.++++  ++|++-+  ..|....    .+.+.+.+....+.+         ...+||++=-.|..     +
T Consensus        78 ~~~~~~~a~~a~~~--Gad~i~v--~pP~y~~----~~~~~i~~~~~~i~~---------~~~~pi~iYn~P~~~g~~l~  140 (281)
T cd00408          78 TREAIELARHAEEA--GADGVLV--VPPYYNK----PSQEGIVAHFKAVAD---------ASDLPVILYNIPGRTGVDLS  140 (281)
T ss_pred             HHHHHHHHHHHHHC--CCCEEEE--CCCCCCC----CCHHHHHHHHHHHHH---------CCCCCEEEEECCCCCCCCCC
T ss_conf             99999999999975--9998998--7997778----999999999999985---------55997799727753167768


Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHH
Q ss_conf             48889999987644982999806655532345775446322113564542468999999974089748999678899999
Q gi|254780434|r  222 EEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKD  301 (362)
Q Consensus       222 ~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~D  301 (362)
                      .+.+.+++    +  ...|+.+--         ..         |      ....+.++.+..++++.++. |   ....
T Consensus       141 ~~~l~~L~----~--~~nv~giK~---------s~---------~------d~~~~~~~~~~~~~~~~v~~-G---~d~~  186 (281)
T cd00408         141 PETIARLA----E--HPNIVGIKD---------SS---------G------DLDRLTRLIALLGPDFAVLS-G---DDDL  186 (281)
T ss_pred             HHHHHHHH----C--CCCEEEEEC---------CC---------C------CHHHHHHHHHHCCCCCEEEC-C---CHHH
T ss_conf             99999984----8--999899984---------88---------9------99999999997599705626-9---6688


Q ss_pred             HHHHHHCCCCEEEECHHHHCCCHHHHHHHHH
Q ss_conf             9999983999754527877069789999999
Q gi|254780434|r  302 ALDKIMAGANLIQLYSAMIYEGISLPKRIIQ  332 (362)
Q Consensus       302 a~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~  332 (362)
                      ..+.+.+||+-...+++-++  |..+.++.+
T Consensus       187 ~~~~l~~G~~G~i~~~~n~~--P~~~~~l~~  215 (281)
T cd00408         187 LLPALALGADGAISGAANVA--PKLAVALYE  215 (281)
T ss_pred             HHHHHHCCCCCEEECHHHCC--HHHHHHHHH
T ss_conf             99998728981440242316--999999999


No 253
>PRK08091 ribulose-phosphate 3-epimerase; Validated
Probab=96.26  E-value=0.11  Score=31.18  Aligned_cols=213  Identities=11%  Similarity=0.031  Sum_probs=115.5

Q ss_pred             CEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             74853468886779888740367524102001368789988626884255541000024777778899987641000121
Q gi|254780434|r   57 PLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPI  136 (362)
Q Consensus        57 PiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi  136 (362)
                      |=+++|-+..-.+.++++.+.|+-++-+-                  .-|+-.+..++|.   . .++++++.   ..++
T Consensus        17 pSIL~aD~~~L~~ei~~l~~~g~d~lHiD------------------IMDG~FVPNitfg---~-~~v~~l~~---~~~~   71 (235)
T PRK08091         17 VGILAGQWLALHRYLQQLEALNQPLLHFD------------------IMDGQFSPQFTVG---P-WAVGQFPQ---TFIK   71 (235)
T ss_pred             HHHHHHCHHHHHHHHHHHHHCCCCEEEEC------------------CCCCCCCCCCCCC---H-HHHHHHCC---CCCC
T ss_conf             99875189999999999997799999981------------------8588767843228---9-99997374---9997


Q ss_pred             CCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEE--EE
Q ss_conf             0001104542467887765554206755269830333653221100002343211112244455655312688517--86
Q gi|254780434|r  137 GINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPI--FL  214 (362)
Q Consensus       137 ~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi--~v  214 (362)
                      =|-++...     .++|.+.+.  ..++|++.+-+=+.           ..+...+..++.....   ......++  .+
T Consensus        72 DvHLMV~~-----P~~~i~~~~--~aGad~it~H~Ea~-----------~~~~~~i~~i~~~~~~---~~~~~~~~~~Gl  130 (235)
T PRK08091         72 DVHLMVAD-----QWTVAKACV--KAGAHCITLQAEGD-----------IHLHHTLSWLGQQTVP---VIGGEMPVLRGI  130 (235)
T ss_pred             CEEEEECC-----HHHHHHHHH--HCCCCEEEECCCCC-----------CCHHHHHHHHHHHCCH---HHHHHCCCCCEE
T ss_conf             26643388-----899999999--75998999754555-----------5889999999983420---222220750138


Q ss_pred             ECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC---CCCEEEE
Q ss_conf             5057777488899999876449829998066555323457754463221135645424689999999740---8974899
Q gi|254780434|r  215 KISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRV---GPKIAII  291 (362)
Q Consensus       215 KLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~---~~~i~II  291 (362)
                      -|.|+.+.+.+..+...     +|.+.+-            ...  . |.+|..-.+-++.-|+++++..   +.+..|-
T Consensus       131 AlnP~Tpve~l~~~L~~-----vD~VLvM------------tV~--P-GfgGQ~fi~~~l~KI~~l~~~~~~~~~~~~I~  190 (235)
T PRK08091        131 SLCPATPLDVLIPYLSD-----VDVIQLL------------TLD--P-RYGSKMRSSDLHERVAQLLCLLGDKREGKLIV  190 (235)
T ss_pred             EECCCCCHHHHHHHHHH-----CCEEEEE------------EEC--C-CCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             97999988999998705-----3999998------------766--8-98888678789999999999999649991599


Q ss_pred             EECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             96788999999999983999754527877069789999999999999
Q gi|254780434|r  292 GTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFL  338 (362)
Q Consensus       292 g~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l  338 (362)
                      --|||.. +.+-+...||||.+=.+|+ +|+.+. +.+..+.|++.|
T Consensus       191 VDGGI~~-~ti~~~~~aGad~~V~GS~-iF~~~d-~~e~i~~lk~l~  234 (235)
T PRK08091        191 IDGSMTQ-DQLPSLIAQGIDWVVSGSA-LFSDDR-LVENLRSWKAMF  234 (235)
T ss_pred             EECCCCH-HHHHHHHHCCCCEEEECHH-HCCCCC-HHHHHHHHHHHH
T ss_conf             8489898-8899999839999997824-337999-999999999852


No 254
>TIGR01919 hisA-trpF bifunctional HisA/TrpF protein; InterPro: IPR010188   This entry represents a bifunctional protein possessing both hisA (1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase) and trpF (N-(5'phosphoribosyl)anthranilate isomerase) activities . Thus, it is involved in both the histidine and tryptophan biosynthetic pathways. Enzymes with this property have been described only in the Actinobacteria (High-GC Gram-positive). The enzyme is closely related to the monofunctional HisA proteins and in Actinobacteria, the classical monofunctional TrpF is generally absent.; GO: 0003949 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity, 0004640 phosphoribosylanthranilate isomerase activity, 0000105 histidine biosynthetic process, 0000162 tryptophan biosynthetic process, 0005737 cytoplasm.
Probab=96.19  E-value=0.033  Score=34.64  Aligned_cols=85  Identities=21%  Similarity=0.302  Sum_probs=65.4

Q ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             77774888999998764498299980665553234577544632211356454246899999997408974899967889
Q gi|254780434|r  218 PDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGIS  297 (362)
Q Consensus       218 Pd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~  297 (362)
                      +...--++.++.+.+-..|+.-++++.-+  +           -|-||||.|     .+++++.+++  +=|||++|||+
T Consensus       147 W~~dGGDLwevl~~LDS~GCsRfVVTDv~--K-----------DG~lsGPN~-----~LL~eVA~~T--DA~v~ASGGiS  206 (246)
T TIGR01919       147 WESDGGDLWEVLERLDSEGCSRFVVTDVA--K-----------DGTLSGPNV-----ELLAEVAERT--DAPVVASGGIS  206 (246)
T ss_pred             CCCCCCCHHHHHHHHCCCCCCCEEEEECC--C-----------CCCCCCCCH-----HHHHHHHHHC--CCCEEEECCCC
T ss_conf             55788628999987434885403785012--3-----------786678528-----9999988622--88478717756


Q ss_pred             CHHHHHH---HHHCCCCEEEECHHHHCC
Q ss_conf             9999999---998399975452787706
Q gi|254780434|r  298 STKDALD---KIMAGANLIQLYSAMIYE  322 (362)
Q Consensus       298 s~~Da~e---~l~aGAs~VQi~Tali~~  322 (362)
                      +-+|..+   +-..|-+-+-|+-++.-+
T Consensus       207 ~LdDl~~i~~l~~~Gvds~I~GKaLY~~  234 (246)
T TIGR01919       207 KLDDLRAIAKLAEEGVDSAIVGKALYAR  234 (246)
T ss_pred             CHHHHHHHHHHHHCCCCEEEECHHHHHH
T ss_conf             1889999999975588657620255532


No 255
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional
Probab=96.18  E-value=0.022  Score=35.92  Aligned_cols=35  Identities=20%  Similarity=0.256  Sum_probs=25.3

Q ss_pred             CCCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCC
Q ss_conf             599748534688867798887403675241020013
Q gi|254780434|r   54 LSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTP   89 (362)
Q Consensus        54 ~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~   89 (362)
                      ..-|+-++.|. ++.+.++.++++|+.-|+++|...
T Consensus        72 ~~~piqvGGGI-rs~e~i~~~l~~Ga~kViigt~a~  106 (228)
T PRK04128         72 TGLKVQVGGGF-RTYESIKDAYEIGVENVIIGTKAF  106 (228)
T ss_pred             CCCEEEECCCC-CCHHHHHHHHHCCCCEEEECCCCC
T ss_conf             49628973860-779999999968997698145125


No 256
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed
Probab=96.12  E-value=0.047  Score=33.63  Aligned_cols=229  Identities=17%  Similarity=0.202  Sum_probs=117.1

Q ss_pred             CCCEEEECCEECCC-CEEECCCCC-C-CHHH----HHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCC
Q ss_conf             63116888733599-748534688-8-6779----888740367524102001368789988626884255541000024
Q gi|254780434|r   43 PRLNTKVAGISLSN-PLGMAAGYD-K-NAEV----PIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGF  115 (362)
Q Consensus        43 ~~L~~~~~Gl~~~n-PiglAaG~d-k-~~~~----~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl  115 (362)
                      .+-.+++.|++|-. .+.+-||+. - +-+.    .+.+.+.|....--|-  .+||+ +  |              +.|
T Consensus        78 ~~t~i~v~~~~iGg~~~~iiAGPCsvEs~eq~~~~A~~vk~~ga~~lRgGa--~KPRT-s--P--------------ysF  138 (335)
T PRK08673         78 EPTIVKVGDVEIGGGKPVVIAGPCSVESEEQILEIARAVKEAGAQILRGGA--FKPRT-S--P--------------YSF  138 (335)
T ss_pred             CCCEEEECCEEECCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEECCCC--CCCCC-C--C--------------CCC
T ss_conf             897799799998898536996178678799999999999977996880666--57899-9--8--------------541


Q ss_pred             CCCCHHHHHHHHHHH--HHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             777778899987641--000121000110454246788776555420675526983033365322110000234321111
Q gi|254780434|r  116 NNAGYHTVFSRLSKI--QPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLI  193 (362)
Q Consensus       116 ~N~G~~~~~~~l~~~--~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~  193 (362)
                      +-.|.+ -++-|++.  ..+.|+..-|+-.       .    -++.+..++|.+-|        |-|.+|+.+.|.++  
T Consensus       139 qGlg~e-GL~~L~~~~~e~GlpvvTEV~~~-------~----~ve~v~~~vDilQI--------GARnmqN~~LL~ev--  196 (335)
T PRK08673        139 QGLGEE-GLKLLAEAREETGLPIVTEVMDP-------R----DVELVAEYADILQI--------GARNMQNFDLLKEV--  196 (335)
T ss_pred             CCCCHH-HHHHHHHHHHHHCCCEEEEECCH-------H----HHHHHHHHCCEEEE--------CHHHHCCHHHHHHH--
T ss_conf             455166-99999999998699528996689-------9----99999964979998--------91550599999999--


Q ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             22444556553126885178650577774888999998764498299980665553234577544632211356454246
Q gi|254780434|r  194 HVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKS  273 (362)
Q Consensus       194 ~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~a  273 (362)
                                  ..+.+||++|=+...+-++....++.+...|..-+++|-.     ++.+...       +++...+  
T Consensus       197 ------------g~~~kPVllKrg~~~ti~ewl~AaEyi~~~Gn~~ViLcER-----Girtfe~-------~tRntlD--  250 (335)
T PRK08673        197 ------------GKTNKPVLLKRGMSATIEEWLMAAEYILAEGNPNVILCER-----GIRTFET-------ATRNTLD--  250 (335)
T ss_pred             ------------HHHCCEEEECCCCCCCHHHHHHHHHHHHHCCCCCEEEEEC-----CCCCCCC-------CCCCCCC--
T ss_conf             ------------9729948973788788999987899999769986799934-----6545676-------6678778--


Q ss_pred             HHHHHHHHHHCCCCEEEEE----ECCCCCHH--HHHHHHHCCCCEEEECHH-----HHCCC-----HHHHHHHHHHHHHH
Q ss_conf             8999999974089748999----67889999--999999839997545278-----77069-----78999999999999
Q gi|254780434|r  274 TIALAKIRQRVGPKIAIIG----TGGISSTK--DALDKIMAGANLIQLYSA-----MIYEG-----ISLPKRIIQGLSDF  337 (362)
Q Consensus       274 l~~i~~i~~~~~~~i~IIg----~GGI~s~~--Da~e~l~aGAs~VQi~Ta-----li~~G-----p~~~~~I~~~L~~~  337 (362)
                      +..|-.+++..  ++|||.    ..|-.+.-  =+..-+.+|||-+.+=+-     .+..|     |.-+.++.++|+..
T Consensus       251 l~aip~~k~~t--hlPVI~DPSH~~G~r~~V~~la~aAiAaGaDGL~iEvHp~P~~AlSDg~Q~l~p~~f~~l~~~l~~i  328 (335)
T PRK08673        251 LSAVPVLKKLT--HLPVIVDPSHATGKRDLVEPLALAAVAAGADGLIVEVHPDPEKALSDGPQSLTPEEFEELMKKLRAI  328 (335)
T ss_pred             HHHHHHHHHCC--CCCEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCHHHCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             78889997188--9888988822036332289999999980998899995688121468742368999999999999999


Q ss_pred             HHH
Q ss_conf             998
Q gi|254780434|r  338 LNK  340 (362)
Q Consensus       338 l~~  340 (362)
                      .+.
T Consensus       329 ~~~  331 (335)
T PRK08673        329 AEA  331 (335)
T ss_pred             HHH
T ss_conf             998


No 257
>PRK08005 ribulose-phosphate 3-epimerase; Validated
Probab=96.08  E-value=0.13  Score=30.59  Aligned_cols=205  Identities=15%  Similarity=0.210  Sum_probs=116.6

Q ss_pred             CCEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             97485346888677988874036752410200136878998862688425554100002477777889998764100012
Q gi|254780434|r   56 NPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSP  135 (362)
Q Consensus        56 nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~p  135 (362)
                      +|=+++|-+..-++.++.+.+.|+..+-+-                  .-|+-.+..+.|.   . .+.+.+++.. +.|
T Consensus         4 sPSil~ad~~~L~~ei~~l~~~g~d~lHiD------------------IMDG~FVPNitfg---~-~~v~~ir~~t-~~p   60 (210)
T PRK08005          4 HPSLASADPLRYAEALTALHDAPLGSLHLD------------------IEDTSFINNITFG---M-KTIQAVAQYT-RHP   60 (210)
T ss_pred             EHHHHHHCHHHHHHHHHHHHHCCCCEEEEE------------------CCCCCCCCCCCCC---H-HHHHHHHHCC-CCC
T ss_conf             655654489999999999997799989982------------------8889827745629---8-9999998618-998


Q ss_pred             CCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             10001104542467887765554206755269830333653221100002343211112244455655312688517865
Q gi|254780434|r  136 IGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLK  215 (362)
Q Consensus       136 i~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vK  215 (362)
                      +=+-++.+.+     ++|.+.+.+.  ++|++.+-+-+-+           ...+.+..+++         .. +-..+-
T Consensus        61 ~DvHLMv~~P-----~~~i~~~~~~--g~d~it~H~Ea~~-----------~~~~~i~~Ik~---------~g-~k~GlA  112 (210)
T PRK08005         61 LSFHLMVSSP-----QRWLPWLAAI--RPGWIFIHAESVQ-----------NPSEILADIRA---------IG-AKAGLA  112 (210)
T ss_pred             EEEEEEECCH-----HHHHHHHHHC--CCCEEEEECCCCC-----------CHHHHHHHHHH---------CC-CEEEEE
T ss_conf             0799986888-----9999999972--9985999356776-----------99999999997---------49-807888


Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECC
Q ss_conf             05777748889999987644982999806655532345775446322113564542468999999974089748999678
Q gi|254780434|r  216 ISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGG  295 (362)
Q Consensus       216 LsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GG  295 (362)
                      |.|+.+.+.+..++.     -+|.+.+- |           ...   |.+|..-.+.++.-|+++|+... +..|..-||
T Consensus       113 lnP~T~i~~~~~~l~-----~vD~VLvM-t-----------V~P---Gf~GQ~Fi~~~~~KI~~~r~~~~-~~~I~vDGG  171 (210)
T PRK08005        113 LNPATPLLPYRYLAL-----QLDALMIM-T-----------SEP---DGRGQQFIAAMCEKVSQSREHFP-AAECWADGG  171 (210)
T ss_pred             ECCCCCHHHHHHHHH-----CCCEEEEE-E-----------ECC---CCCCCCCCHHHHHHHHHHHHHCC-CCCEEEECC
T ss_conf             379998799873040-----07989998-7-----------789---99872117889999999996287-788899788


Q ss_pred             CCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHH
Q ss_conf             8999999999983999754527877069789999999999
Q gi|254780434|r  296 ISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLS  335 (362)
Q Consensus       296 I~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~  335 (362)
                      |.. +-+-+...||||.+=++|++ |+-+..-..| ++|+
T Consensus       172 In~-~t~~~~~~aGad~~V~GSai-F~~~d~~~~i-~~lr  208 (210)
T PRK08005        172 ITL-RAARLLAAAGAQHLVIGRAL-FTTANYDVTL-SQFT  208 (210)
T ss_pred             CCH-HHHHHHHHCCCCEEEECHHH-HCCCCHHHHH-HHHH
T ss_conf             788-99999998699999979065-3699999999-9986


No 258
>TIGR01182 eda 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4.1.3.16 from EC) (KHG-aldolase) catalyzes the interconversion of 4-hydroxy-2-oxoglutarate into pyruvate and glyoxylate. Phospho-2-dehydro-3-deoxygluconate aldolase (4.1.2.14 from EC) (KDPG-aldolase) catalyzes the interconversion of 6-phospho-2-dehydro-3-deoxy-D-gluconate into pyruvate and glyceraldehyde 3-phosphate. These two enzymes are structurally and functionally related . They are both homotrimeric proteins of approximately 220 amino-acid residues. They are class I aldolases whose catalytic mechanism involves the formation of a Schiff-base intermediate between the substrate and the epsilon-amino group of a lysine residue. In both enzymes, an arginine is required for catalytic activity.; GO: 0003824 catalytic activity, 0008152 metabolic process.
Probab=96.04  E-value=0.054  Score=33.22  Aligned_cols=176  Identities=16%  Similarity=0.191  Sum_probs=97.8

Q ss_pred             CCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHH-CCCCCCEEEC
Q ss_conf             888677988874036752410200136878998862688425554100002477777889998764100-0121000110
Q gi|254780434|r   64 YDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQP-TSPIGINLGA  142 (362)
Q Consensus        64 ~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~-~~pi~vsI~~  142 (362)
                      .+.-..+.+.|.+-|...+|+   |                          |.++.....++.|++..+ +..||+   +
T Consensus        19 ~~~A~~lA~aL~egG~~~~Ev---T--------------------------lRT~~A~~aI~~l~~~~P~~~~iGA---G   66 (205)
T TIGR01182        19 VEDALPLAKALIEGGLRVLEV---T--------------------------LRTPVALEAIRALRKEVPKDALIGA---G   66 (205)
T ss_pred             HHHHHHHHHHHHHCCCEEEEE---E--------------------------ECCCCHHHHHHHHHHHCCCCCEECC---C
T ss_conf             877789999998679808988---5--------------------------1472168999999972823348716---7


Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCH
Q ss_conf             45424678877655542067552698303336532211000023432111122444556553126885178650577774
Q gi|254780434|r  143 NKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSE  222 (362)
Q Consensus       143 ~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~  222 (362)
                      +      +-+-.++.+....+|||+   + ||+           .-.++++..          ....+|++==+.   +-
T Consensus        67 T------VL~~~Q~~~A~~AGA~F~---v-SPG-----------~~p~l~~~~----------~~~~~P~iPGV~---tp  112 (205)
T TIGR01182        67 T------VLNPEQLRQAVAAGAQFI---V-SPG-----------LTPELAKHA----------KDKGIPIIPGVA---TP  112 (205)
T ss_pred             C------CCCHHHHHHHHHCCCCEE---E-CCC-----------CCHHHHHHH----------HHCCCCEECCCC---CH
T ss_conf             6------489899999997089578---7-697-----------888999998----------508881217776---87


Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHH
Q ss_conf             88899999876449829998066555323457754463221135645424689999999740897489996788999999
Q gi|254780434|r  223 EELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDA  302 (362)
Q Consensus       223 ~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da  302 (362)
                         -+ +..|.++|++-+=++                 ....+|-      ..+++-++.=+ +++..+=.|||+- ..+
T Consensus       113 ---sE-i~~Al~~G~~~lKlF-----------------PAe~~GG------~~~lkAL~GPf-~~v~F~PTGGi~l-~N~  163 (205)
T TIGR01182       113 ---SE-IMLALELGITALKLF-----------------PAEVVGG------VKMLKALAGPF-PQVRFCPTGGINL-DNA  163 (205)
T ss_pred             ---HH-HHHHHHCCCCEEEEC-----------------CCCCCCH------HHHHHHHCCCC-CCCCCCCCCCCCH-HHH
T ss_conf             ---89-999987577465212-----------------5623530------89999731657-8984514799988-789


Q ss_pred             HHHHHCCCCEEEECHHHHCC------CHHHHHHHHHHH
Q ss_conf             99998399975452787706------978999999999
Q gi|254780434|r  303 LDKIMAGANLIQLYSAMIYE------GISLPKRIIQGL  334 (362)
Q Consensus       303 ~e~l~aGAs~VQi~Tali~~------Gp~~~~~I~~~L  334 (362)
                      .|||.+++=+|-.+|.|+=.      .+.-++++.++.
T Consensus       164 ~~YLa~p~v~c~GGSWl~P~~~~~~g~wd~i~~l~r~a  201 (205)
T TIGR01182       164 RDYLALPNVACVGGSWLVPKDLIAAGDWDEITELAREA  201 (205)
T ss_pred             HHHHCCCCEEEEECCCCCCHHHHHCCCHHHHHHHHHHH
T ss_conf             99971893799816314647887589967999999999


No 259
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism]
Probab=96.02  E-value=0.14  Score=30.39  Aligned_cols=227  Identities=18%  Similarity=0.207  Sum_probs=122.7

Q ss_pred             CEEEECCEECCCC--EEECCCCC--CCHHHHHHHH----HCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCC
Q ss_conf             1168887335997--48534688--8677988874----03675241020013687899886268842555410000247
Q gi|254780434|r   45 LNTKVAGISLSNP--LGMAAGYD--KNAEVPIELL----KLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFN  116 (362)
Q Consensus        45 L~~~~~Gl~~~nP--iglAaG~d--k~~~~~~~l~----~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~  116 (362)
                      --+++.+.....+  +.++||+.  .+.|++....    ..|.-++--|.  .+||+ +                -+.|+
T Consensus        31 tivd~~~~~~g~~~~~~viAGPCsvEs~E~i~~~A~~vk~~Ga~~lRGga--fKPRT-S----------------PYsFQ   91 (286)
T COG2876          31 TIVDVGDVVIGEGRALRVIAGPCSVESEEQVRETAESVKAAGAKALRGGA--FKPRT-S----------------PYSFQ   91 (286)
T ss_pred             EEECCCCCEECCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCHHHCCCCC--CCCCC-C----------------CCCCC
T ss_conf             13204552005886138995474247799999999999873622313776--78889-9----------------53336


Q ss_pred             CCCHHHHHHHHHHHH--HCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             777788999876410--001210001104542467887765554206755269830333653221100002343211112
Q gi|254780434|r  117 NAGYHTVFSRLSKIQ--PTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIH  194 (362)
Q Consensus       117 N~G~~~~~~~l~~~~--~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~  194 (362)
                      ..|.+. ++.+++.+  .+.|+..-|+.       ..|    ++.+.+++|.+-|        |-|.+|+=+.|.+.   
T Consensus        92 Glge~g-L~~l~~a~~~~Gl~vvtEvm~-------~~~----~e~~~~y~Dilqv--------GARNMQNF~LLke~---  148 (286)
T COG2876          92 GLGEEG-LKLLKRAADETGLPVVTEVMD-------VRD----VEAAAEYADILQV--------GARNMQNFALLKEV---  148 (286)
T ss_pred             CCCHHH-HHHHHHHHHHCCCEEEEEECC-------HHH----HHHHHHHHHHHHH--------CCCCHHHHHHHHHH---
T ss_conf             657788-999999888729905889548-------989----9999866169886--------33200516999982---


Q ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             24445565531268851786505777748889999987644982999806655532345775446322113564542468
Q gi|254780434|r  195 VMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKST  274 (362)
Q Consensus       195 v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al  274 (362)
                                 ...++||++|=.+--|-++....|+-....|-..+++|-.     ++.+....+       +  .-.-+
T Consensus       149 -----------G~~~kPvLLKRg~~aTieEwL~AAEYI~s~GN~~vILCER-----GIRtfe~~T-------R--ntLDi  203 (286)
T COG2876         149 -----------GRQNKPVLLKRGLSATIEEWLNAAEYILSHGNGNVILCER-----GIRTFEKAT-------R--NTLDI  203 (286)
T ss_pred             -----------CCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC-----CCCCCCCCC-------C--CEECH
T ss_conf             -----------3559976972474124999999999999679995799714-----433455566-------6--42236


Q ss_pred             HHHHHHHHHCCCCEEEEEECCCCCHHH------HHHHHHCCCCEEEEC------HHH----HCCCHHHHHHHHHHHHHHH
Q ss_conf             999999974089748999678899999------999998399975452------787----7069789999999999999
Q gi|254780434|r  275 IALAKIRQRVGPKIAIIGTGGISSTKD------ALDKIMAGANLIQLY------SAM----IYEGISLPKRIIQGLSDFL  338 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~IIg~GGI~s~~D------a~e~l~aGAs~VQi~------Tal----i~~Gp~~~~~I~~~L~~~l  338 (362)
                      ..|..+++.+  ++|||.-=-=.++++      |..-+.+|||-+++-      .|+    -.-.|.-+.++.+++..+.
T Consensus       204 ~aV~~~kq~T--HLPVivDpSH~~Grr~lv~pla~AA~AaGAdglmiEVHp~P~~AlsD~~Qql~~~~f~~l~~~~~~~~  281 (286)
T COG2876         204 SAVPILKQET--HLPVIVDPSHATGRRDLVEPLAKAAIAAGADGLMIEVHPDPEKALSDAKQQLTPEEFEELVKELRALA  281 (286)
T ss_pred             HHHHHHHHHC--CCCEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             8888887615--78779878776553135788899998616773699964795434576000179999999999998776


Q ss_pred             HH
Q ss_conf             98
Q gi|254780434|r  339 NK  340 (362)
Q Consensus       339 ~~  340 (362)
                      +.
T Consensus       282 ~~  283 (286)
T COG2876         282 DA  283 (286)
T ss_pred             HH
T ss_conf             54


No 260
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional
Probab=95.98  E-value=0.12  Score=30.84  Aligned_cols=91  Identities=20%  Similarity=0.240  Sum_probs=54.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEC--CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             786505777748889999987644982999806--655532345775446322113564542468999999974089748
Q gi|254780434|r  212 IFLKISPDLSEEELDDIAVEVLSHKVEGIIVSN--TTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIA  289 (362)
Q Consensus       212 i~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~N--T~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~  289 (362)
                      .++-+|-+    ...++. .+.+.|+|=+.+.-  .|..++         ..    +   .|..+..+.+..+.. .++|
T Consensus       103 ~iIG~S~h----~~~e~~-~A~~~gaDYig~Gpif~T~TK~---------~~----~---~p~G~~~l~~~~~~~-~~iP  160 (211)
T PRK03512        103 LRLGVSTH----DDMEID-VALAARPSYIALGHVFPTQTKQ---------MP----S---APQGLAQLARHVERL-ADYP  160 (211)
T ss_pred             CEEEEECC----CHHHHH-HHHHCCCCEEEECCCCCCCCCC---------CC----C---CCCHHHHHHHHHHHC-CCCC
T ss_conf             78997429----999999-9986499839985633458878---------99----8---872499999999971-7999


Q ss_pred             EEEECCCCCHHHHHHHHHCCCCEEEECHHHHC-CCHH
Q ss_conf             99967889999999999839997545278770-6978
Q gi|254780434|r  290 IIGTGGISSTKDALDKIMAGANLIQLYSAMIY-EGIS  325 (362)
Q Consensus       290 IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~-~Gp~  325 (362)
                      +++.||| +.+++.+.+.+||+-|-|.|+++. +.|.
T Consensus       161 vvAIGGI-~~~n~~~v~~~Ga~gvAViSaI~~a~dp~  196 (211)
T PRK03512        161 TVAIGGI-SLERAPAVLATGVGSIAVVSAITQAADWR  196 (211)
T ss_pred             EEEECCC-CHHHHHHHHHCCCCEEEEEHHHHCCCCHH
T ss_conf             8998896-89999999983999999951874699999


No 261
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase  FabD. NPD is part of the nitroalkaneoxidizing enzyme family, that catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDPs are members of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative  electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.
Probab=95.98  E-value=0.15  Score=30.27  Aligned_cols=51  Identities=22%  Similarity=0.214  Sum_probs=35.4

Q ss_pred             CCCHHHHHHHHHHHHHC--CCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHH
Q ss_conf             45424689999999740--8974899967889999999999839997545278
Q gi|254780434|r  268 PLFLKSTIALAKIRQRV--GPKIAIIGTGGISSTKDALDKIMAGANLIQLYSA  318 (362)
Q Consensus       268 ~i~~~al~~i~~i~~~~--~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Ta  318 (362)
                      .|.|.-+++=.++....  ...+-|=+.|||-|++-|..-++.||+.|.-+|-
T Consensus       198 ~LlP~i~~LRd~~~~~~~y~~~iRvGaAGGIGTP~aaaAAF~mGA~yVvTGSI  250 (418)
T cd04742         198 VLLPTIIRLRDELAARYGYRRPIRVGAAGGIGTPEAAAAAFALGADFIVTGSI  250 (418)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCEECCCCCCCCHHHHHHHHHCCCCEEEECCH
T ss_conf             89899999999999861888884110358879879999999717744895553


No 262
>PRK04180 pyridoxine biosynthesis protein; Provisional
Probab=95.95  E-value=0.013  Score=37.32  Aligned_cols=73  Identities=15%  Similarity=0.201  Sum_probs=52.3

Q ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHH------------------CCCHHHHHHHHHHHH
Q ss_conf             89999999740897489996788999999999983999754527877------------------069789999999999
Q gi|254780434|r  274 TIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMI------------------YEGISLPKRIIQGLS  335 (362)
Q Consensus       274 l~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali------------------~~Gp~~~~~I~~~L~  335 (362)
                      ..++.++++.-.--++-.+.|||.|+.||.-++-.|||-|=++|+..                  |+.|.++.++-++|.
T Consensus       192 ~elv~~v~~~grLPVvnFaAGGiATPADAALmMqLG~dGVFVGSGIFKS~dP~~rA~AIV~A~thy~dp~~laevS~~Lg  271 (293)
T PRK04180        192 YELVKEVARLGRLPVVNFAAGGIATPADAALMMQLGADGVFVGSGIFKSGNPEKRAKAIVEATTHYDDPEVLAEVSKGLG  271 (293)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHCC
T ss_conf             89999999848876255325775780569999871787467545434679988999999999852378999999986126


Q ss_pred             HHHHHCCCCCH
Q ss_conf             99998389977
Q gi|254780434|r  336 DFLNKENEVNF  346 (362)
Q Consensus       336 ~~l~~~G~~si  346 (362)
                      +-|.--..+++
T Consensus       272 eaM~Gi~i~~l  282 (293)
T PRK04180        272 EAMVGIDIDEL  282 (293)
T ss_pred             CCCCCCCCCCC
T ss_conf             56678860329


No 263
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=95.93  E-value=0.11  Score=31.14  Aligned_cols=135  Identities=13%  Similarity=0.118  Sum_probs=82.0

Q ss_pred             HHHHHHHHHH-CCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             8776555420-675526983033365322110000234321111224445565531268851786505777748889999
Q gi|254780434|r  151 LDYVSGIRLF-FTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIA  229 (362)
Q Consensus       151 ~dy~~~~~~~-~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia  229 (362)
                      ++...+++.+ ..+...+|+-+..|+..        +.+    ..+.+.        ...  +.+-..-=++    .+-+
T Consensus        27 ~~a~~~~~al~~gGi~~iEITlrt~~a~--------~~I----~~l~~~--------~p~--~~vGaGTVl~----~e~~   80 (212)
T PRK06015         27 EHAVPLARALARGGLPAIEITLRTPAAL--------DAI----RAVAAE--------VEE--AIVGAGTILN----AKQF   80 (212)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHH--------HHH----HHHHHH--------CCC--CEEEEEECCC----HHHH
T ss_conf             9999999999987998899968995199--------999----999986--------999--6795421156----9999


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCC
Q ss_conf             98764498299980665553234577544632211356454246899999997408974899967889999999999839
Q gi|254780434|r  230 VEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAG  309 (362)
Q Consensus       230 ~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aG  309 (362)
                      +.+.++|++.++.-++                           ....+...+ ..  ++|.  .=|+.|+.++...+.+|
T Consensus        81 ~~a~~aGA~FiVSP~~---------------------------~~~v~~~a~-~~--~i~~--iPGv~TpsEi~~A~~~G  128 (212)
T PRK06015         81 EDAAKAGSRFIVSPGT---------------------------TQELLAAAN-DS--DVPL--LPGAITPSEVMALREEG  128 (212)
T ss_pred             HHHHHCCCCEEECCCC---------------------------CHHHHHHHH-HC--CCCE--ECCCCCHHHHHHHHHCC
T ss_conf             9999849989985899---------------------------999999999-83--9977--37869999999999879


Q ss_pred             CCEEEECHHHHCCCHHHHHHHH----------------HHHHHHHHHCCC
Q ss_conf             9975452787706978999999----------------999999998389
Q gi|254780434|r  310 ANLIQLYSAMIYEGISLPKRII----------------QGLSDFLNKENE  343 (362)
Q Consensus       310 As~VQi~Tali~~Gp~~~~~I~----------------~~L~~~l~~~G~  343 (362)
                      ++.|-++-+-..-||..++.+.                +.+.+||+..++
T Consensus       129 ~~~vKlFPA~~~gG~~~lkal~~p~p~~~~~ptGGV~~~N~~~yl~~~~v  178 (212)
T PRK06015        129 YTVLKFFPAEQAGGAAFLKALSSPLAGTFFCPTGGISLKNARDYLSLPNV  178 (212)
T ss_pred             CCEEEECCCCCCCCHHHHHHHHCCCCCCCEEECCCCCHHHHHHHHCCCCE
T ss_conf             99899784300168999999857799998886289898889999808981


No 264
>PRK12330 oxaloacetate decarboxylase; Provisional
Probab=95.90  E-value=0.16  Score=30.05  Aligned_cols=181  Identities=17%  Similarity=0.200  Sum_probs=92.0

Q ss_pred             HHHHHHHCCCC-----CCEEEC-CCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             87641000121-----000110-454246788776555420675526983033365322110000234321111224445
Q gi|254780434|r  126 RLSKIQPTSPI-----GINLGA-NKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTR  199 (362)
Q Consensus       126 ~l~~~~~~~pi-----~vsI~~-~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~  199 (362)
                      .+++.-++.|+     |.|+-+ ..-.+|-++.|++..  ...+.|.+-+- -+        +.|..++..-..++++.-
T Consensus        69 ~lr~~~pnt~lQmLlRG~N~vGy~~ypddvv~~fv~~~--~~~GidifRiF-Da--------LNdv~Nm~~ai~~vk~~G  137 (499)
T PRK12330         69 TFRKLMPNSKLQMLLRGQNLLGYRHYEDEVVDRFVEKS--AENGMDVFRVF-DA--------LNDLRNLETSIKAVKKTG  137 (499)
T ss_pred             HHHHHCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHH--HHCCCCEEEEE-CC--------CCCHHHHHHHHHHHHHCC
T ss_conf             99986779732313133550564258879999999999--97699889972-44--------445777899999999718


Q ss_pred             HHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             56553126885178650577774888999998764498299980665553234577544632211356454246899999
Q gi|254780434|r  200 EEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAK  279 (362)
Q Consensus       200 ~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~  279 (362)
                      ..      ...-|---.||--+.+...++++.+++.|+|.|.+-.    +.++..+               ..+-.+|..
T Consensus       138 ~~------~q~~i~yt~sPvht~~yy~~~ak~l~~~G~d~i~IKD----mAGll~P---------------~~a~~LV~~  192 (499)
T PRK12330        138 KH------AQGTICYTVSPIHTTEGFVEQAKRLLDMGCDSICIKD----MAALLKP---------------QPAYDLVKG  192 (499)
T ss_pred             CE------EEEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEC----CCCCCCH---------------HHHHHHHHH
T ss_conf             85------8999996058877899999999999975999899847----5346788---------------999999999


Q ss_pred             HHHHCCCCEEEEEECCCCCH---HHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99740897489996788999---999999983999754527877069789999999999999983899
Q gi|254780434|r  280 IRQRVGPKIAIIGTGGISST---KDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEV  344 (362)
Q Consensus       280 i~~~~~~~i~IIg~GGI~s~---~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~  344 (362)
                      +++.+++++||==-.=-.+|   .-.++-+.||||.|..+..-+-.|.....-  ..+-..|+..||+
T Consensus       193 lk~~~g~d~pI~~HtH~T~G~~~~~~l~AieAGvDivD~A~~~~s~gtsqp~~--~s~va~L~~t~~d  258 (499)
T PRK12330        193 IKEACGPDTRVHVHAHATTGVTLVSLMKAIEAGVDVVDTAISSMSLGPGHNPT--ESLVEMLEGTGYT  258 (499)
T ss_pred             HHHHCCCCCCEEEECCCCCCHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCH--HHHHHHHHCCCCC
T ss_conf             99863899837985178874699999999984998872445432379889979--9999998578988


No 265
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional
Probab=95.88  E-value=0.16  Score=30.00  Aligned_cols=184  Identities=23%  Similarity=0.312  Sum_probs=106.8

Q ss_pred             EECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCC
Q ss_conf             42555410000247777788999876410001210001104542467887765554206755269830333653221100
Q gi|254780434|r  103 LTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSL  182 (362)
Q Consensus       103 ~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~  182 (362)
                      ..-|+-.+..++|   |. .+++.+++..++.|+=|-++.+.+     ++|.+.+.  ..++|++.+-+=|.+       
T Consensus        37 DImDG~FVpN~t~---g~-~~v~~ir~~~~~~~lDvHLMv~~P-----~~~i~~~~--~~gad~I~~H~E~~~-------   98 (224)
T PTZ00170         37 DVMDGHFVPNLSF---GP-PVVSSLRKHLPNTFLDVHLMVSDP-----ERWVDSFA--KAGASQFTFHIEATE-------   98 (224)
T ss_pred             ECCCCCCCCCCCC---CH-HHHHHHHHHCCCCCEEEEEEECCH-----HHHHHHHH--HCCCCEEEECCCCCC-------
T ss_conf             4405850776574---97-899999971799864689986388-----88799998--628967998500133-------


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             00234321111224445565531268851786505777748889999987644982999806655532345775446322
Q gi|254780434|r  183 QKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDG  262 (362)
Q Consensus       183 ~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~G  262 (362)
                          ...+.+..+++.        .  +-..+-|.|+.+.+.+..+++   +.-+|.|.+--            ...   
T Consensus        99 ----~~~~~i~~ik~~--------g--~k~GlAlnP~T~i~~l~~~l~---~~~iD~VLlMs------------V~P---  146 (224)
T PTZ00170         99 ----DPKAVARKIRAA--------G--MQVGVALKPKTPAEELFPLID---AGLVDMVLVMT------------VEP---  146 (224)
T ss_pred             ----CHHHHHHHHHHH--------C--CCEEEEECCCCCHHHHHHHHH---HCCCCEEEEEE------------ECC---
T ss_conf             ----999999999971--------4--764556079998799999971---14457899985------------569---


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHH
Q ss_conf             113564542468999999974089748999678899999999998399975452787706978999999999999998
Q gi|254780434|r  263 GLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNK  340 (362)
Q Consensus       263 GlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~  340 (362)
                      |.+|..-.+-++.-|+++|+.. +++.|---|||.. +-+-+...+|||.+=++|+ +|+.+.. ++-.+.|++-.++
T Consensus       147 Gf~GQ~Fi~~~l~KI~~lr~~~-~~~~I~VDGGIn~-~ti~~l~~aGad~~V~GSa-iF~~~d~-~~~i~~lr~~i~~  220 (224)
T PTZ00170        147 GFGGQSFMHDMMPKVRQLRQRY-PHLNIQVDGGINP-DTIDLAAEAGANVIVAGTS-IFKANDR-KESIETLRRSVQK  220 (224)
T ss_pred             CCCCCCCCHHHHHHHHHHHHCC-CCCEEEEECCCCH-HHHHHHHHCCCCEEEECHH-HHCCCCH-HHHHHHHHHHHHH
T ss_conf             9876214588999999998548-9975999589998-9999999869999997858-8679999-9999999999997


No 266
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. Members of this protein family are 4-hydroxy-2-oxovalerate aldolase, also called 4-hydroxy-2-ketovalerate aldolase and 2-oxo-4-hydroxypentanoate aldolase. This enzyme, part of the pathway for the meta-cleavage of catechol, produces pyruvate and acetaldehyde. Acetaldehyde is then converted by acetaldehyde dehydrogenase (acylating) (DmpF; EC 1.2.1.10) to acetyl-CoA. The two enzymes are tightly associated.
Probab=95.85  E-value=0.17  Score=29.90  Aligned_cols=216  Identities=13%  Similarity=0.107  Sum_probs=111.8

Q ss_pred             HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCH
Q ss_conf             77988874036752410200136878998862688425554100002477777889998764100012100011045424
Q gi|254780434|r   68 AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSK  147 (362)
Q Consensus        68 ~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~  147 (362)
                      .+..+.+.++|+-.+|++.-.     |-+...          .+ .||+...-..+.+.+........+.+-....   -
T Consensus        27 ~~ia~~Ld~aGVd~IEvg~g~-----g~~~ss----------~~-~g~~~~~d~e~i~~~~~~~~~ak~~~l~~pg---~   87 (333)
T TIGR03217        27 RAIAAALDEAGVDAIEVTHGD-----GLGGSS----------FN-YGFSAHTDLEYIEAAADVVKRAKVAVLLLPG---I   87 (333)
T ss_pred             HHHHHHHHHCCCCEEEEECCC-----CCCCCC----------CC-CCCCCCCCHHHHHHHHHHHCCCCEEEEECCC---C
T ss_conf             999999997198989960688-----888874----------33-5788899499999999874248056996478---6


Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHH
Q ss_conf             67887765554206755269830333653221100002343211112244455655312688517865057777488899
Q gi|254780434|r  148 DFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDD  227 (362)
Q Consensus       148 ~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~  227 (362)
                      ....|.. .  ....++|.+-+-..|-..         +...+.   +...     .+....+-.++-++...+.+.+.+
T Consensus        88 ~~~~dl~-~--a~~~gv~~vri~~~~te~---------d~~~~~---i~~a-----k~~G~~v~~~~~~s~~~~~e~l~~  147 (333)
T TIGR03217        88 GTVHDLK-A--AYDAGARTVRVATHCTEA---------DVSEQH---IGMA-----RELGMDTVGFLMMSHMTPPEKLAE  147 (333)
T ss_pred             CCHHHHH-H--HHHCCCCEEEEEECCCHH---------HHHHHH---HHHH-----HHCCCEEEEEEEECCCCCHHHHHH
T ss_conf             6699999-9--996699978986316678---------889999---9999-----976980999975056899999999


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHH-HHHHHHHHHHHCCCCEEEEEECCCCC----HHHH
Q ss_conf             999876449829998066555323457754463221135645424-68999999974089748999678899----9999
Q gi|254780434|r  228 IAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLK-STIALAKIRQRVGPKIAIIGTGGISS----TKDA  302 (362)
Q Consensus       228 ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~-al~~i~~i~~~~~~~i~IIg~GGI~s----~~Da  302 (362)
                      .++.++++|+|.|.+..|.+..                    .|. ..+.++.+++.++++++| |.=+=.+    -.-+
T Consensus       148 ~a~~~~~~Gad~I~i~DT~G~~--------------------~P~~v~~~v~~l~~~~~~~i~i-g~H~HNnlGlAvANs  206 (333)
T TIGR03217       148 QAKLMESYGADCVYIVDSAGAM--------------------LPDDVRDRVRALKAVLKPETQV-GFHAHHNLSLAVANS  206 (333)
T ss_pred             HHHHHHHCCCCEEEECCCCCCC--------------------CHHHHHHHHHHHHHHCCCCCEE-EEEEECCCCHHHHHH
T ss_conf             9999985699999975964468--------------------9999999999999862997548-898617877299999


Q ss_pred             HHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9999839997545278770697899999999999999838997
Q gi|254780434|r  303 LDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVN  345 (362)
Q Consensus       303 ~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~s  345 (362)
                      +..+.+||+-|+..-.=+=+|.+-..  .++|-..|++.||++
T Consensus       207 laAi~aGa~~VD~Ti~GlGe~aGNa~--lE~lVa~l~~~g~~t  247 (333)
T TIGR03217       207 IAAIEAGATRIDASLRGLGAGAGNAP--LEVFVAVLDRLGWNT  247 (333)
T ss_pred             HHHHHCCCCEEEECCCCCCCCCCCCH--HHHHHHHHHCCCCCC
T ss_conf             99998199999762744889888734--999999996179865


No 267
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism]
Probab=95.84  E-value=0.05  Score=33.44  Aligned_cols=34  Identities=29%  Similarity=0.377  Sum_probs=28.1

Q ss_pred             CCCCEEECCCCCCCHHHHHHHHHCCCCEEECCCCC
Q ss_conf             59974853468886779888740367524102001
Q gi|254780434|r   54 LSNPLGMAAGYDKNAEVPIELLKLGFGFVEIGTVT   88 (362)
Q Consensus        54 ~~nPiglAaG~dk~~~~~~~l~~~G~G~v~~ktit   88 (362)
                      ...||=+..|. .+.+.+..+.++|..-|++||+.
T Consensus        74 ~~~~vQvGGGI-Rs~~~v~~ll~~G~~rViiGt~a  107 (241)
T COG0106          74 TDVPVQVGGGI-RSLEDVEALLDAGVARVIIGTAA  107 (241)
T ss_pred             CCCCEEEECCC-CCHHHHHHHHHCCCCEEEEECCE
T ss_conf             79977840876-78999999998799889980312


No 268
>KOG0399 consensus
Probab=95.83  E-value=0.066  Score=32.63  Aligned_cols=80  Identities=11%  Similarity=0.161  Sum_probs=61.6

Q ss_pred             HHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC-CC--------------------HH--------------H
Q ss_conf             7408974899967889999999999839997545278770-69--------------------78--------------9
Q gi|254780434|r  282 QRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY-EG--------------------IS--------------L  326 (362)
Q Consensus       282 ~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~-~G--------------------p~--------------~  326 (362)
                      .-+..++.|=.-|++.|+.|+.-.-+.||+--...|+-+. -|                    |.              .
T Consensus      1164 NdLR~rvVlqtDGqlrtG~DV~iAallGAeefgf~T~plIalGCiMmRkCH~NtCpVGiAtQdp~LRakF~G~PehvVNf 1243 (2142)
T KOG0399        1164 NDLRGRVVLQTDGQLRTGRDVAIAALLGAEEFGFSTAPLIALGCIMMRKCHLNTCPVGIATQDPELRAKFPGQPEHVVNF 1243 (2142)
T ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHCCHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCHHHHHH
T ss_conf             26130279983685023368999998373031544017998766999886057887411138988896579992778899


Q ss_pred             HHHHHHHHHHHHHHCCCCCHHHHHCCCCHHHHHCC
Q ss_conf             99999999999998389977896169752664138
Q gi|254780434|r  327 PKRIIQGLSDFLNKENEVNFENIRGSYTEYWAKKE  361 (362)
Q Consensus       327 ~~~I~~~L~~~l~~~G~~si~e~iG~~~~~~~~~~  361 (362)
                      +--+.+|+..+|.+-||++++|+||+.-.-+++++
T Consensus      1244 f~yvaEEvR~imakLGfrtldemvGrtdlLk~~~d 1278 (2142)
T KOG0399        1244 FFYVAEEVRGIMAKLGFRTLDEMVGRTDLLKARSD 1278 (2142)
T ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHCCHHHHCCCCC
T ss_conf             99999999999988381058887361544223455


No 269
>PRK08195 4-hydroxy-2-ketovalerate aldolase; Validated
Probab=95.69  E-value=0.19  Score=29.51  Aligned_cols=216  Identities=16%  Similarity=0.129  Sum_probs=112.3

Q ss_pred             HHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCH
Q ss_conf             77988874036752410200136878998862688425554100002477777889998764100012100011045424
Q gi|254780434|r   68 AEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSK  147 (362)
Q Consensus        68 ~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~  147 (362)
                      .+..+.+.++|+-.+|++-       |+.-+        .+.. .+||+...-..+++.++....+..+.+-+-..   .
T Consensus        28 ~~ia~~Ld~aGVd~IEVgh-------g~gl~--------~ss~-~~g~~~~~d~e~i~~~~~~~~~aki~~l~~pg---~   88 (337)
T PRK08195         28 RAIARALDAAGVPVIEVTH-------GDGLG--------GSSF-NYGFGAHTDEEYIEAAADVVKQAKLATLLLPG---I   88 (337)
T ss_pred             HHHHHHHHHCCCCEEEECC-------CCCCC--------CCCC-CCCCCCCCHHHHHHHHHHHHHCCEEEEEECCC---C
T ss_conf             9999999980989999447-------88877--------7533-46787798399999999974328378996356---5


Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHH
Q ss_conf             67887765554206755269830333653221100002343211112244455655312688517865057777488899
Q gi|254780434|r  148 DFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDD  227 (362)
Q Consensus       148 ~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~  227 (362)
                      ...+|. +.  ....++|.+-+-..|-..         +...+.+..        ..+....+-.++-.+.-.+.+.+.+
T Consensus        89 ~~~~dl-~~--A~~~gv~~vria~~~tea---------d~~~~~i~~--------ar~~G~~v~~~lm~s~~~~~e~l~~  148 (337)
T PRK08195         89 GTIEDL-KM--AYDAGVRVVRVATHCTEA---------DVSEQHIGL--------ARELGMDTVGFLMMSHMASPEKLAE  148 (337)
T ss_pred             CCHHHH-HH--HHHCCCCEEEEEEECCHH---------HHHHHHHHH--------HHHCCCEEEEEEHHCCCCCHHHHHH
T ss_conf             558889-99--995798979998631488---------779999999--------9977993999751102489999999


Q ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHH-HHHHHHHHHHHCCCCEEEEEECCCCC----HHHH
Q ss_conf             999876449829998066555323457754463221135645424-68999999974089748999678899----9999
Q gi|254780434|r  228 IAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLK-STIALAKIRQRVGPKIAIIGTGGISS----TKDA  302 (362)
Q Consensus       228 ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~-al~~i~~i~~~~~~~i~IIg~GGI~s----~~Da  302 (362)
                      .++.++++|+|.|.+..|.+.                    +.|. ..+.+..+++.++++++| |.=+=.+    -.-.
T Consensus       149 ~a~~~~~~Gad~I~l~DT~G~--------------------~~P~~v~~~v~~l~~~l~~~i~i-gfH~HNnlGlAvANs  207 (337)
T PRK08195        149 QAKLMESYGAQCVYVVDSAGA--------------------LLPDDVRARVRALRAALKPDTQV-GFHGHHNLGLGVANS  207 (337)
T ss_pred             HHHHHHHCCCCEEEECCCCCC--------------------CCHHHHHHHHHHHHHHCCCCCEE-EEEECCCCCHHHHHH
T ss_conf             999998659999997898766--------------------79999999999999864998549-998538867599999


Q ss_pred             HHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9999839997545278770697899999999999999838997
Q gi|254780434|r  303 LDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVN  345 (362)
Q Consensus       303 ~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~s  345 (362)
                      +.-+.+||+.|+..-.=+=+|.+-..  .+.|...|++.||.+
T Consensus       208 laAveaGA~~ID~Ti~GlGegAGNa~--lE~lva~l~r~g~~~  248 (337)
T PRK08195        208 LAAVEAGADRIDASLAGFGAGAGNAP--LEVLVAVLDRMGWET  248 (337)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCCHH--HHHHHHHHHHCCCCC
T ss_conf             99998099999850534488878738--999999997469865


No 270
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional
Probab=95.64  E-value=0.2  Score=29.38  Aligned_cols=186  Identities=16%  Similarity=0.211  Sum_probs=104.7

Q ss_pred             EEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCC
Q ss_conf             68842555410000247777788999876410001210001104542467887765554206755269830333653221
Q gi|254780434|r  100 VFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGL  179 (362)
Q Consensus       100 ~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~  179 (362)
                      ++-..-|+-.+..++|.   . .+++.+++. .+.|+=+-++...     .++|.+.+.+  .++|++.+-+-+-+.   
T Consensus        29 iHiDIMDG~FVPN~tfg---p-~~v~~ir~~-t~~p~DvHLMv~~-----P~~~i~~~~~--~gad~It~H~Ea~~~---   93 (227)
T PRK09722         29 FHIDIMDGHFVPNLTLS---P-FFVSQVKKL-ASKPLDCHLMVTR-----PQDYIAQLAD--AGADFITLHPETING---   93 (227)
T ss_pred             EEEECCCCCCCCCCCCC---H-HHHHHHHHC-CCCCEEEEEEECC-----HHHHHHHHHH--CCCCEEEECHHHCCC---
T ss_conf             99956168607854518---6-599999744-8996478999658-----8888999985--499899956565056---


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCC
Q ss_conf             10000234321111224445565531268851786505777748889999987644982999806655532345775446
Q gi|254780434|r  180 RSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHE  259 (362)
Q Consensus       180 ~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~  259 (362)
                             ...+.+..+++        ..  +-..+-|-|+.+.+.+..++.     -+|.+.+-            ... 
T Consensus        94 -------~~~~~i~~Ik~--------~g--~k~GlAlnP~Tpi~~i~~~l~-----~vD~VLvM------------sV~-  138 (227)
T PRK09722         94 -------QAFRLIDEIRR--------AG--MKVGLVLNPETPVEAIKYYIH-----LADKVTVM------------TVD-  138 (227)
T ss_pred             -------CHHHHHHHHHH--------CC--CCEEEEECCCCCHHHHHHHHH-----HCCEEEEE------------EEC-
T ss_conf             -------59999999998--------69--972233389998668876674-----37989999------------888-


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHC---CCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHH----HHHHHH
Q ss_conf             3221135645424689999999740---897489996788999999999983999754527877069789----999999
Q gi|254780434|r  260 QDGGLSGSPLFLKSTIALAKIRQRV---GPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISL----PKRIIQ  332 (362)
Q Consensus       260 ~~GGlSG~~i~~~al~~i~~i~~~~---~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~----~~~I~~  332 (362)
                       . |.+|..-.+-++.-|+++|+..   +.++.|---|||. .+-+-+...||||.+=++|+.+|..+.-    ++.+..
T Consensus       139 -P-Gf~GQ~Fi~~~l~KI~~lr~~~~~~~~~~~I~VDGGI~-~~~i~~~~~aGAd~~V~GssaiF~~~~~i~~~~~~l~~  215 (227)
T PRK09722        139 -P-GFAGQPFIPEMLDKIAELKAWREREGLEYEIEVDGSCN-QKTYEKLMAAGADVFIVGTSGLFNHAENIDEAWDIMTA  215 (227)
T ss_pred             -C-CCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCCC-HHHHHHHHHCCCCEEEECCHHHCCCCCCHHHHHHHHHH
T ss_conf             -9-99876566889999999999998259982699989888-99999999869999997748974899999999999999


Q ss_pred             HHHHHH
Q ss_conf             999999
Q gi|254780434|r  333 GLSDFL  338 (362)
Q Consensus       333 ~L~~~l  338 (362)
                      ++.+-+
T Consensus       216 ~~~~~~  221 (227)
T PRK09722        216 QILAAT  221 (227)
T ss_pred             HHHHHH
T ss_conf             999986


No 271
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism]
Probab=95.61  E-value=0.19  Score=29.48  Aligned_cols=42  Identities=17%  Similarity=0.394  Sum_probs=26.2

Q ss_pred             CEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHH
Q ss_conf             74899967889999999999839997545278770697899999
Q gi|254780434|r  287 KIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRI  330 (362)
Q Consensus       287 ~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I  330 (362)
                      ++|+  +=|+.|+..+..-+.+|++.+-+.-+-..-|+..++-+
T Consensus       106 ~ip~--~PG~~TptEi~~Ale~G~~~lK~FPa~~~Gg~~~~ka~  147 (211)
T COG0800         106 GIPY--IPGVATPTEIMAALELGASALKFFPAEVVGGPAMLKAL  147 (211)
T ss_pred             CCCC--CCCCCCHHHHHHHHHCCHHHEEECCCCCCCCHHHHHHH
T ss_conf             9963--68879989999999807224564373113769899987


No 272
>PRK05581 ribulose-phosphate 3-epimerase; Validated
Probab=95.56  E-value=0.22  Score=29.17  Aligned_cols=207  Identities=19%  Similarity=0.281  Sum_probs=116.5

Q ss_pred             CEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             74853468886779888740367524102001368789988626884255541000024777778899987641000121
Q gi|254780434|r   57 PLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPI  136 (362)
Q Consensus        57 PiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi  136 (362)
                      |=.++|-+.+-.+.++++.+.|+..+-+                  ..-|+-.+..++|   |. .+++.+++. .+.|+
T Consensus         8 pSil~ad~~~l~~~i~~l~~~g~~~lHi------------------DImDG~FVpn~t~---g~-~~v~~i~~~-t~~~~   64 (220)
T PRK05581          8 PSILSADFARLGEEVKAVEAAGADWIHV------------------DVMDGHFVPNLTI---GP-PVVEAIRKV-TKLPL   64 (220)
T ss_pred             HHHHCCCHHHHHHHHHHHHHCCCCEEEE------------------ECCCCCCCCCCCC---CH-HHHHHHHHH-CCCCE
T ss_conf             8774079999999999999769998999------------------5757844775563---99-999999841-89964


Q ss_pred             CCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             00011045424678877655542067552698303336532211000023432111122444556553126885178650
Q gi|254780434|r  137 GINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKI  216 (362)
Q Consensus       137 ~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKL  216 (362)
                      =|-++.+.+     ++|.+.+.  ..++|.+.+-+-+.           +...+.+..+++.        ..  -..+-|
T Consensus        65 DvHLMv~~P-----~~~i~~~~--~~g~d~I~~H~Ea~-----------~~~~~~i~~ik~~--------g~--k~Glal  116 (220)
T PRK05581         65 DVHLMVENP-----DRYVPDFA--KAGADIITFHVEAS-----------EHIHRLLQLIKEA--------GI--KAGLVL  116 (220)
T ss_pred             EEEEEEECH-----HHHHHHHH--HCCCCEEEECCCCC-----------CCHHHHHHHHHHC--------CC--CEEEEE
T ss_conf             789997188-----88799999--73998899816750-----------2799999999974--------99--704676


Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC---CCCEEEEEE
Q ss_conf             57777488899999876449829998066555323457754463221135645424689999999740---897489996
Q gi|254780434|r  217 SPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRV---GPKIAIIGT  293 (362)
Q Consensus       217 sPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~---~~~i~IIg~  293 (362)
                      .|+.+.+.+..++..     +|.+.+- |           .  +. |.+|....+.++..|+++|+..   +.++.|---
T Consensus       117 np~T~~~~l~~~l~~-----iD~VlvM-t-----------V--~P-Gf~GQ~f~~~~l~ki~~l~~~~~~~~~~~~I~VD  176 (220)
T PRK05581        117 NPATPLEYLEYVLPL-----LDLVLLM-S-----------V--NP-GFGGQKFIPEVLEKIREVRKLIDERGLDILIEVD  176 (220)
T ss_pred             CCCCCHHHHHHHHHH-----HCEEEEE-E-----------E--CC-CCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             699998999999874-----1525899-8-----------6--58-8787645566999999999999845997559997


Q ss_pred             CCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             78899999999998399975452787706978999999999999
Q gi|254780434|r  294 GGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDF  337 (362)
Q Consensus       294 GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~  337 (362)
                      |||.. +.+-+...+|||.+=++|++ |+.+. ..+..+.|++.
T Consensus       177 GGIn~-~~i~~l~~~Gad~~V~GS~i-F~~~d-~~~~i~~lk~~  217 (220)
T PRK05581        177 GGVNA-ENIKECAEAGADVFVAGSAV-FGAPD-YKEAIDELRAE  217 (220)
T ss_pred             CCCCH-HHHHHHHHCCCCEEEECHHH-HCCCC-HHHHHHHHHHH
T ss_conf             89898-99999997799999979488-57999-99999999998


No 273
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid). It has a widespread application as biocatalyst for the synthesis of sialic acid and its derivatives. This enzyme has been shown to be quite specific for pyruvate as the donor, but flexible to a variety of D- and, to some extent, L-hexoses and pentoses as acceptor substrates. NAL is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases.
Probab=95.54  E-value=0.11  Score=31.17  Aligned_cols=195  Identities=12%  Similarity=0.130  Sum_probs=89.4

Q ss_pred             CCC-CCCC--HHHHHHHHH-CCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHH-HHHCCC
Q ss_conf             346-8886--779888740-36752410200136878998862688425554100002477777889998764-100012
Q gi|254780434|r   61 AAG-YDKN--AEVPIELLK-LGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSK-IQPTSP  135 (362)
Q Consensus        61 AaG-~dk~--~~~~~~l~~-~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~-~~~~~p  135 (362)
                      +.| +|..  .+.++.+.+ .|..++++...|-+-         +.+            .......+.+...+ .....|
T Consensus        14 ~dg~iD~~~~~~~i~~li~~~Gv~gi~v~GstGE~---------~~L------------s~~Er~~l~~~~~~~~~~r~p   72 (288)
T cd00954          14 ENGEINEDVLRAIVDYLIEKQGVDGLYVNGSTGEG---------FLL------------SVEERKQIAEIVAEAAKGKVT   72 (288)
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCC---------CCC------------CHHHHHHHHHHHHHHCCCCCE
T ss_conf             88597999999999999987799899979354252---------138------------999999999999997289860


Q ss_pred             CCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             10001104542467887765554206755269830333653221100002343211112244455655312688517865
Q gi|254780434|r  136 IGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLK  215 (362)
Q Consensus       136 i~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vK  215 (362)
                      ++++++.++ +.+ ..++.+.+++++  ||++-+  ..|..-.   . +.+.+......+        ......+||++=
T Consensus        73 vi~gv~~~s-~~~-ai~~a~~a~~~G--ad~v~v--~~P~y~~---~-~~~~~~~~~~~i--------~~~~~~~piiiY  134 (288)
T cd00954          73 LIAHVGSLN-LKE-SQELAKHAEELG--YDAISA--ITPFYYK---F-SFEEIKDYYREI--------IAAAASLPMIIY  134 (288)
T ss_pred             EEECCCCCC-HHH-HHHHHHHHHHCC--CCEEEE--CCCCCCC---C-CHHHHHHHHHHH--------HHHCCCCCEEEE
T ss_conf             873588645-999-999999998649--786773--7998879---9-979999999999--------985779965432


Q ss_pred             CCCC-----CCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             0577-----77488899999876449829998066555323457754463221135645424689999999740897489
Q gi|254780434|r  216 ISPD-----LSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAI  290 (362)
Q Consensus       216 LsPd-----~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~I  290 (362)
                      =.|.     ++.+.+..++    +  ...|+.+-     .    .         ||.      ...+.++.+..+.++.+
T Consensus       135 n~P~~tg~~l~~~~l~~L~----~--~~~vvgiK-----~----s---------~~d------~~~~~~~~~~~~~~~~v  184 (288)
T cd00954         135 HIPALTGVNLTLEQFLELF----E--IPNVIGVK-----F----T---------ATD------LYDLERIRAASPEDKLV  184 (288)
T ss_pred             CCCCCCCCCCCHHHHHHHH----C--CCCEEEEE-----E----C---------CCC------HHHHHHHHHHCCCCCEE
T ss_conf             1765237689999999996----3--68978999-----7----8---------799------99999999976998246


Q ss_pred             EEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHH
Q ss_conf             9967889999999999839997545278770697899999
Q gi|254780434|r  291 IGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRI  330 (362)
Q Consensus       291 Ig~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I  330 (362)
                      ++  |.  ..-.++.+.+||+-.-.+++-++  |..+.+|
T Consensus       185 ~~--G~--d~~~~~~~~~Ga~G~i~~~~n~~--p~~~~~i  218 (288)
T cd00954         185 LN--GF--DEMLLSALALGADGAIGSTYNVN--GKRYRKI  218 (288)
T ss_pred             EC--CC--HHHHHHHHHCCCCEEEECHHHHH--HHHHHHH
T ss_conf             16--95--79999999869989995767867--9999999


No 274
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase; InterPro: IPR003733   Thiamine monophosphate synthase (TMP) (2.5.1.3 from EC) catalyzes the substitution of the pyrophosphate of 2-methyl-4-amino-5- hydroxymethylpyrimidine pyrophosphate by 4-methyl-5- (beta-hydroxyethyl)thiazole phosphate to yield thiamine phosphate in the thiamine biosynthesis pathway .   TENI, a protein from Bacillus subtilis that regulates the production of several extracellular enzymes by reducing alkaline protease production belongs to this group .; GO: 0004789 thiamin-phosphate diphosphorylase activity, 0009228 thiamin biosynthetic process.
Probab=95.53  E-value=0.076  Score=32.22  Aligned_cols=140  Identities=19%  Similarity=0.185  Sum_probs=87.0

Q ss_pred             HHHHHHHHHHH--HHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             78899987641--0001210001104542467887765554206755269830333653221100002343211112244
Q gi|254780434|r  120 YHTVFSRLSKI--QPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQ  197 (362)
Q Consensus       120 ~~~~~~~l~~~--~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~  197 (362)
                      .-...+.++++  +.+.|++||            |+++++..+.  ||-+=|            .|+.-.       +..
T Consensus        51 ~~~~A~~l~~lc~~y~~~f~vN------------D~vdlA~~~~--ADGvHl------------GQ~D~p-------~~~   97 (210)
T TIGR00693        51 RLELAEKLRELCRKYGVPFIVN------------DRVDLALALG--ADGVHL------------GQDDLP-------VSE   97 (210)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEC------------CHHHHHHHHC--CCEEEE------------CCCCCC-------HHH
T ss_conf             9999999999998708976882------------8399999837--987766------------788899-------899


Q ss_pred             HHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHH---HCCCCEEEE---ECCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             455655312688517865057777488899999876---449829998---06655532345775446322113564542
Q gi|254780434|r  198 TREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVL---SHKVEGIIV---SNTTLSRKGVQCSDNHEQDGGLSGSPLFL  271 (362)
Q Consensus       198 ~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~---~~g~dGiv~---~NT~~~~~~~~~~~~~~~~GGlSG~~i~~  271 (362)
                      .|.-.-    .  -.++=+|=    ....+++++..   +.|+|=|-+   ..|.         ....        +-.+
T Consensus        98 aR~l~G----~--~~iiG~S~----~~~~e~~~a~~C~~~~gaDY~G~Gp~fpT~---------TK~~--------~~~~  150 (210)
T TIGR00693        98 ARKLLG----P--DKIIGVST----HNLEELAEAAACELKEGADYIGVGPIFPTP---------TKKD--------AAPP  150 (210)
T ss_pred             HHHHCC----C--CCEEEEEE----CCHHHHHHHHHHHHHCCCCEEEECCCCCCC---------CCCC--------CCCC
T ss_conf             998538----9--95798533----798999999987640789888863711588---------7889--------8776


Q ss_pred             HHHHHHHHHHHHCCC-CEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             468999999974089-74899967889999999999839997545278770
Q gi|254780434|r  272 KSTIALAKIRQRVGP-KIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       272 ~al~~i~~i~~~~~~-~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      .+++.|+++++.. . ++|+.|.|||.. +-+-+.+.+||+-|-|.|+.|-
T Consensus       151 ~g~e~l~~~~~~~-~h~~P~VAIGGI~~-~n~~~v~~~G~~~vAVvSaI~~  199 (210)
T TIGR00693       151 VGLELLREIAATS-IHDIPIVAIGGITL-ENVAEVLAAGADGVAVVSAIMQ  199 (210)
T ss_pred             CCHHHHHHHHHHC-CCCCCEEEECCCCH-HHHHHHHHCCCCEEEEEEEECC
T ss_conf             4888999999861-78876588759887-8999999728873888651015


No 275
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP,  present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa. Together with PdxT, PdxS forms the PLP synthase, a heteromeric glutamine amidotransferase (GATase), whereby PdxT produces ammonia from glutamine and PdxS combines ammonia with five- and three-carbon phosphosugars to form PLP. PLP is the biologically active form of vitamin B6, an essential cofactor in many biochemical processes. PdxS subunits form two hexameric rings.
Probab=95.50  E-value=0.022  Score=35.84  Aligned_cols=71  Identities=13%  Similarity=0.189  Sum_probs=48.3

Q ss_pred             HHHHHHHHHHCCCCEE--EEEECCCCCHHHHHHHHHCCCCEEEECHHHHC------------------CCHHHHHHHHHH
Q ss_conf             8999999974089748--99967889999999999839997545278770------------------697899999999
Q gi|254780434|r  274 TIALAKIRQRVGPKIA--IIGTGGISSTKDALDKIMAGANLIQLYSAMIY------------------EGISLPKRIIQG  333 (362)
Q Consensus       274 l~~i~~i~~~~~~~i~--IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~------------------~Gp~~~~~I~~~  333 (362)
                      ..++.++++.-  ++|  -.+.|||.|+.||.-++-.|||-|=++|+..-                  +.|.++.++-++
T Consensus       183 ~elv~~v~~~g--rLPVvnFaAGGiATPADAALmMqLG~dGVFVGSGIFKS~dP~krA~AIV~Atthy~dp~~laevS~~  260 (283)
T cd04727         183 YELVKETAKLG--RLPVVNFAAGGVATPADAALMMQLGADGVFVGSGIFKSENPEKRARAIVEAVTHYDDPEILAEVSEG  260 (283)
T ss_pred             HHHHHHHHHHC--CCCEEEECCCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHC
T ss_conf             89999999978--9763664267858837799999728987887765457899999999999998465889999999704


Q ss_pred             HHHHHHHCCCCCH
Q ss_conf             9999998389977
Q gi|254780434|r  334 LSDFLNKENEVNF  346 (362)
Q Consensus       334 L~~~l~~~G~~si  346 (362)
                      |.+-|.--..+++
T Consensus       261 LgeaM~Gi~i~~l  273 (283)
T cd04727         261 LGEAMVGIDIASL  273 (283)
T ss_pred             CCCCCCCCCHHHC
T ss_conf             6646788881228


No 276
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2.  This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).
Probab=95.45  E-value=0.23  Score=28.94  Aligned_cols=104  Identities=19%  Similarity=0.170  Sum_probs=61.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCC---CCCC-----CCCCCC---------CCCCCC-CC---CCCC
Q ss_conf             5178650577774888999998764498299980665---5532-----345775---------446322-11---3564
Q gi|254780434|r  210 VPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTT---LSRK-----GVQCSD---------NHEQDG-GL---SGSP  268 (362)
Q Consensus       210 ~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~---~~~~-----~~~~~~---------~~~~~G-Gl---SG~~  268 (362)
                      -|.|..|=+.-+.+...++++.++++|+.+++++=-+   ..|.     +...+.         .....| ++   .+..
T Consensus       125 ~~~wfQLY~~~dr~~~~~li~RA~~aG~~alvlTVD~p~~g~Rerd~r~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~  204 (351)
T cd04737         125 GPKWFQLYMSKDDGFNRSLLDRAKAAGAKAIILTADATVGGNREADIRNKFQFPFGMPNLNHFSEGTGKGKGISEIYAAA  204 (351)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             97089971358879999999999986999899963178878627788629988999872234467775555568898863


Q ss_pred             CCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             542468999999974089748999678899999999998399975452
Q gi|254780434|r  269 LFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLY  316 (362)
Q Consensus       269 i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~  316 (362)
                      -...+-+-++++++.++  .|| -+-||.+++||..-..+|||.|.|.
T Consensus       205 ~~~~~w~di~~lr~~~~--lpl-ilKGI~~~eDA~~A~~~G~dgIvVS  249 (351)
T cd04737         205 KQKLSPADIEFIAKISG--LPV-IVKGIQSPEDADVAINAGADGIWVS  249 (351)
T ss_pred             CCCCCHHHHHHHHHHCC--CCE-EECCCCCHHHHHHHHHCCCCEEEEC
T ss_conf             25799899999998649--985-3236677999999987499889977


No 277
>PRK08782 consensus
Probab=95.42  E-value=0.24  Score=28.86  Aligned_cols=134  Identities=13%  Similarity=0.146  Sum_probs=79.6

Q ss_pred             HHHHHHHHH-CCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             776555420-6755269830333653221100002343211112244455655312688517865057777488899999
Q gi|254780434|r  152 DYVSGIRLF-FTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAV  230 (362)
Q Consensus       152 dy~~~~~~~-~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~  230 (362)
                      +-..+++.+ ..+...+|+-+..|+.-        +.+    ..+.+        ....  +.+-..-=++    .+-++
T Consensus        30 ~a~~~~eal~~gGi~~iEiTlrt~~a~--------~~i----~~l~~--------~~p~--~~vGaGTV~~----~e~~~   83 (219)
T PRK08782         30 QARRVADALLEGGLPAIELTLRTPVAI--------EAL----AMLKR--------ELPN--IVIGAGTVLS----ERQLR   83 (219)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCHHH--------HHH----HHHHH--------HCCC--CEEEEEEECC----HHHHH
T ss_conf             999999999987998799967993399--------999----99998--------6899--4799997058----99999


Q ss_pred             HHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCC
Q ss_conf             87644982999806655532345775446322113564542468999999974089748999678899999999998399
Q gi|254780434|r  231 EVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGA  310 (362)
Q Consensus       231 ~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGA  310 (362)
                      .+.++|++.++--++                           ....+.... ..  ++|  -.=|++|+.++...+.+|+
T Consensus        84 ~a~~aGA~FiVSP~~---------------------------~~~v~~~a~-~~--~i~--~iPGv~TpSEi~~A~~~G~  131 (219)
T PRK08782         84 QSVDAGADFLVTPGT---------------------------PAPLARLLA-DA--PIP--AVPGAATPTELLTLMGLGF  131 (219)
T ss_pred             HHHHCCCCEEECCCC---------------------------CHHHHHHHH-HC--CCC--EECCCCCHHHHHHHHHCCC
T ss_conf             999849989987899---------------------------799999999-81--997--6478599999999998799


Q ss_pred             CEEEECHHHHCCCHHHHHHHH----------------HHHHHHHHHCCC
Q ss_conf             975452787706978999999----------------999999998389
Q gi|254780434|r  311 NLIQLYSAMIYEGISLPKRII----------------QGLSDFLNKENE  343 (362)
Q Consensus       311 s~VQi~Tali~~Gp~~~~~I~----------------~~L~~~l~~~G~  343 (362)
                      ++|-++-|-.+.|+..++.+.                +-+.+||...++
T Consensus       132 ~~vKlFPA~~~Gg~~~lkal~~pfp~~~f~pTGGV~~~N~~~yl~~~~v  180 (219)
T PRK08782        132 RVCKLFPATAVGGLQMLKGLAGPLSELKLCPTGGISETNAAEFLSQPNV  180 (219)
T ss_pred             CEEEECCCHHCCCHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCE
T ss_conf             9899777322084999999847699981876799898789999807993


No 278
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI. TMP synthase catalyzes an important step in the thiamine biosynthesis pathway, the substitution of the pyrophosphate of 2-methyl-4-amino-5- hydroxymethylpyrimidine pyrophosphate by 4-methyl-5- (beta-hydroxyethyl) thiazole phosphate to yield thiamine phosphate. TenI is a enzymatically inactive regulatory protein involved in the regulation of several extracellular enzymes. This superfamily also contains other enzymatically inactive proteins with unknown functions.
Probab=95.38  E-value=0.22  Score=29.18  Aligned_cols=91  Identities=18%  Similarity=0.242  Sum_probs=59.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC-CHHHHHHHHHHHHHCCCCEEE
Q ss_conf             7865057777488899999876449829998066555323457754463221135645-424689999999740897489
Q gi|254780434|r  212 IFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPL-FLKSTIALAKIRQRVGPKIAI  290 (362)
Q Consensus       212 i~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i-~~~al~~i~~i~~~~~~~i~I  290 (362)
                      .++-+|-    ...++ +..+.+.|+|-+.+.--      ..+...         +.. .|..+..++++.+..  ++|+
T Consensus        96 ~iiG~S~----h~~~e-~~~a~~~g~DYi~~gpv------f~T~tK---------~~~~~~~g~~~l~~~~~~~--~~Pv  153 (196)
T cd00564          96 LIIGVST----HSLEE-ALRAEELGADYVGFGPV------FPTPTK---------PGAGPPLGLELLREIAELV--EIPV  153 (196)
T ss_pred             CEEEECC----CCHHH-HHHHHHHCCCEEEECCC------CCCCCC---------CCCCCCCCHHHHHHHHHHC--CCCE
T ss_conf             7588247----88999-99988709993886465------578988---------8877877889999999867--9998


Q ss_pred             EEECCCCCHHHHHHHHHCCCCEEEECHHHHCC-CHH
Q ss_conf             99678899999999998399975452787706-978
Q gi|254780434|r  291 IGTGGISSTKDALDKIMAGANLIQLYSAMIYE-GIS  325 (362)
Q Consensus       291 Ig~GGI~s~~Da~e~l~aGAs~VQi~Tali~~-Gp~  325 (362)
                      ++.||| +.+++.+.+.+||+-|-+.|+++-. .|.
T Consensus       154 ~AiGGI-~~~ni~~~~~~G~~giAv~s~i~~~~dp~  188 (196)
T cd00564         154 VAIGGI-TPENAAEVLAAGADGVAVISAITGADDPA  188 (196)
T ss_pred             EEECCC-CHHHHHHHHHCCCCEEEEHHHHHCCCCHH
T ss_conf             998589-99999999980999999729977799999


No 279
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea. This subfamily of enzymes is adapted for high thermostability and shows specificity for non-phosphorylated substrates. The enzyme catalyses the reversible aldol cleavage of 2-keto-3-dexoygluconate to pyruvate and glyceraldehyde, the third step of a modified non-phosphorylated Entner-Doudoroff pathway of glucose oxidation. KDG aldolase shows no significant sequence similarity to microbial 2-keto-3-deoxyphosphogluconate (KDPG) aldolases, and the enzyme shows no activity with glyceraldehyde 3-phosphate as substrate. The enzyme is a tetramer and a member of the DHDPS family of Schiff-base-dependent class I aldolases.
Probab=95.29  E-value=0.25  Score=28.72  Aligned_cols=197  Identities=14%  Similarity=0.174  Sum_probs=88.5

Q ss_pred             CCEEECCC-CCC--CHHHHHHHHHCCCCEEEC-CCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHH
Q ss_conf             97485346-888--677988874036752410-20013687899886268842555410000247777788999876410
Q gi|254780434|r   56 NPLGMAAG-YDK--NAEVPIELLKLGFGFVEI-GTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQ  131 (362)
Q Consensus        56 nPiglAaG-~dk--~~~~~~~l~~~G~G~v~~-ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~  131 (362)
                      -||  ..| .|.  -.+.++.+.+.|..++++ || |-+-.         -+            .-.....+.+...+..
T Consensus        10 TPF--~~g~iD~~~l~~~i~~l~~~Gv~gi~v~Gs-tGE~~---------~L------------s~eEr~~vi~~~~~~~   65 (279)
T cd00953          10 TPF--TGNKIDKEKFKKHCENLISKGIDYVFVAGT-TGLGP---------SL------------SFQEKLELLKAYSDIT   65 (279)
T ss_pred             CCC--CCCCCCHHHHHHHHHHHHHCCCCEEEECCH-HHHHH---------HC------------CHHHHHHHHHHHHHHC
T ss_conf             784--959679999999999999779999997813-12165---------58------------9999999999999967


Q ss_pred             HCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCE
Q ss_conf             00121000110454246788776555420675526983033365322110000234321111224445565531268851
Q gi|254780434|r  132 PTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVP  211 (362)
Q Consensus       132 ~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~P  211 (362)
                        .++++-++.. ++++.+ +..+.++++  +||++-  +..|..-.   ..+.+.+.+....+..           .+|
T Consensus        66 --~~vi~~vg~~-~~~~ai-~la~~A~~~--Gad~i~--~~pP~y~~---~~~~~~l~~yf~~va~-----------~lP  123 (279)
T cd00953          66 --DKVIFQVGSL-NLEESI-ELARAAKSF--GIYAIA--SLPPYYFP---GIPEEWLIKYFTDISS-----------PYP  123 (279)
T ss_pred             --CCEEEEECCC-CHHHHH-HHHHHHHHC--CCCEEE--EECCCCCC---CCCHHHHHHHHHHHHH-----------HCC
T ss_conf             --9818997778-799999-999999977--999899--76886789---9999999999999985-----------098


Q ss_pred             EEEECCCCCCHHHH-HHHHHHHHHC-C-CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             78650577774888-9999987644-9-8299980665553234577544632211356454246899999997408974
Q gi|254780434|r  212 IFLKISPDLSEEEL-DDIAVEVLSH-K-VEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKI  288 (362)
Q Consensus       212 i~vKLsPd~~~~~i-~~ia~~a~~~-g-~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i  288 (362)
                      +++=--|..+..++ .+++..+.+. + +-|+=  +++                   |.      ...+.++++ ..+++
T Consensus       124 i~lYn~P~~tg~~l~~~~~~~L~~~~~~v~giK--ds~-------------------~d------~~~~~~~~~-~~~~~  175 (279)
T cd00953         124 TFIYNYPKATGYDINARMAKEIKKAGGDIIGVK--DTN-------------------ED------ISHMLEYKR-LVPDF  175 (279)
T ss_pred             EEEEECCCCCCCCCCHHHHHHHHHCCCCEEEEE--CCC-------------------CC------HHHHHHHHH-HCCCC
T ss_conf             769967753588889999999981799889997--387-------------------69------999999998-48994


Q ss_pred             EEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHH
Q ss_conf             89996788999999999983999754527877069789999999
Q gi|254780434|r  289 AIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQ  332 (362)
Q Consensus       289 ~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~  332 (362)
                      .+. +|   +-...+..+.+||+-.-.+++-++  |..+.+|.+
T Consensus       176 ~v~-~G---~d~~~~~~l~~Ga~G~i~~~~n~~--P~~~~~l~~  213 (279)
T cd00953         176 KVY-SG---PDSLIFSALRSGLDGSVAAASNYL--PEVFVKIKD  213 (279)
T ss_pred             EEE-CC---CHHHHHHHHHCCCEEEEEHHHHHH--HHHHHHHHH
T ss_conf             785-69---579999999809979997089885--999999999


No 280
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional
Probab=95.29  E-value=0.26  Score=28.59  Aligned_cols=192  Identities=20%  Similarity=0.218  Sum_probs=104.8

Q ss_pred             EECCEECCCCEE--ECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHH
Q ss_conf             888733599748--534688867798887403675241020013687899886268842555410000247777788999
Q gi|254780434|r   48 KVAGISLSNPLG--MAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFS  125 (362)
Q Consensus        48 ~~~Gl~~~nPig--lAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~  125 (362)
                      =++-++-++|--  +...+|. .+..+.+...|+.++.+=|   +       |++|.                |.-..++
T Consensus        43 iIaEiKraSPSkG~i~~~~dp-~~iA~~Y~~~GA~aiSVLT---e-------~~~F~----------------Gs~~~L~   95 (247)
T PRK13957         43 IIAECKRKSPSAGELRADYHP-VQIAKTYETLGASAISVLT---D-------QSYFG----------------GSLEDLK   95 (247)
T ss_pred             EEEEEECCCCCCCCCCCCCCH-HHHHHHHHHCCCCEEEECC---C-------CCCCC----------------CCHHHHH
T ss_conf             999762589998875788999-9999999977992899827---8-------56679----------------9899999


Q ss_pred             HHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             87641000121000110454246788776555420675526983033365322110000234321111224445565531
Q gi|254780434|r  126 RLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIK  205 (362)
Q Consensus       126 ~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~  205 (362)
                      .+++. .+.|+--        .|.+.|-.+..+...-+||++=|=.+|         -+++.+.+++......       
T Consensus        96 ~v~~~-v~lPiLr--------KDFIid~~QI~ea~~~GADaILLIaa~---------L~~~~l~~l~~~A~~l-------  150 (247)
T PRK13957         96 SVSSE-LKIPVLR--------KDFILDEIQIREARAFGASAILLIVRI---------LTPSQIKSFLKHASSL-------  150 (247)
T ss_pred             HHHHH-CCCCEEE--------EEEECCHHHHHHHHHCCCCEEHHHHHC---------CCHHHHHHHHHHHHHH-------
T ss_conf             99985-7998474--------112064999999997399851268850---------8999999999999983-------


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             26885178650577774888999998764498299980665553234577544632211356454246899999997408
Q gi|254780434|r  206 TGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVG  285 (362)
Q Consensus       206 ~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~  285 (362)
                         ..-++|-+.   +.   .++ +.+.+.+++ ++.+|.   |. +.+               +.+.+.....+....+
T Consensus       151 ---Gle~LvEvH---~~---~El-~~al~~~~~-iIGINN---Rn-L~t---------------f~vd~~~~~~l~~~ip  200 (247)
T PRK13957        151 ---GMDVLVEVH---TE---DEA-KLALDCGAE-IIGINT---RD-LDT---------------FQIHQNLVEEVAAFLP  200 (247)
T ss_pred             ---CCEEEEEEC---CH---HHH-HHHHHCCCC-EEEEEC---CC-CCC---------------CCCCHHHHHHHHHHCC
T ss_conf             ---881562558---99---999-999848998-898745---77-321---------------4639889999984389


Q ss_pred             CCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCC
Q ss_conf             9748999678899999999998399975452787706
Q gi|254780434|r  286 PKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYE  322 (362)
Q Consensus       286 ~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~  322 (362)
                      .+..+|+-.||.+.+|+.. +..++++|-||+++|-+
T Consensus       201 ~~~~~VsESGI~~~~di~~-l~~~~da~LIGeslMk~  236 (247)
T PRK13957        201 PNIVKVGESGIESRSDLDK-FRKLVDAALIGTYFMEK  236 (247)
T ss_pred             CCCEEEECCCCCCHHHHHH-HHHHCCEEEECHHHHCC
T ss_conf             9987996789999999999-99739999988677569


No 281
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism]
Probab=95.23  E-value=0.042  Score=33.99  Aligned_cols=70  Identities=14%  Similarity=0.306  Sum_probs=49.1

Q ss_pred             HHHHHHHHHCCCCEEE--EEECCCCCHHHHHHHHHCCCCEEEECHHHH------------------CCCHHHHHHHHHHH
Q ss_conf             9999999740897489--996788999999999983999754527877------------------06978999999999
Q gi|254780434|r  275 IALAKIRQRVGPKIAI--IGTGGISSTKDALDKIMAGANLIQLYSAMI------------------YEGISLPKRIIQGL  334 (362)
Q Consensus       275 ~~i~~i~~~~~~~i~I--Ig~GGI~s~~Da~e~l~aGAs~VQi~Tali------------------~~Gp~~~~~I~~~L  334 (362)
                      .++.++++.  +++|+  .+.|||-++.||.-++..|||-|=++|+..                  |..|.++.++-++|
T Consensus       196 elv~~~~~~--grLPVvnFAAGGvATPADAALMM~LGadGVFVGSGIFKS~~P~~~A~AIV~A~~~~ddp~~~aevs~~l  273 (296)
T COG0214         196 ELVKEVAKL--GRLPVVNFAAGGVATPADAALMMQLGADGVFVGSGIFKSSNPEKRAKAIVEATTHYDDPEVLAEVSEGL  273 (296)
T ss_pred             HHHHHHHHH--CCCCEEEECCCCCCCHHHHHHHHHHCCCEEEECCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             999999983--988747422567688167999998189847865643378998999999999997148889999999874


Q ss_pred             HHHHHHCCCCCH
Q ss_conf             999998389977
Q gi|254780434|r  335 SDFLNKENEVNF  346 (362)
Q Consensus       335 ~~~l~~~G~~si  346 (362)
                      .+-|.--..+++
T Consensus       274 g~~M~Gi~i~~l  285 (296)
T COG0214         274 GEAMKGIDISEL  285 (296)
T ss_pred             CCCCCCCCHHHC
T ss_conf             625578874547


No 282
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed
Probab=95.21  E-value=0.13  Score=30.72  Aligned_cols=232  Identities=16%  Similarity=0.172  Sum_probs=124.0

Q ss_pred             CCCCEEEECCEECC--CCEEECCCCCC-CHHHH----HHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECC
Q ss_conf             96311688873359--97485346888-67798----8874036752410200136878998862688425554100002
Q gi|254780434|r   42 DPRLNTKVAGISLS--NPLGMAAGYDK-NAEVP----IELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLG  114 (362)
Q Consensus        42 ~~~L~~~~~Gl~~~--nPiglAaG~dk-~~~~~----~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~G  114 (362)
                      ..+--+++.|.++-  +|+.+|.=|.- +-|.+    +.+.+.|.-.+--         |-=+||-.  |        +.
T Consensus       102 ~~~t~v~v~~~~iG~~~~~iIAGPCsvES~eQi~~~A~~vk~~G~~~lRg---------Ga~KPRTs--P--------ys  162 (360)
T PRK12595        102 PEDTIVDVKGEIIGDGNQSFIFGPCAVESYEQVAAVAQALKAKGLKLLRG---------GAFKPRTS--P--------YD  162 (360)
T ss_pred             CCCCEEEECCEEECCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEC---------CCCCCCCC--C--------CC
T ss_conf             88877987999977996438956883678999999999999759755725---------55689999--9--------76


Q ss_pred             CCCCCHHHHHHHHHHH--HHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             4777778899987641--00012100011045424678877655542067552698303336532211000023432111
Q gi|254780434|r  115 FNNAGYHTVFSRLSKI--QPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLL  192 (362)
Q Consensus       115 l~N~G~~~~~~~l~~~--~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l  192 (362)
                      |+-.|.+- ++-|++.  ..+.|++.-|+..       .    -++.+..++|.+-|        |-|.+|+.+.+..  
T Consensus       163 FqGlG~eG-L~~L~~a~~e~gl~vvTEV~~~-------~----~ve~~~~yvDilqI--------GARnmqNf~LLk~--  220 (360)
T PRK12595        163 FQGLGVEG-LKILKQVADEYDLAVISEIVNP-------N----DVEVALDYVDVIQI--------GARNMQNFELLKA--  220 (360)
T ss_pred             CCCCCHHH-HHHHHHHHHHHCCCEEEEECCH-------H----HHHHHHHHCCEEEE--------CCHHCCCHHHHHH--
T ss_conf             57684579-9999999998599727985788-------8----99999974868988--------8410359999999--


Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             12244455655312688517865057777488899999876449829998066555323457754463221135645424
Q gi|254780434|r  193 IHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLK  272 (362)
Q Consensus       193 ~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~  272 (362)
                        +          ..+.+||++|=+...+-++....++-....|..-|++|-.     ++.+...       +-+-..+ 
T Consensus       221 --v----------g~~~kPVLlKrg~~ati~ewl~AaEyi~~~Gn~~vilceR-----GirT~e~-------~tRntld-  275 (360)
T PRK12595        221 --A----------GRVNKPVLLKRGLSATIEEFIYAAEYIMSQGNDQIILCER-----GIRTYEK-------ATRNTLD-  275 (360)
T ss_pred             --H----------HCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEC-----CCCCCCC-------CCCCCCC-
T ss_conf             --8----------6139937960799999999999999998679987899917-----7567787-------6688988-


Q ss_pred             HHHHHHHHHHHCCCCEEEEE----ECCCCCHH--HHHHHHHCCCCEEEECHH-----HHCC-----CHHHHHHHHHHHHH
Q ss_conf             68999999974089748999----67889999--999999839997545278-----7706-----97899999999999
Q gi|254780434|r  273 STIALAKIRQRVGPKIAIIG----TGGISSTK--DALDKIMAGANLIQLYSA-----MIYE-----GISLPKRIIQGLSD  336 (362)
Q Consensus       273 al~~i~~i~~~~~~~i~IIg----~GGI~s~~--Da~e~l~aGAs~VQi~Ta-----li~~-----Gp~~~~~I~~~L~~  336 (362)
                       +..|-.+++..  ++|||.    .+|..+.-  =+..-+.+|||-+.|=+-     .+..     .|.-+.++.++|+.
T Consensus       276 -l~avp~~k~~t--hLPVivDPSH~~G~r~lv~~~a~aa~a~GaDGlmIEvHp~P~~AlSD~~Qql~~~~f~~l~~~l~~  352 (360)
T PRK12595        276 -ISAVPILKQET--HLPVMVDVTHSTGRRDLLLPTAKAALAIGADGVMAEVHPDPAVALSDSAQQMDIPEFDRFYDELKP  352 (360)
T ss_pred             -HHHHHHHHCCC--CCCEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCHHHCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             -67889986499--999898996521557589999999997499979998668823215871004899999999999999


Q ss_pred             HHHHCC
Q ss_conf             999838
Q gi|254780434|r  337 FLNKEN  342 (362)
Q Consensus       337 ~l~~~G  342 (362)
                      +.+..+
T Consensus       353 ~~~~~~  358 (360)
T PRK12595        353 LADKLN  358 (360)
T ss_pred             HHHHHC
T ss_conf             999854


No 283
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776    This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea . The oxaloacetate decarboxylase Na+ pump is the paradigm of the family of Na+ transport decarboxylases that present in bacteria and archaea. It a multi subunit enzyme consisting of a peripheral alpha-subunit and integral membrane subunits beta and gamma. The energy released by the decarboxylation reaction of oxaloacetate is coupled to Na+ ion pumping across the membrane.; GO: 0008948 oxaloacetate decarboxylase activity, 0006814 sodium ion transport.
Probab=95.20  E-value=0.18  Score=29.67  Aligned_cols=213  Identities=23%  Similarity=0.317  Sum_probs=116.6

Q ss_pred             HHHHHHCCCCEEEC-CCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCC-----CCEE-ECC
Q ss_conf             88874036752410-2001368789988626884255541000024777778899987641000121-----0001-104
Q gi|254780434|r   71 PIELLKLGFGFVEI-GTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPI-----GINL-GAN  143 (362)
Q Consensus        71 ~~~l~~~G~G~v~~-ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi-----~vsI-~~~  143 (362)
                      +..|.+.||..+|+ |.=|...+-     |+  |            +=+.|+.+ +.||+.-++.||     |=|+ |+-
T Consensus        27 ~~~LD~vGfwSLEvWGGATFDaC~-----RF--L------------~EDPW~RL-R~lk~~~pnT~L~MLLRGQNLlGYR   86 (616)
T TIGR01108        27 LEKLDDVGFWSLEVWGGATFDACI-----RF--L------------NEDPWERL-RELKKALPNTKLQMLLRGQNLLGYR   86 (616)
T ss_pred             HHHHHHCCCEEEEECCCHHHHHHH-----HH--C------------CCCHHHHH-HHHHHHCCCCCHHHHHCCCCCCCCC
T ss_conf             987502495565202441055784-----42--4------------88855899-9999735787512342045423441


Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCC-CCE--EEEECCCCC
Q ss_conf             54246788776555420675526983033365322110000234321111224445565531268-851--786505777
Q gi|254780434|r  144 KDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGK-FVP--IFLKISPDL  220 (362)
Q Consensus       144 ~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~-~~P--i~vKLsPd~  220 (362)
                      .-.+|-++.|++.  .+..+.|.|=| |        -.|-|+=+|..-+.+++        +... ++-  |-=-+||-=
T Consensus        87 HYADDVVe~FV~~--a~~NG~DVFRi-F--------DALND~RNl~~ai~a~K--------k~g~dHvQg~iSYTtSPvH  147 (616)
T TIGR01108        87 HYADDVVEAFVKK--AVENGLDVFRI-F--------DALNDPRNLQKAIEAAK--------KHGADHVQGAISYTTSPVH  147 (616)
T ss_pred             CCCHHHHHHHHHH--HHHCCCEEEEE-E--------CCCCCHHHHHHHHHHHH--------HHCCCEEEEEEECCCCCHH
T ss_conf             5843689999999--99759808995-1--------24588778999999999--------7389789999712468436


Q ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEE----EECCC
Q ss_conf             74888999998764498299980665553234577544632211356454246899999997408974899----96788
Q gi|254780434|r  221 SEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAII----GTGGI  296 (362)
Q Consensus       221 ~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~II----g~GGI  296 (362)
                      |-+...++++.+.+.|+|-|++    .|+.|+++|..               +-++|+.+++.++ .+||=    ..-|-
T Consensus       148 Tl~~yl~la~~L~~~G~DSI~I----KDMaGlLTP~~---------------AYELV~alK~~~~-n~pvhLH~H~TtGm  207 (616)
T TIGR01108       148 TLEKYLELAKELLEMGVDSICI----KDMAGLLTPKV---------------AYELVSALKKEFG-NLPVHLHSHATTGM  207 (616)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEE----ECCCCCCCHHH---------------HHHHHHHHHHHCC-CEEEEEECCCCHHH
T ss_conf             7888999999999818860552----02004644158---------------9999999974239-74688632472337


Q ss_pred             CCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9999999999839997545278770697899999999999999838997
Q gi|254780434|r  297 SSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVN  345 (362)
Q Consensus       297 ~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~s  345 (362)
                      .+ ---++-+.||||.+-=|=+-+..|.+...  -+-|-..|+..||++
T Consensus       208 A~-~AllkA~EAG~d~iDTAisS~S~gtSHPp--tE~lv~~L~~~gyD~  253 (616)
T TIGR01108       208 AE-MALLKAIEAGADMIDTAISSMSGGTSHPP--TETLVAALRGTGYDT  253 (616)
T ss_pred             HH-HHHHHHHHCCCCCCHHCCCCCCCCCCCCH--HHHHHHHHHCCCCCC
T ss_conf             99-99998887078800200552347888874--799999970578743


No 284
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional
Probab=95.17  E-value=0.14  Score=30.48  Aligned_cols=233  Identities=18%  Similarity=0.246  Sum_probs=116.8

Q ss_pred             CEEEE--CCEECC--CCEEECCCCC--CCHH----HHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECC
Q ss_conf             11688--873359--9748534688--8677----988874036752410200136878998862688425554100002
Q gi|254780434|r   45 LNTKV--AGISLS--NPLGMAAGYD--KNAE----VPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLG  114 (362)
Q Consensus        45 L~~~~--~Gl~~~--nPiglAaG~d--k~~~----~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~G  114 (362)
                      ..+++  .++.|-  +|+.+-||++  -+-|    ..+.+.++|..+.--|-  .+||+   +|              +.
T Consensus        85 ~~v~~~~G~v~~G~~~~~~iiAGPCsvEs~eq~~~~A~~vk~~Ga~~lRgGa--~KPRT---sP--------------ys  145 (352)
T PRK13396         85 VVVPTPNGPVTFGENHPVVVVAGPCSVENEEMIVETAKRVKAAGAKFLRGGA--YKPRT---SP--------------YA  145 (352)
T ss_pred             EEEECCCCCEEECCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEECCCC--CCCCC---CC--------------CC
T ss_conf             3995689877747997799996787568999999999999983998782650--24789---98--------------54


Q ss_pred             CCCCCHHHHHHHHHHH--HHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             4777778899987641--00012100011045424678877655542067552698303336532211000023432111
Q gi|254780434|r  115 FNNAGYHTVFSRLSKI--QPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLL  192 (362)
Q Consensus       115 l~N~G~~~~~~~l~~~--~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l  192 (362)
                      |+-.| +.-++-|++.  ..+.|+..-|+-.           +-++.+..++|.+-|        |-|.+|+.+.|    
T Consensus       146 FqGlG-eeGL~~L~~ak~e~GLpvvTEV~~~-----------~~ve~v~~~~DilQI--------GARn~qNf~LL----  201 (352)
T PRK13396        146 FQGHG-ESALELLAAAREATGLGIITEVMDA-----------ADLDKIAEVADVIQV--------GARNMQNFSLL----  201 (352)
T ss_pred             CCCCC-HHHHHHHHHHHHHHCCCEEEEECCH-----------HHHHHHHHHCCEEEE--------CCHHHCCHHHH----
T ss_conf             35870-8799999999998699726886799-----------999999865888998--------92540599999----


Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             12244455655312688517865057777488899999876449829998066555323457754463221135645424
Q gi|254780434|r  193 IHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLK  272 (362)
Q Consensus       193 ~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~  272 (362)
                      .++          ..+.+||++|=+...+-++....++.+...|.+-+++|-.     ++......     + .+...+ 
T Consensus       202 ~~~----------g~t~kPVllKrg~~~ti~ewl~AaEyi~~~Gn~~viLcER-----Girtfe~~-----~-~RntlD-  259 (352)
T PRK13396        202 KKV----------GAQDKPVLLKRGMSATIDEWLMAAEYILAAGNPNVILCER-----GIRTFDRQ-----Y-TRNTLD-  259 (352)
T ss_pred             HHH----------HCCCCEEEECCCCCCCHHHHHHHHHHHHHCCCCCEEEEEC-----CCCCCCCC-----C-CCCCCC-
T ss_conf             998----------5469807973788899999986999999769985899948-----97756676-----5-467755-


Q ss_pred             HHHHHHHHHHHCCCCEEEEEE----CCCCCH--HHHHHHHHCCCCEEEECHH-----HHCCCH-----HHHHHHHHHHHH
Q ss_conf             689999999740897489996----788999--9999999839997545278-----770697-----899999999999
Q gi|254780434|r  273 STIALAKIRQRVGPKIAIIGT----GGISST--KDALDKIMAGANLIQLYSA-----MIYEGI-----SLPKRIIQGLSD  336 (362)
Q Consensus       273 al~~i~~i~~~~~~~i~IIg~----GGI~s~--~Da~e~l~aGAs~VQi~Ta-----li~~Gp-----~~~~~I~~~L~~  336 (362)
                       +..|-.+++..  ++|||.-    .|-.+.  .=+..-+.+|||-+.+=+-     ....||     .-+.++.++|+ 
T Consensus       260 -l~aip~~k~~t--hlPVi~DPSH~~G~r~~V~~la~AAva~GaDGL~iEvHp~P~~AlSDg~Q~l~p~~f~~l~~~l~-  335 (352)
T PRK13396        260 -LSVIPVLRSLT--HLPIMIDPSHGTGKSEYVPSMAMAAIAAGTDSLMIEVHPNPAKALSDGPQSLTPERFDRLMQELA-  335 (352)
T ss_pred             -HHHHHHHHHCC--CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHH-
T ss_conf             -78879997489--99889789864578727999999999839988999846880115787523589999999999999-


Q ss_pred             HHHHCCCCCHHHHHCCCC
Q ss_conf             999838997789616975
Q gi|254780434|r  337 FLNKENEVNFENIRGSYT  354 (362)
Q Consensus       337 ~l~~~G~~si~e~iG~~~  354 (362)
                              .|.+++|+..
T Consensus       336 --------~i~~~vgr~~  345 (352)
T PRK13396        336 --------VIGKTVGRWP  345 (352)
T ss_pred             --------HHHHHHCCCC
T ss_conf             --------9999967898


No 285
>TIGR00674 dapA dihydrodipicolinate synthase; InterPro: IPR005263   Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants. The enzyme catalyses the condensation of L-aspartate-beta-semialdehyde and pyruvate to dihydropicolinic acid via a ping-pong mechanism in which pyruvate binds to the enzyme by forming a Schiff-base with a lysine residue . Three other proteins are structurally related to DHDPS and probably also act via a similar catalytic mechanism. These are Escherichia coli N-acetylneuraminate lyase (4.1.3.3 from EC, IPR005264 from INTERPRO) (gene nanA), which catalyzes the condensation of N-acetyl-D-mannosamine and pyruvate to form N-acetylneuraminate; Sinorhizobium meliloti protein mosA , which is involved in the biosynthesis of the rhizopine 3-O-methyl-scyllo-inosamine; and E. coli hypothetical protein yjhH. The sequences of DHDPS from different sources are well-conserved. The structure takes the form of a homotetramer, in which 2 monomers are related by an approximate 2-fold symmetry . Each monomer comprises 2 domains: an 8-fold alpha-/beta-barrel, and a C-terminal alpha-helical domain. The fold resembles that of N-acetylneuraminate lyase. The active site lysine is located in the barrel domain, and has access via 2 channels on the C-terminal side of the barrel.   This family represents a subclass of dihydrodipicolinate synthase. ; GO: 0008840 dihydrodipicolinate synthase activity, 0019877 diaminopimelate biosynthetic process.
Probab=95.17  E-value=0.29  Score=28.35  Aligned_cols=19  Identities=16%  Similarity=0.167  Sum_probs=7.6

Q ss_pred             CCCHHHHHHHHHHHHHHHH
Q ss_conf             0697899999999999999
Q gi|254780434|r  321 YEGISLPKRIIQGLSDFLN  339 (362)
Q Consensus       321 ~~Gp~~~~~I~~~L~~~l~  339 (362)
                      -..+.-.++|+.-|...++
T Consensus       222 ~G~~~~A~EIh~kL~~L~~  240 (288)
T TIGR00674       222 EGDFAEAREIHQKLMPLFK  240 (288)
T ss_pred             CCCHHHHHHHHHHHHHHHH
T ss_conf             3897899999987888988


No 286
>pfam02219 MTHFR Methylenetetrahydrofolate reductase. This family includes the 5,10-methylenetetrahydrofolate reductase EC:1.7.99.5 from bacteria and methylenetetrahydrofolate reductase EC: 1.5.1.20 from eukaryotes. The structure for this domain is known to be a TIM barrel.
Probab=95.16  E-value=0.29  Score=28.34  Aligned_cols=132  Identities=17%  Similarity=0.195  Sum_probs=61.9

Q ss_pred             CCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHH
Q ss_conf             42467887765554206755269830333653221100002343211112244455655312688517865057777488
Q gi|254780434|r  145 DSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEE  224 (362)
Q Consensus       145 ~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~  224 (362)
                      ++.+.-.|+..+.+++..+|||+.-          +.+.+.+.+.++++.+.        ....++||++-+-|-.+..+
T Consensus       153 ~a~~~~~di~~L~~Ki~aGA~f~iT----------Q~~fd~~~~~~f~~~~~--------~~Gi~~PIi~GI~Pi~s~~~  214 (286)
T pfam02219       153 EAKSWQADLKYLKEKVDAGADFIIT----------QLFFDVDNFLRFVDRCR--------AAGIDIPIIPGIMPITSYKS  214 (286)
T ss_pred             CCCCHHHHHHHHHHHHHCCCHHHHH----------HHEECHHHHHHHHHHHH--------HCCCCCEEECCCEEECCHHH
T ss_conf             5121999999999999846105364----------35324999999999999--------74998204215211146889


Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCC-CHHHHH
Q ss_conf             8999998764498299980665553234577544632211356454246899999997408974899967889-999999
Q gi|254780434|r  225 LDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGIS-STKDAL  303 (362)
Q Consensus       225 i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~-s~~Da~  303 (362)
                      +..+.+      .-|+.+-.                              .++..+.+.-++.-..-.+ ||. ..+.+.
T Consensus       215 ~~~~~~------~~Gi~iP~------------------------------~l~~~l~~~~~~~e~~~~~-gi~~a~e~~~  257 (286)
T pfam02219       215 LKRIAK------LSGVSIPQ------------------------------ELIDRLEPIKDDDEAVKSI-GIELAVEMCK  257 (286)
T ss_pred             HHHHHH------HCCCCCCH------------------------------HHHHHHHHCCCCHHHHHHH-HHHHHHHHHH
T ss_conf             999997------35998949------------------------------9999998547999999999-9999999999


Q ss_pred             HHHHCCCCEEEECHHHHCCCHHHHHHHHHHH
Q ss_conf             9998399975452787706978999999999
Q gi|254780434|r  304 DKIMAGANLIQLYSAMIYEGISLPKRIIQGL  334 (362)
Q Consensus       304 e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L  334 (362)
                      +.+..|++-+.+||   ++-+..+.+|++.|
T Consensus       258 ~l~~~Gv~GiH~yt---~N~~~~~~~Il~~l  285 (286)
T pfam02219       258 KLLAEGVPGLHFYT---LNREEAILEILEQL  285 (286)
T ss_pred             HHHHCCCCEEEEEC---CCCHHHHHHHHHHC
T ss_conf             99977998669950---89759999999972


No 287
>PRK07807 inositol-5-monophosphate dehydrogenase; Validated
Probab=95.16  E-value=0.1  Score=31.30  Aligned_cols=86  Identities=16%  Similarity=0.313  Sum_probs=58.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             78650577774888999998764498299980665553234577544632211356454246899999997408974899
Q gi|254780434|r  212 IFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAII  291 (362)
Q Consensus       212 i~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~II  291 (362)
                      +-+-++.   .++..+-++++.++|+|-+++ .|         ...      -|     ...++.|+++++.. ++++| 
T Consensus       218 VgAAVGv---~~d~~eR~~aLv~AGvDvlvI-Dt---------AHG------hS-----~~vi~~vk~iK~~~-p~~~v-  271 (479)
T PRK07807        218 VAAAVGI---NGDVAAKARALLEAGVDVLVI-DT---------AHG------HQ-----EKMLEAIRAVRALD-PGVPL-  271 (479)
T ss_pred             EEEEECC---CCCHHHHHHHHHHCCCCEEEE-EC---------CCC------CH-----HHHHHHHHHHHHHC-CCCCE-
T ss_conf             7887257---845899999999769989997-54---------576------64-----89999999998408-98857-


Q ss_pred             EECCCCCHHHHHHHHHCCCCEE-------EECHHHHCCC
Q ss_conf             9678899999999998399975-------4527877069
Q gi|254780434|r  292 GTGGISSTKDALDKIMAGANLI-------QLYSAMIYEG  323 (362)
Q Consensus       292 g~GGI~s~~Da~e~l~aGAs~V-------Qi~Tali~~G  323 (362)
                      -+|-|-+++.|.+.+.||||+|       .+||.=+--|
T Consensus       272 iaGNvaT~~~a~~Li~aGad~ikvGiG~GSiCtTr~v~g  310 (479)
T PRK07807        272 VAGNVVTAEGTRDLVEAGADIVKVGVGPGAMCTTRMMTG  310 (479)
T ss_pred             EEEEHHHHHHHHHHHHCCCCEEECCCCCCCCEECCCCCC
T ss_conf             874320299999999739997631555783243463237


No 288
>PRK06267 hypothetical protein; Provisional
Probab=95.02  E-value=0.31  Score=28.08  Aligned_cols=132  Identities=16%  Similarity=0.196  Sum_probs=93.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             17865057777488899999876449829998066555323457754463221135645424689999999740897489
Q gi|254780434|r  211 PIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAI  290 (362)
Q Consensus       211 Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~I  290 (362)
                      -++|-|+  .+.+++.+.+..+.+.++|-|.+ |.....+++.-...+      ++.+  .-.+++|+.+|=.+ +++-|
T Consensus       172 G~ivGlG--ET~ed~~~~~~~lkel~~d~I~I-~~f~P~~gTP~en~p------~~t~--~e~lk~iA~~RL~~-Pki~I  239 (324)
T PRK06267        172 TIILGLG--ETEDDIELLLNLIEELNLDRITF-YSLNPQKETIFEGKP------SPTT--LEYMNWVSSVRLNF-PKIKI  239 (324)
T ss_pred             EEEEECC--CCHHHHHHHHHHHHHCCCCEEEE-CCCCCCCCCCCCCCC------CCCH--HHHHHHHHHHHHHC-CCCCC
T ss_conf             4687379--88999999999999769997632-584589999889999------9899--99999999999968-87125


Q ss_pred             EEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHH-HHHCC-CCCHHHHHCCCC
Q ss_conf             99678899999999998399975452787706978999999999999-99838-997789616975
Q gi|254780434|r  291 IGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDF-LNKEN-EVNFENIRGSYT  354 (362)
Q Consensus       291 Ig~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~-l~~~G-~~si~e~iG~~~  354 (362)
                      ++.-.+.....+--.++|||+.+-..-.|-+-|-...+++-+|...- .+-+| |++++-+.|...
T Consensus       240 ~~~t~~~~~~ni~~ll~aGan~itkfp~~~~~~~~~~~~~e~~~~~~~r~~~~~~~~~~~~~~~~~  305 (324)
T PRK06267        240 ITGTWVDKLTNIGPLVMAGSNVITKFPLFSMYGKKEGKTVENEIKSTGRELYGSFSDLDLLKGGKS  305 (324)
T ss_pred             CCCCCCCCCCCCCHHHHCCCCCCCCCHHHHHHCHHHHHHHHHHHHHHHHHHHCCCCHHHHHCCCCC
T ss_conf             357653571100187764776301041088636287777999999964666345431887568430


No 289
>KOG1606 consensus
Probab=94.93  E-value=0.15  Score=30.20  Aligned_cols=77  Identities=14%  Similarity=0.226  Sum_probs=56.6

Q ss_pred             HHHHHHHHHHCCCCEEE--EEECCCCCHHHHHHHHHCCCCEEEECHHHH------------------CCCHHHHHHHHHH
Q ss_conf             89999999740897489--996788999999999983999754527877------------------0697899999999
Q gi|254780434|r  274 TIALAKIRQRVGPKIAI--IGTGGISSTKDALDKIMAGANLIQLYSAMI------------------YEGISLPKRIIQG  333 (362)
Q Consensus       274 l~~i~~i~~~~~~~i~I--Ig~GGI~s~~Da~e~l~aGAs~VQi~Tali------------------~~Gp~~~~~I~~~  333 (362)
                      ..++++..+.  +++|+  .+.|||.++.||.-++-.|.|-|-++|+..                  |..|...-++-.+
T Consensus       196 ~dLv~~t~q~--GrlPVV~FAaGGvaTPADAALmMQLGCdGVFVGSgiFks~dP~k~a~aiVqAvthy~dp~~L~evS~~  273 (296)
T KOG1606         196 YDLVKQTKQL--GRLPVVNFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPVKRARAIVQAVTHYDDPAKLAEVSSG  273 (296)
T ss_pred             HHHHHHHHHC--CCCCEEEECCCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHCC
T ss_conf             8999999970--87745874256758816799999808984886554236898899999999998705888999987415


Q ss_pred             HHHHHHHCCCCCHHHHHCC
Q ss_conf             9999998389977896169
Q gi|254780434|r  334 LSDFLNKENEVNFENIRGS  352 (362)
Q Consensus       334 L~~~l~~~G~~si~e~iG~  352 (362)
                      |.+.|.--...++.+..+.
T Consensus       274 Lg~aM~g~~i~~~~~~~f~  292 (296)
T KOG1606         274 LGEAMVGISIQSIKEARFA  292 (296)
T ss_pred             HHHHHHCCCCCCHHHHHCC
T ss_conf             7877525544502444212


No 290
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional
Probab=94.80  E-value=0.17  Score=29.82  Aligned_cols=70  Identities=16%  Similarity=0.224  Sum_probs=51.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             88517865057777488899999876449829998066555323457754463221135645424689999999740897
Q gi|254780434|r  208 KFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPK  287 (362)
Q Consensus       208 ~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~  287 (362)
                      ..+|+++-=      .     .+.+...|+||+.+.-.                            -.-+.++|+.++++
T Consensus        70 ~gv~lIIND------~-----~dlA~~~gADGVHlGq~----------------------------d~~~~~aR~~lg~~  110 (221)
T PRK06512         70 AGAAALIAG------D-----TRIAGRVKADGLHIEGN----------------------------AAALAEAIEKHAPK  110 (221)
T ss_pred             CCCCEEECC------C-----HHHHHHCCCCEEEECCC----------------------------CCCHHHHHHHHCCC
T ss_conf             299199889------7-----99999709986652687----------------------------53199999984788


Q ss_pred             EEEEEECCCCCHHHHHHHHHCCCCEEEECH
Q ss_conf             489996788999999999983999754527
Q gi|254780434|r  288 IAIIGTGGISSTKDALDKIMAGANLIQLYS  317 (362)
Q Consensus       288 i~IIg~GGI~s~~Da~e~l~aGAs~VQi~T  317 (362)
                      . |||++...+-+++.+--.+|||.|.++.
T Consensus       111 ~-IIG~~~~~s~~~A~~A~e~GADYv~fG~  139 (221)
T PRK06512        111 M-IVGFGNLRDRHGAMEVGELQPDYLFFGK  139 (221)
T ss_pred             C-EEEEECCCCHHHHHHHHHCCCCEEEECC
T ss_conf             6-7864057889999999973998576578


No 291
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism]
Probab=94.74  E-value=0.37  Score=27.59  Aligned_cols=101  Identities=20%  Similarity=0.289  Sum_probs=61.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             78650577774888999998764498299980665553234577544632211356454246899999997408974899
Q gi|254780434|r  212 IFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAII  291 (362)
Q Consensus       212 i~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~II  291 (362)
                      .++-+|-.    .+++ +..+.+.|+|=|.+..-      ..++...       ++  .+..+..++++++..  .+|++
T Consensus       105 ~iIG~S~h----~~ee-a~~A~~~g~DYv~~Gpi------fpT~tK~-------~~--~~~G~~~l~~~~~~~--~iP~v  162 (211)
T COG0352         105 LIIGLSTH----DLEE-ALEAEELGADYVGLGPI------FPTSTKP-------DA--PPLGLEGLREIRELV--NIPVV  162 (211)
T ss_pred             CEEEEECC----CHHH-HHHHHHCCCCEEEECCC------CCCCCCC-------CC--CCCCHHHHHHHHHHC--CCCEE
T ss_conf             78983049----9999-99987639999998886------7889998-------87--746789999999827--99989


Q ss_pred             EECCCCCHHHHHHHHHCCCCEEEECHHHHCC-C-HHHHHHHHHHHH
Q ss_conf             9678899999999998399975452787706-9-789999999999
Q gi|254780434|r  292 GTGGISSTKDALDKIMAGANLIQLYSAMIYE-G-ISLPKRIIQGLS  335 (362)
Q Consensus       292 g~GGI~s~~Da~e~l~aGAs~VQi~Tali~~-G-p~~~~~I~~~L~  335 (362)
                      +.|||. .+.+.+.+.+||+-|-+-|+++.. . ...++++.+-+.
T Consensus       163 AIGGi~-~~nv~~v~~~Ga~gVAvvsai~~a~d~~~a~~~~~~~~~  207 (211)
T COG0352         163 AIGGIN-LENVPEVLEAGADGVAVVSAITSAADPAAAAKALRNALE  207 (211)
T ss_pred             EECCCC-HHHHHHHHHHCCCEEEEHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             984889-999999998298769726686607988999999999987


No 292
>KOG2550 consensus
Probab=94.71  E-value=0.17  Score=29.81  Aligned_cols=68  Identities=19%  Similarity=0.352  Sum_probs=49.1

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHH
Q ss_conf             99999876449829998066555323457754463221135645424689999999740897489996788999999999
Q gi|254780434|r  226 DDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDK  305 (362)
Q Consensus       226 ~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~  305 (362)
                      ..-.+.+.++|+|-|++-          .+..         ..++  -+++|+++++.+ ++++||| |-|-+.+.|.+.
T Consensus       253 K~rl~ll~~aGvdvviLD----------SSqG---------nS~~--qiemik~iK~~y-P~l~Via-GNVVT~~qa~nL  309 (503)
T KOG2550         253 KERLDLLVQAGVDVVILD----------SSQG---------NSIY--QLEMIKYIKETY-PDLQIIA-GNVVTKEQAANL  309 (503)
T ss_pred             HHHHHHHHHCCCCEEEEE----------CCCC---------CCHH--HHHHHHHHHHHC-CCCEEEC-CCEEEHHHHHHH
T ss_conf             677888663488689996----------6888---------5045--799999998668-8863431-655338889999


Q ss_pred             HHCCCCEEEEC
Q ss_conf             98399975452
Q gi|254780434|r  306 IMAGANLIQLY  316 (362)
Q Consensus       306 l~aGAs~VQi~  316 (362)
                      |.||||-+-|+
T Consensus       310 I~aGaDgLrVG  320 (503)
T KOG2550         310 IAAGADGLRVG  320 (503)
T ss_pred             HHCCCCEEEEC
T ss_conf             87367605752


No 293
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the cost of also yielding formaldehyde. These latter species tend usually have a formaldehyde-activating enzyme to attach formaldehyde to the C1 carrier tetrahydromethanopterin. In these species, the enzyme is viewed as a lyase rather than a synthase and is called D-arabino 3-hexulose 6-phosphate formaldehyde lyase. Note that there is some overlap in specificity with the Escherichia coli enzyme 3-keto-L-gulonate 6-phosphate decarboxylase.
Probab=94.68  E-value=0.38  Score=27.50  Aligned_cols=161  Identities=13%  Similarity=0.074  Sum_probs=87.2

Q ss_pred             HHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99987641000121000110454246788776555420675526983033365322110000234321111224445565
Q gi|254780434|r  123 VFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEE  202 (362)
Q Consensus       123 ~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~  202 (362)
                      +.++|++..++.+|.+-+ +..++....   .+  ..+..+||++.+-=+++          .+.+...+.+.   +   
T Consensus        42 ~v~~lk~~~p~~~I~~Dl-K~~D~g~~~---~~--~~~~~Gad~itVh~~~~----------~~ti~~a~~~a---~---   99 (206)
T TIGR03128        42 AVKEMKEAFPDRKVLADL-KTMDAGEYE---AE--QAFAAGADIVTVLGVAD----------DATIKGAVKAA---K---   99 (206)
T ss_pred             HHHHHHHHCCCCEEEEEE-EECCCHHHH---HH--HHHHCCCCEEEEECCCC----------HHHHHHHHHHH---H---
T ss_conf             999999878999799995-044743899---99--99972898999943489----------79999999999---9---


Q ss_pred             HHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             53126885178650577774888999998764498299980665553234577544632211356454246899999997
Q gi|254780434|r  203 KIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQ  282 (362)
Q Consensus       203 ~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~  282 (362)
                          ...+.+.+-+..   ..+....++.+.+.|+|++.+.... +                 ...........+..+++
T Consensus       100 ----~~~~~v~vdl~~---~~~~~~~a~~~~~~g~d~v~~h~g~-d-----------------~~~~~~~~~~~~~~~~~  154 (206)
T TIGR03128       100 ----KHGKEVQVDLIN---VKDKVKRAKELKELGADYIGVHTGL-D-----------------EQAKGQNPFEDLQTILK  154 (206)
T ss_pred             ----HCCCEEEEEECC---CCCHHHHHHHHHHCCCCEEEEECCC-C-----------------HHHCCCCCHHHHHHHHH
T ss_conf             ----739979999747---8988999999997589889950250-0-----------------44326798899999986


Q ss_pred             HCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCC--CHH-HHHHHHHH
Q ss_conf             4089748999678899999999998399975452787706--978-99999999
Q gi|254780434|r  283 RVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYE--GIS-LPKRIIQG  333 (362)
Q Consensus       283 ~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~--Gp~-~~~~I~~~  333 (362)
                      ...+  +-++++|=-+...+.+.+.+|||.|=++++ +++  .|. ..++|.++
T Consensus       155 ~~~~--~~i~v~gGi~~~t~~~ai~~Gad~vVVGR~-It~A~dP~~aa~~i~e~  205 (206)
T TIGR03128       155 LVKE--ARVAVAGGINLDTIPDVIKLGPDIVIVGGA-ITKAADPAEAARQIRKL  205 (206)
T ss_pred             CCCC--CCEEECCCCCCCCHHHHHHCCCCEEEECCC-CCCCCCHHHHHHHHHHH
T ss_conf             2578--736367986835699998669999998961-24799999999999974


No 294
>pfam02581 TMP-TENI Thiamine monophosphate synthase/TENI. Thiamine monophosphate synthase (TMP) (EC:2.5.1.3) catalyses the substitution of the pyrophosphate of 2-methyl-4-amino-5- hydroxymethylpyrimidine pyrophosphate by 4-methyl-5- (beta-hydroxyethyl)thiazole phosphate to yield thiamine phosphate. This Pfam family also includes the regulatory protein TENI.
Probab=94.65  E-value=0.23  Score=28.98  Aligned_cols=85  Identities=20%  Similarity=0.270  Sum_probs=55.8

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             78650577774888999998764498299980665553234577544632211356454246899999997408974899
Q gi|254780434|r  212 IFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAII  291 (362)
Q Consensus       212 i~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~II  291 (362)
                      .++-.|-.    ...+ +..+.+.|+|-+++.--      ..+...         +...|..+..++++.+..  ++|++
T Consensus        96 ~iiG~S~h----~~~e-~~~a~~~gaDYi~~gpv------f~T~sK---------~~~~~~g~~~~~~~~~~~--~~Pv~  153 (180)
T pfam02581        96 KIIGVSTH----TLEE-ALEAEALGADYIGFGPV------FPTPTK---------PDAPPLGLEGLRAIAEAV--NIPVV  153 (180)
T ss_pred             CEEEECCC----CHHH-HHHHHHCCCCCEEECCC------CCCCCC---------CCCCCCCHHHHHHHHHHC--CCCEE
T ss_conf             68974478----8999-99998719980887476------777999---------998878989999999858--99999


Q ss_pred             EECCCCCHHHHHHHHHCCCCEEEECHHH
Q ss_conf             9678899999999998399975452787
Q gi|254780434|r  292 GTGGISSTKDALDKIMAGANLIQLYSAM  319 (362)
Q Consensus       292 g~GGI~s~~Da~e~l~aGAs~VQi~Tal  319 (362)
                      +.||| +.+++.+.+.+||+-|-+.|++
T Consensus       154 AiGGI-~~~n~~~~~~~Ga~gvAvis~i  180 (180)
T pfam02581       154 AIGGI-TPENVPEVLEAGADGVAVVSAI  180 (180)
T ss_pred             EECCC-CHHHHHHHHHCCCCEEEEECCC
T ss_conf             99098-9999999998599889996509


No 295
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only]
Probab=94.63  E-value=0.39  Score=27.42  Aligned_cols=211  Identities=13%  Similarity=0.212  Sum_probs=110.3

Q ss_pred             HHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCHHH
Q ss_conf             98887403675241020013687899886268842555410000247777788999876410001210001104542467
Q gi|254780434|r   70 VPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPIGINLGANKDSKDF  149 (362)
Q Consensus        70 ~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi~vsI~~~~~s~~~  149 (362)
                      -..++.+.|+-++.+--....|-.   + .+  -|+   -+-+|       ..+..++.+ .-..|+|+|+-.|.    .
T Consensus        39 dA~~leegG~DavivEN~gD~Pf~---k-~v--~~~---tvaaM-------a~iv~~v~r-~v~iPvGvNVLrNd----~   97 (263)
T COG0434          39 DAAALEEGGVDAVIVENYGDAPFL---K-DV--GPE---TVAAM-------AVIVREVVR-EVSIPVGVNVLRND----A   97 (263)
T ss_pred             HHHHHHHCCCCEEEEECCCCCCCC---C-CC--CHH---HHHHH-------HHHHHHHHH-HCCCCCEEEEECCC----C
T ss_conf             999998489768997135788777---7-79--747---88999-------999999987-50766103210266----2


Q ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE----EECCCCCCHHHH
Q ss_conf             8877655542067552698303336532211000023432111122444556553126885178----650577774888
Q gi|254780434|r  150 ILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIF----LKISPDLSEEEL  225 (362)
Q Consensus       150 ~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~----vKLsPd~~~~~i  225 (362)
                      ..-|.-   ..+..|||+-+|.-|=-     .+.+..-++.-...+...+..  ..  .++-++    ||=+-.+....+
T Consensus        98 vaA~~I---A~a~gA~FIRVN~~tg~-----~~tdqGiieg~A~e~~r~r~~--L~--~~v~vlADv~VKHa~~l~~~~~  165 (263)
T COG0434          98 VAALAI---AYAVGADFIRVNVLTGA-----YATDQGIIEGNAAELARYRAR--LG--SRVKVLADVHVKHAVHLGNRSL  165 (263)
T ss_pred             HHHHHH---HHHCCCCEEEEEEEECE-----EECCCCCCCCHHHHHHHHHHH--CC--CCCEEEEECHHHCCCCCCCCCH
T ss_conf             888999---98607977998734342-----763565014448899998986--16--7737976111321532378688


Q ss_pred             HHHHHH-HHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHH
Q ss_conf             999998-7644982999806655532345775446322113564542468999999974089748999678899999999
Q gi|254780434|r  226 DDIAVE-VLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALD  304 (362)
Q Consensus       226 ~~ia~~-a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e  304 (362)
                      .+.++- ++..++||++++...   .               |.   +..+.-++.+++..+  .|++..-|| +.+.+.+
T Consensus       166 ~~~v~dtver~~aDaVI~tG~~---T---------------G~---~~d~~el~~a~~~~~--~pvlvGSGv-~~eN~~~  221 (263)
T COG0434         166 EEAVKDTVERGLADAVIVTGSR---T---------------GS---PPDLEELKLAKEAVD--TPVLVGSGV-NPENIEE  221 (263)
T ss_pred             HHHHHHHHHCCCCCEEEEECCC---C---------------CC---CCCHHHHHHHHHCCC--CCEEEECCC-CHHHHHH
T ss_conf             9999999970488779995666---7---------------89---999899999986269--878973688-8889999


Q ss_pred             HHHCCCCEEEECHHHHCCC-------HHHHHHHHHHHHHHH
Q ss_conf             9983999754527877069-------789999999999999
Q gi|254780434|r  305 KIMAGANLIQLYSAMIYEG-------ISLPKRIIQGLSDFL  338 (362)
Q Consensus       305 ~l~aGAs~VQi~Tali~~G-------p~~~~~I~~~L~~~l  338 (362)
                      ++.. ||-+-++|.+-..|       +.-++++.+..++.+
T Consensus       222 ~l~~-adG~IvgT~lK~~G~~~n~VD~~Rv~~~v~~a~~~~  261 (263)
T COG0434         222 LLKI-ADGVIVGTSLKKGGVTWNPVDLERVRRFVEAARRLR  261 (263)
T ss_pred             HHHH-CCCEEEEEEECCCCEECCCCCHHHHHHHHHHHHHHC
T ss_conf             9987-286699786603886368459999999999998753


No 296
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional
Probab=94.56  E-value=0.28  Score=28.40  Aligned_cols=65  Identities=14%  Similarity=0.126  Sum_probs=44.3

Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHC
Q ss_conf             99876449829998066555323457754463221135645424689999999740897489996788999999999983
Q gi|254780434|r  229 AVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMA  308 (362)
Q Consensus       229 a~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~a  308 (362)
                      ++.+.++|+|=|.+--|...|++           |.+       -..++.++++.+ + ..  -+.-|.|-+|+..-..+
T Consensus        81 v~~l~~aGadiIA~DaT~R~RP~-----------g~~-------~~~~i~~i~~~~-~-~l--~MAD~st~eea~~A~~~  138 (222)
T PRK01130         81 VDALAAAGADIIALDATLRPRPD-----------GET-------LAELVKRIKEKP-G-QL--LMADCSTLEEGLAAAKL  138 (222)
T ss_pred             HHHHHHCCCCEEEEECCCCCCCC-----------CCC-------HHHHHHHHHHHH-C-CE--EEEECCCHHHHHHHHHC
T ss_conf             99999869999998467898989-----------968-------999999999982-9-87--89854889999999984


Q ss_pred             CCCEEEE
Q ss_conf             9997545
Q gi|254780434|r  309 GANLIQL  315 (362)
Q Consensus       309 GAs~VQi  315 (362)
                      |+|.|.-
T Consensus       139 G~D~V~T  145 (222)
T PRK01130        139 GFDFIGT  145 (222)
T ss_pred             CCCEEEC
T ss_conf             9999972


No 297
>pfam04309 G3P_antiterm Glycerol-3-phosphate responsive antiterminator. Intracellular glycerol is usually converted to glycerol-3-phosphate in an ATP-requiring phosphorylation reaction catalysed by glycerol kinase (GlpK) glycerol-3-phosphate activates the antiterminator GlpP.
Probab=94.55  E-value=0.079  Score=32.11  Aligned_cols=41  Identities=24%  Similarity=0.372  Sum_probs=36.1

Q ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             8999999974089748999678899999999998399975452
Q gi|254780434|r  274 TIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLY  316 (362)
Q Consensus       274 l~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~  316 (362)
                      .+.+.++++.+  +.|||+.|=|.+.+|+.+.+.+||.+|--.
T Consensus       128 p~~i~~i~~~~--~~PiIAGGLI~~~edv~~aL~aGA~aVSTS  168 (174)
T pfam04309       128 PKVIQEITERT--NIPIIAGGLIRTEEEVREALKAGAVAVSTS  168 (174)
T ss_pred             HHHHHHHHHHC--CCCEEEECCCCCHHHHHHHHHCCCEEEECC
T ss_conf             99999999747--999997678388999999998499699878


No 298
>pfam09370 TIM-br_sig_trns TIM-barrel signal transduction protein. This domain is likely to have a TIM barrel fold related to IGPS. Although this family of proteins are functionally uncharacterized this domain is found as an N-terminal domain of sigma 54 -dependent transcriptional activators (enhancer-binding proteins) suggesting a potential role in signal recognition/receiving and signal transduction.
Probab=94.54  E-value=0.41  Score=27.28  Aligned_cols=219  Identities=15%  Similarity=0.147  Sum_probs=95.2

Q ss_pred             CCEE-ECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCC--CCCCHHHHHHHHHHHHH
Q ss_conf             9748-53468886779888740367524102001368789988626884255541000024--77777889998764100
Q gi|254780434|r   56 NPLG-MAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGF--NNAGYHTVFSRLSKIQP  132 (362)
Q Consensus        56 nPig-lAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl--~N~G~~~~~~~l~~~~~  132 (362)
                      .||+ -+||..-.   -+.....|..++++-.-..           ||.....++.--|-+  .|.=+-.+.+++-..-.
T Consensus        15 ~pIigagaGtGls---AK~ae~gGaDlIi~ynsGr-----------fRm~G~gSlagllpygdaN~iv~ema~Evlpvv~   80 (268)
T pfam09370        15 EPIIGAGAGTGLS---AKCEEAGGADLILIYNSGR-----------YRMAGRGSLAGLLPYGNANEIVLEMAREVLPVVK   80 (268)
T ss_pred             CCEEEEECCCCHH---HHHHHHCCCCEEEEECCCH-----------HHHCCCCCHHHHCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             9669973251165---7899857986998615403-----------4435883131201356576999999988875535


Q ss_pred             CCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCC--CCCCCC--HHHHH--HHHHHHHHHHHHHHHHC
Q ss_conf             0121000110454246788776555420675526983033365322--110000--23432--11112244455655312
Q gi|254780434|r  133 TSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPG--LRSLQK--KKNLE--RLLIHVMQTREEEKIKT  206 (362)
Q Consensus       133 ~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g--~~~~~~--~~~l~--~~l~~v~~~~~~~~~~~  206 (362)
                      +.||+.-+.++.+.-+ +..|.+-+++.+  -. =..|+  |.+..  ++.-+.  ..++.  .-++.++.++.      
T Consensus        81 ~tPViaGv~~tDP~~~-~~~~L~~l~~~G--fs-GV~Nf--PTvglidG~fR~~LEetGmgy~~EVEmIr~A~~------  148 (268)
T pfam09370        81 HTPVLAGVCGTDPFRD-MDRFLDELKEMG--FA-GVQNF--PTVGLIDGEFRQNLEETGMGYDLEVEMIRLAHE------  148 (268)
T ss_pred             CCCEEEECCCCCCCCC-HHHHHHHHHHHC--CC-CEEEC--CCEEEECCHHHHHHHHCCCCHHHHHHHHHHHHH------
T ss_conf             8875876158897452-999999999719--77-44438--822033518887788808867999999999997------


Q ss_pred             CCCCEEEEECCCCC-CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCC---CCHHHHHH---HHH
Q ss_conf             68851786505777-748889999987644982999806655532345775446322113564---54246899---999
Q gi|254780434|r  207 GKFVPIFLKISPDL-SEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSP---LFLKSTIA---LAK  279 (362)
Q Consensus       207 ~~~~Pi~vKLsPd~-~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~---i~~~al~~---i~~  279 (362)
                       ..+   .-+ |+. +.+|..+    ..++|+|-|++-             .....||..|..   -..-+.+.   +..
T Consensus       149 -~dl---~T~-~yvf~~e~a~~----Ma~AGaDiIv~H-------------~GlT~gG~iG~~~a~sl~~a~~~~~~i~~  206 (268)
T pfam09370       149 -KGL---LTT-PYVFNVEEARA----MAEAGADIIVAH-------------MGLTTGGTIGADTALSLDDCVELINAIAR  206 (268)
T ss_pred             -CCC---CCC-CEECCHHHHHH----HHHCCCCEEEEC-------------CCCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             -798---333-13268999999----997499899976-------------77677767467776789999999999999


Q ss_pred             HHHHCCCCEEEEEEC-CCCCHHHHHHHHHCCCCEEEECHHHHCC
Q ss_conf             997408974899967-8899999999998399975452787706
Q gi|254780434|r  280 IRQRVGPKIAIIGTG-GISSTKDALDKIMAGANLIQLYSAMIYE  322 (362)
Q Consensus       280 i~~~~~~~i~IIg~G-GI~s~~Da~e~l~aGAs~VQi~Tali~~  322 (362)
                      ....+++++-++.-| =|.+++|+...+..-......+.+--.+
T Consensus       207 aa~~v~~diIvLchGGpI~~P~Da~~vl~~t~~~~Gf~GaSS~E  250 (268)
T pfam09370       207 AARSVNPDVIVLCHGGPIATPEDAQYVLDRTPGCHGFYGASSME  250 (268)
T ss_pred             HHHHHCCCEEEEECCCCCCCHHHHHHHHHCCCCCCEEECCCHHH
T ss_conf             99985998699951788899899999997397776676330366


No 299
>KOG0564 consensus
Probab=94.43  E-value=0.44  Score=27.11  Aligned_cols=37  Identities=22%  Similarity=0.307  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHHHHCCCCCEEE-------------------EECCCCCCCCCCCCCC
Q ss_conf             678877655542067552698-------------------3033365322110000
Q gi|254780434|r  148 DFILDYVSGIRLFFTIASYFT-------------------INISSPNTPGLRSLQK  184 (362)
Q Consensus       148 ~~~~dy~~~~~~~~~~aD~iE-------------------iNiSCPNt~g~~~~~~  184 (362)
                      +...|...+-++...+||++.                   ..++||=.||.-..+.
T Consensus       166 ~~~~Dl~yLk~KvdaGaDFIiTQlFYd~e~flkfv~~cR~~gi~~PIvPGIMPI~~  221 (590)
T KOG0564         166 DYLADLPYLKEKVDAGADFIITQLFYDVETFLKFVKDCRAAGINVPIVPGIMPIQS  221 (590)
T ss_pred             CHHHHHHHHHHHHCCCCHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHH
T ss_conf             41221689998521542143554640799999999999983788885555431020


No 300
>PRK08649 inositol-5-monophosphate dehydrogenase; Validated
Probab=94.42  E-value=0.22  Score=29.14  Aligned_cols=75  Identities=16%  Similarity=0.225  Sum_probs=45.7

Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHH
Q ss_conf             88899999876449829998066555323457754463221135645424689999999740897489996788999999
Q gi|254780434|r  223 EELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDA  302 (362)
Q Consensus       223 ~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da  302 (362)
                      .+..+.++++.++|+|-+++-.++.+-          ..++-++..     +.+.+.+++ .  +++| -.|-|-|++.|
T Consensus       140 ~~~~~~~~~Lv~aGvDvlvId~~vvd~----------aH~~~~~~~-----l~~~~~~~~-~--~v~v-IaGNVaT~e~a  200 (368)
T PRK08649        140 QNAQKLGPTVVEAGADLFVIQGTVVSA----------EHVSEGGEP-----LNLKEFIYE-L--DVPV-VVGGCVTYTTA  200 (368)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEEEEEEE----------HHHCCCCHH-----HHHHHHHCC-C--CCCE-EEECCCCHHHH
T ss_conf             638999999997499889984147540----------222032035-----656643123-7--9878-97344699999


Q ss_pred             HHHHHCCCCEEEEC
Q ss_conf             99998399975452
Q gi|254780434|r  303 LDKIMAGANLIQLY  316 (362)
Q Consensus       303 ~e~l~aGAs~VQi~  316 (362)
                      .+.+.+|||+|-++
T Consensus       201 ~~Li~aGADaVKVG  214 (368)
T PRK08649        201 LHLMRTGAAGVLVG  214 (368)
T ss_pred             HHHHHCCCCEEEEC
T ss_conf             99997799899945


No 301
>TIGR00259 TIGR00259 conserved hypothetical protein TIGR00259; InterPro: IPR005137   Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane. It consists of 11 subunits, ~100 chlorophyll a molecules, 2 phylloquinones, and 3 Fe4S4-clusters. The three dimensional structure of the PSI complex has been resolved at 2.5 A , which allows the precise localisation of each cofactor. PSI together with photosystem II (PSII) catalyses the light-induced steps in oxygenic photosynthesis - a process found in cyanobacteria, eukaryotic algae (e.g. red algae, green algae) and higher plants.   To date, three thylakoid proteins involved in the stable accumulation of PSI have been identified: BtpA , Ycf3 , , and Ycf4 (IPR003359 from INTERPRO) . Because translation of the psaA and psaB mRNAs encoding the two reaction centre polypeptides, of PSI and PSII respectively, is not affected in mutant strains lacking functional ycf3 and ycf4, the products of these two genes appear to act at a post-translational step of PSI biosynthesis. These gene products are therefore involved either in the stabilisation or in the assembly of the PSI complex. However, their exact roles remain unknown. The BtpA protein appears to act at the level of PSI stabilisation . It is an extrinsic membrane protein located on the cytoplasmic side of the thylakoid membrane , . Homologs of BtpA are found in the crenarchaeota and euryarchaeota, where their function remains unknown. The Ycf4 protein is firmly associated with the thylakoid membrane, presumably through a transmembrane domain . Ycf4 co-fractionates with a protein complex larger than PSI upon sucrose density gradient centrifugation of solubilised thylakoids . The Ycf3 protein is loosely associated with the thylakoid membrane and can be released from the membrane with sodium carbonate. This suggests that Ycf3 is not part of a stable complex and that it probably interacts transiently with its partners . Ycf3 contains a number of tetratrico peptide repeats (TPR, IPR001440 from INTERPRO); TPR is a structural motif present in a wide range of proteins, which mediates proteinprotein interactions.  .
Probab=94.30  E-value=0.46  Score=26.94  Aligned_cols=224  Identities=17%  Similarity=0.253  Sum_probs=124.0

Q ss_pred             CEEECCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             74853468886779888740367524102001368789988626884255541000024777778899987641000121
Q gi|254780434|r   57 PLGMAAGYDKNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPTSPI  136 (362)
Q Consensus        57 PiglAaG~dk~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~~pi  136 (362)
                      -+|+.+=.||--+..++|.+.|+-+|.+-=.-..|   .++-|+     +...+-+|       ..+..+|++ .-..|+
T Consensus        22 ~lGl~~vid~A~~da~aL~~GG~DAv~~eN~fd~P---F~kq~v-----~~~tvAAM-------a~I~~~l~~-~v~~Pl   85 (261)
T TIGR00259        22 NLGLNAVIDKAVKDAKALEEGGVDAVILENFFDAP---FLKQEV-----DPETVAAM-------AVIAKELKE-DVSIPL   85 (261)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC---CCCCCC-----CHHHHHHH-------HHHHHHHHH-CCCCCC
T ss_conf             55648999999999999985698789985246869---776505-----63443188-------999998875-120464


Q ss_pred             CCEEECCCCCHHHHH--HHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE-
Q ss_conf             000110454246788--77655542067552698303336532211000023432111122444556553126885178-
Q gi|254780434|r  137 GINLGANKDSKDFIL--DYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIF-  213 (362)
Q Consensus       137 ~vsI~~~~~s~~~~~--dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~-  213 (362)
                      ||||-.|    |++.  +.+.+     -.|||+=+|+=.=-     ...|..-++--...+...+..  ..+ .++-+| 
T Consensus        86 GiNvLrN----Da~aa~~iA~~-----v~A~FiRVn~L~G~-----~~sD~G~~eg~a~E~~ry~~~--~~s-G~v~~la  148 (261)
T TIGR00259        86 GINVLRN----DAVAALAIAKA-----VGAKFIRVNVLTGV-----AASDQGIIEGNAGELLRYKKL--LGS-GEVKILA  148 (261)
T ss_pred             CEEEECC----CHHHHHHHHHH-----HCCCEEEEEEEEEE-----EECCCCCEECCHHHHHHHHHC--CCC-CCEEEEE
T ss_conf             1012123----47778988676-----47726898533212-----553674000416543343312--676-6456303


Q ss_pred             ---EECCCCCCHHHHHHHHHH-HHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             ---650577774888999998-7644982999806655532345775446322113564542468999999974089748
Q gi|254780434|r  214 ---LKISPDLSEEELDDIAVE-VLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIA  289 (362)
Q Consensus       214 ---vKLsPd~~~~~i~~ia~~-a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~  289 (362)
                         +|=+-.+...++...+.- ++..-+||++++--+                  .|   .+..++.++.+++.+. +.|
T Consensus       149 dv~vkhA~~lG~~~l~~~~~~Tver~laDAvi~SG~~------------------tG---~~~~~e~Lk~ak~~~~-~~p  206 (261)
T TIGR00259       149 DVVVKHAVHLGNRDLESIVLDTVERGLADAVILSGKT------------------TG---TEVDLEELKLAKETVK-DTP  206 (261)
T ss_pred             CCCHHHCCCCCCCCHHHHHHHHHHHCCCCEEEEECCC------------------CC---CCCCHHHHHHHHHHCC-CCE
T ss_conf             1524521025883668898644541698838981545------------------78---8878888999987517-966


Q ss_pred             EEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCC-------HHHHHHHHHHHHHH
Q ss_conf             9996788999999999983999754527877069-------78999999999999
Q gi|254780434|r  290 IIGTGGISSTKDALDKIMAGANLIQLYSAMIYEG-------ISLPKRIIQGLSDF  337 (362)
Q Consensus       290 IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~G-------p~~~~~I~~~L~~~  337 (362)
                      ++..-|+..  |=.+.+..=||=|=++|.+=.+|       +.=+++|.+.+.+-
T Consensus       207 Vl~gsG~~~--~N~~~ll~~AdG~ivat~~Kk~G~~nn~vD~~Rv~~~~~~~a~~  259 (261)
T TIGR00259       207 VLAGSGVNL--ENVEELLSIADGVIVATTIKKDGKINNLVDQERVSKFVEKVAEG  259 (261)
T ss_pred             EEEECCCCH--HHHHHHHHHHCCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             998478798--89999998739879835653388420042189999999999852


No 302
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain.  FCB2 (AKA L-lactate:cytochrome c oxidoreductase) is a respiratory enzyme located in the intermembrane space of fungal mitochondria which catalyzes the oxidation of L-lactate to pyruvate. FCB2 also participates in a short electron-transport chain involving cytochrome c and cytochrome oxidase which ultimately directs the reducing equivalents gained from L-lactate oxidation to oxygen, yielding one molecule of ATP for every L-lactate molecule consumed. FCB2  is composed of 2 domains: a C-terminal flavin-binding domain, which includes the active site for lacate oxidation, and an N-terminal b2-cytochrome domain, required for efficient cytochrome c reduction. FCB2 is a homotetramer and contains two noncovalently bound cofactors, FMN and heme per subunit.
Probab=94.26  E-value=0.47  Score=26.87  Aligned_cols=103  Identities=16%  Similarity=0.203  Sum_probs=62.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEC-C-C-CCCC-----CCCCCCCCC-------CCC-CC----CCCCCC
Q ss_conf             1786505777748889999987644982999806-6-5-5532-----345775446-------322-11----356454
Q gi|254780434|r  211 PIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSN-T-T-LSRK-----GVQCSDNHE-------QDG-GL----SGSPLF  270 (362)
Q Consensus       211 Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~N-T-~-~~~~-----~~~~~~~~~-------~~G-Gl----SG~~i~  270 (362)
                      |.|.-|=+.-+.+...++++.++++|+.+++++= + + ..|.     +...+....       ..+ +.    ++..-.
T Consensus       119 ~~wfQLY~~~dr~~~~~li~RA~~aG~~alvlTvD~p~~G~R~rd~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  198 (344)
T cd02922         119 PLFFQLYVNKDRTKTEELLKRAEKLGAKAIFLTVDAPVLGKRERDERLKAEEAVSDGPAGKKTKAKGGGAGRAMSGFIDP  198 (344)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCC
T ss_conf             66999824776799999999999869988999567888775226665077778876654333344663166777750488


Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             2468999999974089748999678899999999998399975452
Q gi|254780434|r  271 LKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLY  316 (362)
Q Consensus       271 ~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~  316 (362)
                      ..+-+-|+++|+.++  .|+| +=||.+++||.....+|||.|.|.
T Consensus       199 ~~tw~di~~lr~~~~--~pli-vKGIl~~~DA~~A~~~G~dgIiVS  241 (344)
T cd02922         199 TLTWDDIKWLRKHTK--LPIV-LKGVQTVEDAVLAAEYGVDGIVLS  241 (344)
T ss_pred             CCCHHHHHHHHHHCC--CCEE-ECCCCCHHHHHHHHHCCCCEEEEE
T ss_conf             899999999998669--9701-002577999999996599889971


No 303
>KOG4201 consensus
Probab=94.22  E-value=0.24  Score=28.90  Aligned_cols=52  Identities=12%  Similarity=0.197  Sum_probs=42.4

Q ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCC-CHH
Q ss_conf             8999999974089748999678899999999998399975452787706-978
Q gi|254780434|r  274 TIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYE-GIS  325 (362)
Q Consensus       274 l~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~-Gp~  325 (362)
                      +..-+.+-+-.++++-++|--||+|++|+..+-.+|-++|-++-++|-+ +|.
T Consensus       224 lstTskL~E~i~kDvilva~SGi~tpdDia~~q~~GV~avLVGEslmk~sDp~  276 (289)
T KOG4201         224 LSTTSKLLEGIPKDVILVALSGIFTPDDIAKYQKAGVKAVLVGESLMKQSDPK  276 (289)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCEEEEECHHHHHCCCHH
T ss_conf             02578898508632698741578887889999874861898527777245888


No 304
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate. This reaction is part of the pathway that allows the usage of sialic acid as a carbohydrate source. Sialic acids are a family of related sugars that are found as a component of glycoproteins, gangliosides, and other sialoglycoconjugates.
Probab=93.71  E-value=0.54  Score=26.50  Aligned_cols=120  Identities=18%  Similarity=0.215  Sum_probs=64.6

Q ss_pred             CCCCCEEE--EECC-CC----CCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             26885178--6505-77----77488899999876449829998066555323457754463221135645424689999
Q gi|254780434|r  206 TGKFVPIF--LKIS-PD----LSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALA  278 (362)
Q Consensus       206 ~~~~~Pi~--vKLs-Pd----~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~  278 (362)
                      ...++||+  +|-. ||    +| +-+.+ ++.+.++|+|=|.+--|...|++           |.|       -.+.+.
T Consensus        57 ~~v~lPIIGi~K~~~~~s~VyIT-Pt~~e-v~~l~~aGadiIA~DaT~R~RP~-----------g~~-------l~~~i~  116 (219)
T cd04729          57 ARVDLPIIGLIKRDYPDSEVYIT-PTIEE-VDALAAAGADIIALDATDRPRPD-----------GET-------LAELIK  116 (219)
T ss_pred             HCCCCCEEEEEECCCCCCCEEEC-CCHHH-HHHHHHCCCCEEEEECCCCCCCC-----------CCC-------HHHHHH
T ss_conf             32899889999568899984566-88999-99999859999999467887989-----------978-------999999


Q ss_pred             HHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEE----CHHH--HCCCH--HHHHHHHHHHHHHHH-HCCCCCHHHH
Q ss_conf             9997408974899967889999999999839997545----2787--70697--899999999999999-8389977896
Q gi|254780434|r  279 KIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQL----YSAM--IYEGI--SLPKRIIQGLSDFLN-KENEVNFENI  349 (362)
Q Consensus       279 ~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi----~Tal--i~~Gp--~~~~~I~~~L~~~l~-~~G~~si~e~  349 (362)
                      ++++.+  +..  -+.-|+|.+|+..-..+|+|.|.-    ||..  .-.+|  .+++++.+.+.-..- +=+|.+-+++
T Consensus       117 ~i~~~~--~~l--~MAD~st~ee~~~A~~~G~D~vgTTL~GYT~~t~~~~~PD~~lv~~l~~~~~~pvIaEGri~tPe~a  192 (219)
T cd04729         117 RIHEEY--NCL--LMADISTLEEALNAAKLGFDIIGTTLSGYTEETAKTEDPDFELLKELRKALGIPVIAEGRINSPEQA  192 (219)
T ss_pred             HHHHHH--CCE--EEEECCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCCCCHHHH
T ss_conf             999986--977--8875488999999998499899702145677878899987899999999759939970698999999


No 305
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase; InterPro: IPR006268   These sequences are one of at least three types of phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase). This enzyme catalyzes the first of 7 steps in the biosynthesis of chorismate, that last common precursor of all three aromatic amino acids and of PABA, ubiquinone and menaquinone. Some members of this family, including an experimentally characterised member from Bacillus subtilis, are bifunctional, with a chorismate mutase domain N-terminal to this region. The member of this family from Synechocystis PCC 6803, CcmA, was shown to be essential for carboxysome formation. However, no other candidate for this enzyme is present in that species, chorismate biosynthesis does occur, other species having this protein lack carboxysomes but appear to make chorismate, and a requirement of CcmA for carboxysome formation does not prohibit a role in chorismate biosynthesis.; GO: 0016832 aldehyde-lyase activity, 0009073 aromatic amino acid family biosynthetic process.
Probab=93.69  E-value=0.6  Score=26.17  Aligned_cols=229  Identities=18%  Similarity=0.224  Sum_probs=126.0

Q ss_pred             CCEEEECCEECCCC-EEECCCCC--CCHHHHHHHHHC--CCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCC
Q ss_conf             31168887335997-48534688--867798887403--67524102001368789988626884255541000024777
Q gi|254780434|r   44 RLNTKVAGISLSNP-LGMAAGYD--KNAEVPIELLKL--GFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNA  118 (362)
Q Consensus        44 ~L~~~~~Gl~~~nP-iglAaG~d--k~~~~~~~l~~~--G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~  118 (362)
                      +--+++.|+++=+= +.+.|||.  -|.|++......  ..|+-..=.=-.+||+ +|                +.|+--
T Consensus        11 ~tv~~v~~v~IG~G~~~~iAGPCsvEs~eq~~~~A~~vk~~Ga~~LRGGAfKPRT-SP----------------YsFQGl   73 (262)
T TIGR01361        11 KTVVDVKGVKIGEGSPIVIAGPCSVESEEQIVETARFVKEAGAKILRGGAFKPRT-SP----------------YSFQGL   73 (262)
T ss_pred             CCEEECCCEEECCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEECCCCCCCC-CC----------------CCCCCC
T ss_conf             6157718577538478998648774887999999999986674043066348888-88----------------412474


Q ss_pred             CHHHHHHHHHHHH--HCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             7788999876410--00121000110454246788776555420675526983033365322110000234321111224
Q gi|254780434|r  119 GYHTVFSRLSKIQ--PTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVM  196 (362)
Q Consensus       119 G~~~~~~~l~~~~--~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~  196 (362)
                      |.+- ++-+++.+  .+.+++--|+-.       .|    ++.+.+|+|.|=|        |=|.+|+=.-|++    + 
T Consensus        74 g~~g-l~~l~~A~~~~GL~~vTEvmd~-------~d----~e~~~~y~D~lQi--------GARNmQNF~LL~~----v-  128 (262)
T TIGR01361        74 GEEG-LKLLRRAADETGLPVVTEVMDP-------RD----VEIVAEYADILQI--------GARNMQNFELLKE----V-  128 (262)
T ss_pred             HHHH-HHHHHHHHHHCCCEEEEEEECH-------HH----HHHHHHHHHHHHH--------CCCCCCCHHHHHH----H-
T ss_conf             1899-9999999986099489886362-------56----7778765113422--------2541225699999----7-


Q ss_pred             HHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCC-CCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             4455655312688517865057777488899999876449-829998066555323457754463221135645424689
Q gi|254780434|r  197 QTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHK-VEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTI  275 (362)
Q Consensus       197 ~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g-~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~  275 (362)
                               ...++||++|=++--|-+|...-|+-....| -..|++|-.     ++.+-...+-+         -.-+.
T Consensus       129 ---------G~~~KPVLLKRG~~aTi~EwL~AAEYIl~~GsN~~ViLCER-----GIRTfE~~TR~---------TLD~s  185 (262)
T TIGR01361       129 ---------GKQGKPVLLKRGMGATIEEWLEAAEYILSEGSNGNVILCER-----GIRTFEKSTRN---------TLDLS  185 (262)
T ss_pred             ---------HHCCCCEEEECCCCHHHHHHHHHHHHHHHCCCCCCEEEEEC-----CCCCCCCHHHH---------HHHHH
T ss_conf             ---------22379755307721589999999999984688995489975-----85676300245---------33378


Q ss_pred             HHHHHHHHCCCCEEEEE----ECCCCCHHH--HHHHHHCCCCEEEE------CHHHHCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             99999974089748999----678899999--99999839997545------27877069789999999999999983
Q gi|254780434|r  276 ALAKIRQRVGPKIAIIG----TGGISSTKD--ALDKIMAGANLIQL------YSAMIYEGISLPKRIIQGLSDFLNKE  341 (362)
Q Consensus       276 ~i~~i~~~~~~~i~IIg----~GGI~s~~D--a~e~l~aGAs~VQi------~Tali~~Gp~~~~~I~~~L~~~l~~~  341 (362)
                      .|..+++.+  ++|||-    ..|-.+-=-  |..-+.+|||.+.|      -.|| -.|++-+.-. +++..+|++.
T Consensus       186 aV~~~K~~t--HLPi~VDPSH~~GrRdLV~plA~AA~A~GADgl~iEVHp~Pe~AL-SD~~Qql~~c-~~f~~~~~~~  259 (262)
T TIGR01361       186 AVPLLKKET--HLPIIVDPSHAAGRRDLVLPLAKAAIAAGADGLMIEVHPDPEKAL-SDSKQQLTPC-EEFKRLVKEL  259 (262)
T ss_pred             HHHHHHHCC--CCCEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHC-CCCCCCCCHH-HHHHHHHHHH
T ss_conf             999998605--898787187987624578899999897574736898667833320-7871144667-8899999985


No 306
>cd04725 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway. In mammals, UMP synthase contains two domains:  the orotate phosphoribosyltransferase (OPRTase) domain that catalyzes the transfer of phosphoribosyl 5'-pyrophosphate (PRPP) to orotate to form OMP, and the orotidine-5'-phosphate decarboxylase (ODCase) domain that decarboxylates OMP to form UMP.
Probab=93.49  E-value=0.65  Score=25.95  Aligned_cols=146  Identities=19%  Similarity=0.213  Sum_probs=77.5

Q ss_pred             HHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             89998764100012100011045424678877655542067552698303336532211000023432111122444556
Q gi|254780434|r  122 TVFSRLSKIQPTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREE  201 (362)
Q Consensus       122 ~~~~~l~~~~~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~  201 (362)
                      .+.+.|++.  +.+++.-. +..+.+...+.+++.+.+.  .+|+++++-++.          .+.+...+++..     
T Consensus        40 ~~i~~l~~~--~~~iflDl-K~~DI~nTv~~~~~~~~~~--~~d~~Tvh~~~G----------~~~l~~~~~~~~-----   99 (216)
T cd04725          40 EIVKELREL--GFLVFLDL-KLGDIPNTVAAAAEALLGL--GADAVTVHPYGG----------SDMLKAALEAAE-----   99 (216)
T ss_pred             HHHHHHHHC--CCEEEEEH-HHCCHHHHHHHHHHHHHHC--CCCEEEEECCCC----------HHHHHHHHHHHH-----
T ss_conf             999999867--97786303-5378058999999999845--988999846787----------999999999864-----


Q ss_pred             HHHHCCCCCEEEEECCC-CC----------CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             55312688517865057-77----------74888999998764498299980665553234577544632211356454
Q gi|254780434|r  202 EKIKTGKFVPIFLKISP-DL----------SEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLF  270 (362)
Q Consensus       202 ~~~~~~~~~Pi~vKLsP-d~----------~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~  270 (362)
                         +..+.+=..+.||. +.          ..+....+++.+.+.|++|+++..+-                        
T Consensus       100 ---~~~~~vl~V~~lts~~~~~l~~~~~~~~~~~~~~~~~~a~~~g~~G~V~~~~~------------------------  152 (216)
T cd04725         100 ---EKGKGLFAVTVLSSPGALDLQEGIPGSLEDLVERLAKLAREAGVDGVVCGATE------------------------  152 (216)
T ss_pred             ---CCCCEEEEEEEECCCCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCEEEECCCH------------------------
T ss_conf             ---35980699997168887899988537789999999999986189779988624------------------------


Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCCCC---------HHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             2468999999974089748999678899---------99999999839997545278770
Q gi|254780434|r  271 LKSTIALAKIRQRVGPKIAIIGTGGISS---------TKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       271 ~~al~~i~~i~~~~~~~i~IIg~GGI~s---------~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                            ...+++...+++.++ +-||.-         +.+..+.+.+|||.+=|+.+...
T Consensus       153 ------~~~i~~~~~~~~~il-tPGI~~~~~~~dq~r~~tp~~a~~~gad~ivVGR~I~~  205 (216)
T cd04725         153 ------PEALRRALGPDFLIL-TPGIGAQGSGDDQKRGGTPEDAIRAGADYIVVGRPITQ  205 (216)
T ss_pred             ------HHHHHHHCCCCCEEE-CCCCCCCCCCCCCCCCCCHHHHHHCCCCEEEECCCCCC
T ss_conf             ------899998508861797-35605777766882668999999879999998910148


No 307
>PRK11572 copper homeostasis protein CutC; Provisional
Probab=93.40  E-value=0.67  Score=25.86  Aligned_cols=44  Identities=11%  Similarity=0.163  Sum_probs=32.9

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             2468999999974089748999678899999999998399975452
Q gi|254780434|r  271 LKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLY  316 (362)
Q Consensus       271 ~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~  316 (362)
                      ...+..++++.+..++.+ |++.|||. .+.+.+++..|.+.+...
T Consensus       155 ~~G~~~L~~L~~~a~~~i-Im~GgGV~-~~Ni~~~~~tG~~eiH~S  198 (248)
T PRK11572        155 EQGLSLIMELIAQGDAPI-IMAGAGVR-AENLQKFLDAGVREVHSS  198 (248)
T ss_pred             HHHHHHHHHHHHHCCCCE-EEECCCCC-HHHHHHHHHCCCCEEEEC
T ss_conf             788999999998449968-98789989-999999997597789735


No 308
>KOG4175 consensus
Probab=93.35  E-value=0.68  Score=25.81  Aligned_cols=209  Identities=19%  Similarity=0.285  Sum_probs=111.2

Q ss_pred             ECCC-CC--CCHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHC---
Q ss_conf             5346-88--86779888740367524102001368789988626884255541000024777778899987641000---
Q gi|254780434|r   60 MAAG-YD--KNAEVPIELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFNNAGYHTVFSRLSKIQPT---  133 (362)
Q Consensus        60 lAaG-~d--k~~~~~~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~N~G~~~~~~~l~~~~~~---  133 (362)
                      +-|| +|  ..+..++-+.+.|.+-+|.|-=-..|-.  -.|.+. .....++.|-.     -...+++.++..++.   
T Consensus        24 iTaG~P~v~~T~kilkglq~gG~dIIELGvPfSDp~A--DGPtIq-~~n~~aL~ng~-----tl~~i~emvk~ar~~gvt   95 (268)
T KOG4175          24 ITAGDPDVSTTAKILKGLQSGGSDIIELGVPFSDPLA--DGPTIQ-AANRRALLNGT-----TLNSIIEMVKEARPQGVT   95 (268)
T ss_pred             EECCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCCC--CCCHHH-HHHHHHHHCCC-----CHHHHHHHHHHHCCCCCC
T ss_conf             7248996788999998875279674886685676456--773455-66789987289-----689999999985046863


Q ss_pred             CCCCCEEECCCCCHHHHHHHHHHHHHHCCCCC-EEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             12100011045424678877655542067552-69830333653221100002343211112244455655312688517
Q gi|254780434|r  134 SPIGINLGANKDSKDFILDYVSGIRLFFTIAS-YFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPI  212 (362)
Q Consensus       134 ~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD-~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi  212 (362)
                      .|++.-=-+|.--.-..+.|.+.++.++  |. ++.+.+  |          +|.       ....|...+...   +-+
T Consensus        96 ~PIiLmgYYNPIl~yG~e~~iq~ak~aG--anGfiivDl--P----------pEE-------a~~~Rne~~k~g---isl  151 (268)
T KOG4175          96 CPIILMGYYNPILRYGVENYIQVAKNAG--ANGFIIVDL--P----------PEE-------AETLRNEARKHG---ISL  151 (268)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHHHHCC--CCCEEECCC--C----------HHH-------HHHHHHHHHHCC---CEE
T ss_conf             0266220144887640789999999658--774585068--8----------689-------899999998649---248


Q ss_pred             EEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             86505777748889999987644982999806655532345775446322113564542468999999974089748999
Q gi|254780434|r  213 FLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIG  292 (362)
Q Consensus       213 ~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg  292 (362)
                      ..-.+|-.+++.++.+++++     |+++-.   .+|.+...         .+ ..+-..-..++.++|+..+ +-|+ +
T Consensus       152 vpLvaPsTtdeRmell~~~a-----dsFiYv---VSrmG~TG---------~~-~svn~~l~~L~qrvrk~t~-dtPl-A  211 (268)
T KOG4175         152 VPLVAPSTTDERMELLVEAA-----DSFIYV---VSRMGVTG---------TR-ESVNEKLQSLLQRVRKATG-DTPL-A  211 (268)
T ss_pred             EEEECCCCHHHHHHHHHHHH-----CCEEEE---EEECCCCC---------CH-HHHHHHHHHHHHHHHHHCC-CCCE-E
T ss_conf             97417998089999999863-----255999---87145666---------17-7788889999999998648-9862-6


Q ss_pred             EC-CCCCHHHHHHHHHCCCCEEEECHHHHC
Q ss_conf             67-889999999999839997545278770
Q gi|254780434|r  293 TG-GISSTKDALDKIMAGANLIQLYSAMIY  321 (362)
Q Consensus       293 ~G-GI~s~~Da~e~l~aGAs~VQi~Tali~  321 (362)
                      +| ||++.++....=.. ||-|-++|.++-
T Consensus       212 VGFGvst~EHf~qVgsv-aDGVvvGSkiv~  240 (268)
T KOG4175         212 VGFGVSTPEHFKQVGSV-ADGVVVGSKIVK  240 (268)
T ss_pred             EEECCCCHHHHHHHHHH-CCCEEECHHHHH
T ss_conf             75066878998765203-254476078999


No 309
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional
Probab=93.23  E-value=0.45  Score=27.04  Aligned_cols=24  Identities=13%  Similarity=0.329  Sum_probs=11.9

Q ss_pred             HHHHHHCC-CCEEECCCCCCCCCCC
Q ss_conf             88874036-7524102001368789
Q gi|254780434|r   71 PIELLKLG-FGFVEIGTVTPHPQAG   94 (362)
Q Consensus        71 ~~~l~~~G-~G~v~~ktit~~p~~G   94 (362)
                      +|.+..+| +|.-++-.+|-+--.|
T Consensus       252 lKt~sA~G~Yg~s~iTAlTAQNT~G  276 (738)
T PRK09517        252 LKSIAAAGGYGMSVVTALVAQNTHG  276 (738)
T ss_pred             HHHHHHCCCHHHHHHHEEEEECCCC
T ss_conf             9999962711312450256213656


No 310
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional
Probab=93.17  E-value=0.32  Score=28.07  Aligned_cols=204  Identities=19%  Similarity=0.167  Sum_probs=99.1

Q ss_pred             CCEEEECCEECC-CCEEECCCCC-C-CHHHH----HHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCEEECCCC
Q ss_conf             311688873359-9748534688-8-67798----887403675241020013687899886268842555410000247
Q gi|254780434|r   44 RLNTKVAGISLS-NPLGMAAGYD-K-NAEVP----IELLKLGFGFVEIGTVTPHPQAGNPRPRVFRLTKDRAIINKLGFN  116 (362)
Q Consensus        44 ~L~~~~~Gl~~~-nPiglAaG~d-k-~~~~~----~~l~~~G~G~v~~ktit~~p~~GNp~PR~~r~~~~~~iiN~~Gl~  116 (362)
                      +--+++.|+++- +++.+=||+. - +-+.+    +.+.+.|.-..--+.  .+||.               -.+  +|.
T Consensus        13 ~~~i~i~~i~iG~~~~~~IAGPC~iEs~e~~~~~A~~lk~~g~~~~r~~~--fK~RT---------------s~~--sfr   73 (266)
T PRK13398         13 KTIVKIGDVVIGGEEKIIIAGPCAVESEEQMVKVAEKLKELGVHMLRGGA--FKPRT---------------SPY--SFQ   73 (266)
T ss_pred             CCEEEECCEEECCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCE--ECCCC---------------CCC--CCC
T ss_conf             88799799998899548997577207999999999999983334333754--15899---------------985--556


Q ss_pred             CCCHHHHHHHHHHHH--HCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEE-CCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             777788999876410--001210001104542467887765554206755269830-33365322110000234321111
Q gi|254780434|r  117 NAGYHTVFSRLSKIQ--PTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTIN-ISSPNTPGLRSLQKKKNLERLLI  193 (362)
Q Consensus       117 N~G~~~~~~~l~~~~--~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiN-iSCPNt~g~~~~~~~~~l~~~l~  193 (362)
                      -+|.+ -++-|++.+  .+.|+.--|.-.    +.       ++.+.+++|.+-|- ..|-||             +++.
T Consensus        74 G~G~e-gL~~L~~vk~~~glpi~TdVh~~----~q-------~~~v~~~vDvlQIpAfl~rqt-------------dLl~  128 (266)
T PRK13398         74 GLGEE-GLKILKEVGDKYNMPVVTEVMDT----RD-------VEEVADYIDMLQIGSRNMQNF-------------ELLK  128 (266)
T ss_pred             CCCHH-HHHHHHHHHHHCCCCEEEEECCH----HH-------HHHHHHHHHHEEECCHHCCCH-------------HHHH
T ss_conf             88588-99999999987299547774583----76-------999997510112250422798-------------9999


Q ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             22444556553126885178650577774888999998764498299980665553234577544632211356454246
Q gi|254780434|r  194 HVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKS  273 (362)
Q Consensus       194 ~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~a  273 (362)
                      ++          ..+.+||.+|=+-..+.++....++.+...|.+-+.+|-.     +...      +-|++ +-  ..-
T Consensus       129 a~----------a~t~kpV~iKkg~~~s~~~~~~a~eki~~~Gn~~v~l~ER-----G~~t------~~gy~-~~--v~D  184 (266)
T PRK13398        129 EV----------GKTKKPILLKRGMSATIEEWLYAAEYIMSEGNENVVLCER-----GIRT------FETYT-RN--TLD  184 (266)
T ss_pred             HH----------HHHCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCEEEEEC-----CCCC------CCCCC-CC--CHH
T ss_conf             99----------9709966734876688899999999998479983899842-----5245------77744-35--213


Q ss_pred             HHHHHHHHHHCCCCEEEEE----ECCCCCHHH--HHHHHHCCCCEEEECH
Q ss_conf             8999999974089748999----678899999--9999983999754527
Q gi|254780434|r  274 TIALAKIRQRVGPKIAIIG----TGGISSTKD--ALDKIMAGANLIQLYS  317 (362)
Q Consensus       274 l~~i~~i~~~~~~~i~IIg----~GGI~s~~D--a~e~l~aGAs~VQi~T  317 (362)
                      .+.+..+++..  ++|||-    +.|-.+.--  +..-+.+|||-+.+=|
T Consensus       185 ~~~i~~mk~~~--~lPVi~D~SHs~G~r~~v~~la~aAva~G~dGlfiE~  232 (266)
T PRK13398        185 LAAVAVIKELS--HLPIIVDPSHATGRRELVIPMAKAAIAAGADGLMIEV  232 (266)
T ss_pred             HHHHHHHHHCC--CCCEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             67799998577--9998988853356799999999999983998899982


No 311
>COG0646 MetH Methionine synthase I (cobalamin-dependent), methyltransferase domain [Amino acid transport and metabolism]
Probab=92.83  E-value=0.81  Score=25.30  Aligned_cols=155  Identities=17%  Similarity=0.242  Sum_probs=78.0

Q ss_pred             HCCCCCEEEEE-CCCCCCCCCCCCCCHHHHHHHH-HHHHHHHHHHHHHCCCCCEEEEE-----------CCC--CCCHHH
Q ss_conf             06755269830-3336532211000023432111-12244455655312688517865-----------057--777488
Q gi|254780434|r  160 FFTIASYFTIN-ISSPNTPGLRSLQKKKNLERLL-IHVMQTREEEKIKTGKFVPIFLK-----------ISP--DLSEEE  224 (362)
Q Consensus       160 ~~~~aD~iEiN-iSCPNt~g~~~~~~~~~l~~~l-~~v~~~~~~~~~~~~~~~Pi~vK-----------LsP--d~~~~~  224 (362)
                      +..+||.+|-| ++| |+..+.+.+-.+...++- .+++-+|..... ...++|.||-           ++|  +.+.++
T Consensus        63 ~eAGADiIeTNTFga-t~i~lady~led~v~~in~~aa~iAR~aA~~-~~~~k~rfVaGsiGPt~k~~~~~~~~~v~fd~  140 (311)
T COG0646          63 IEAGADIIETNTFGA-TTIKLADYGLEDKVYEINQKAARIARRAADE-AGDPKPRFVAGSIGPTNKTLSISPDFAVTFDE  140 (311)
T ss_pred             HHCCCCEEEECCCCC-CHHHHHHHCHHHHHHHHHHHHHHHHHHHHHH-CCCCCCEEEEEECCCCCCCCCCCCCCCCCHHH
T ss_conf             964676787347786-5365755073889999999999999999864-47887538987326867767768766635999


Q ss_pred             H----HHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCC--
Q ss_conf             8----9999987644982999806655532345775446322113564542468999999974089748999678899--
Q gi|254780434|r  225 L----DDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISS--  298 (362)
Q Consensus       225 i----~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s--  298 (362)
                      +    .+-++.+.+.|+|++.+ -|.-|..     .             ...++..++++.+..+.++|+|.+|-|.+  
T Consensus       141 l~~ay~eq~~~Li~gG~D~iLi-ET~~D~l-----~-------------~KaA~~a~~~~~~~~~~~LPv~~s~Ti~~sG  201 (311)
T COG0646         141 LVEAYREQVEGLIDGGADLILI-ETIFDTL-----N-------------AKAAVFAAREVFEELGVRLPVMISGTITDSG  201 (311)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEE-EHHCCHH-----H-------------HHHHHHHHHHHHHHCCCCCCEEEEEEEECCC
T ss_conf             9999999999998378758997-5221689-----8-------------9999999999987327765479999980376


Q ss_pred             -------HHHHHHHHH-CCCCEEEECHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             -------999999998-3999754527877069789999999999999
Q gi|254780434|r  299 -------TKDALDKIM-AGANLIQLYSAMIYEGISLPKRIIQGLSDFL  338 (362)
Q Consensus       299 -------~~Da~e~l~-aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l  338 (362)
                             .++++.-+. +|+++|.+--++   ||...+...++|++.-
T Consensus       202 ~tl~Gq~~~a~~~~l~~~~~~~vGlNCa~---Gp~~m~~~l~~ls~~~  246 (311)
T COG0646         202 RTLSGQTIEAFLNSLEHLGPDAVGLNCAL---GPDEMRPHLRELSRIA  246 (311)
T ss_pred             EECCCCCHHHHHHHHHCCCCCEEEECCCC---CHHHHHHHHHHHHHCC
T ss_conf             12379868999998663597478534566---8899999999987416


No 312
>TIGR01464 hemE uroporphyrinogen decarboxylase; InterPro: IPR006361   This entry represents uroporphyrinogen decarboxylase (HemE), which catalyzes the fifth step in the heme biosynthetic pathway, converting uroporphyrinogen III to coproporphyrinogen III by decarboxylating the four acetate side chains of the substrate . This step takes the pathway toward protoporphyrin IX, a common precursor of both heme and chlorophyll, rather than toward precorrin 2 and its products.   This activity is essential in all organisms, and subnormal activity of URO-D leads to the most common form of porphyria in humans, porphyria cutanea tarda (PCT).; GO: 0004853 uroporphyrinogen decarboxylase activity, 0006779 porphyrin biosynthetic process.
Probab=92.80  E-value=0.82  Score=25.27  Aligned_cols=19  Identities=21%  Similarity=0.188  Sum_probs=9.2

Q ss_pred             HHHHHHHHHHHHCCCCCEEEE
Q ss_conf             788776555420675526983
Q gi|254780434|r  149 FILDYVSGIRLFFTIASYFTI  169 (362)
Q Consensus       149 ~~~dy~~~~~~~~~~aD~iEi  169 (362)
                      .+.||+.  .++..+||++=|
T Consensus       182 ~~~~YL~--~Qv~AGA~avQi  200 (351)
T TIGR01464       182 ATIEYLS--EQVKAGAQAVQI  200 (351)
T ss_pred             HHHHHHH--HHHHCCCCEEEE
T ss_conf             9999999--988618848999


No 313
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism]
Probab=92.63  E-value=0.59  Score=26.23  Aligned_cols=175  Identities=10%  Similarity=0.138  Sum_probs=84.7

Q ss_pred             HHHHHHHHHHCCCCCCEEECCCCCHH------HHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             99987641000121000110454246------788776555420675526983033365322110000234321111224
Q gi|254780434|r  123 VFSRLSKIQPTSPIGINLGANKDSKD------FILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVM  196 (362)
Q Consensus       123 ~~~~l~~~~~~~pi~vsI~~~~~s~~------~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~  196 (362)
                      +.+.|+.......+|+-+=+.++|+.      ...+|+..+++.+  |+++-+            +.++..+.--++.+.
T Consensus        35 f~~AL~~~~~~~~vIAEvKkaSPS~G~ir~d~dp~~ia~~Ye~~G--Aa~iSV------------LTd~~~F~Gs~e~L~  100 (254)
T COG0134          35 FYAALKEASGKPAVIAEVKKASPSKGLIREDFDPVEIAKAYEEGG--AAAISV------------LTDPKYFQGSFEDLR  100 (254)
T ss_pred             HHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHC--CEEEEE------------ECCCCCCCCCHHHHH
T ss_conf             999997437886089986157998775555599999999999739--848999------------637664698789999


Q ss_pred             HHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             44556553126885178650577774888999998764498299980665553234577544632211356454246899
Q gi|254780434|r  197 QTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIA  276 (362)
Q Consensus       197 ~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~  276 (362)
                      .      .+....+||+.|=- -++..|+    ..+..+|+|+|-++=..                      +-+.-+.-
T Consensus       101 ~------v~~~v~~PvL~KDF-iiD~yQI----~~Ar~~GADavLLI~~~----------------------L~~~~l~e  147 (254)
T COG0134         101 A------VRAAVDLPVLRKDF-IIDPYQI----YEARAAGADAVLLIVAA----------------------LDDEQLEE  147 (254)
T ss_pred             H------HHHHCCCCEEECCC-CCCHHHH----HHHHHCCCCCHHHHHHH----------------------CCHHHHHH
T ss_conf             9------99855898264467-7889999----99998085619999996----------------------39999999


Q ss_pred             HHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHH-------CCCCCHHHH
Q ss_conf             9999974089748999678899999999998399975452787706978999999999999998-------389977896
Q gi|254780434|r  277 LAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNK-------ENEVNFENI  349 (362)
Q Consensus       277 i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~-------~G~~si~e~  349 (362)
                      +......++-+. ++   =|++.++....+.+||+.+.|-.-- ++...+=-.....|...+..       -|+++.+|+
T Consensus       148 l~~~A~~LGm~~-LV---EVh~~eEl~rAl~~ga~iIGINnRd-L~tf~vdl~~t~~la~~~p~~~~~IsESGI~~~~dv  222 (254)
T COG0134         148 LVDRAHELGMEV-LV---EVHNEEELERALKLGAKIIGINNRD-LTTLEVDLETTEKLAPLIPKDVILISESGISTPEDV  222 (254)
T ss_pred             HHHHHHHCCCCE-EE---EECCHHHHHHHHHCCCCEEEEECCC-CCHHEECHHHHHHHHHHCCCCCEEEECCCCCCHHHH
T ss_conf             999999769923-89---9789999999996799889983788-402100688999988448777589961798999999


No 314
>TIGR00343 TIGR00343 pyridoxine biosynthesis protein; InterPro: IPR001852   Snz1p is a highly conserved protein involved in growth arrest in S. cerevisiae . Sor1 (singlet oxygen resistance) is essential in pyridoxine (vitamin B6) synthesis in C. nicotianae and Aspergillus flavus. Pyridoxine quenches singlet oxygen at a rate comparable to that of vitamins C and E, two of the most highly efficient biological antioxidants, suggesting a previously unknown role for pyridoxine in active oxygen resistance. ..
Probab=92.21  E-value=0.89  Score=25.04  Aligned_cols=76  Identities=13%  Similarity=0.221  Sum_probs=52.9

Q ss_pred             HHHHHHHHHHHCCCCEEE--EEECCCCCHHHHHHHHHCCCCEEEECHHHHCC------------------CHHHHHHHHH
Q ss_conf             689999999740897489--99678899999999998399975452787706------------------9789999999
Q gi|254780434|r  273 STIALAKIRQRVGPKIAI--IGTGGISSTKDALDKIMAGANLIQLYSAMIYE------------------GISLPKRIIQ  332 (362)
Q Consensus       273 al~~i~~i~~~~~~~i~I--Ig~GGI~s~~Da~e~l~aGAs~VQi~Tali~~------------------Gp~~~~~I~~  332 (362)
                      ...++.++.+.  +++|+  .+.|||.++.|+.-++-.||+-|-++|+..-.                  .|.++.++-+
T Consensus       191 ~~~~~~~~~~~--G~lPvvnfaaGGvatPadaal~mqlG~~GvfvGsGifks~~P~~~a~aiv~a~~~y~~~~~~~~~s~  268 (298)
T TIGR00343       191 PVELLKEVKKE--GKLPVVNFAAGGVATPADAALLMQLGADGVFVGSGIFKSSNPEKLAKAIVEATTHYDNPEVLAEVSK  268 (298)
T ss_pred             HHHHHHHHHHC--CCCCEEEECCCCCCCHHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999863--8974464135764655789999984778247534200056778999999999972001789999999


Q ss_pred             HHHHHHHHCCCCCHHHHH
Q ss_conf             999999983899778961
Q gi|254780434|r  333 GLSDFLNKENEVNFENIR  350 (362)
Q Consensus       333 ~L~~~l~~~G~~si~e~i  350 (362)
                      +|.+.|.--...++.+..
T Consensus       269 ~lG~~m~G~~~~~~~~~~  286 (298)
T TIGR00343       269 DLGEAMKGIEISEISEEE  286 (298)
T ss_pred             HHHHHHHCCCHHHHHHHH
T ss_conf             888886043177776766


No 315
>PRK04302 triosephosphate isomerase; Provisional
Probab=92.11  E-value=0.99  Score=24.71  Aligned_cols=109  Identities=16%  Similarity=0.210  Sum_probs=61.9

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCC---CC------CCCCCCCCCCCCCC-CCCHHHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             8899999876449829998066555323---45------77544632211356-45424689999999740897489996
Q gi|254780434|r  224 ELDDIAVEVLSHKVEGIIVSNTTLSRKG---VQ------CSDNHEQDGGLSGS-PLFLKSTIALAKIRQRVGPKIAIIGT  293 (362)
Q Consensus       224 ~i~~ia~~a~~~g~dGiv~~NT~~~~~~---~~------~~~~~~~~GGlSG~-~i~~~al~~i~~i~~~~~~~i~IIg~  293 (362)
                      ++.+.++.+.++|..-|+|++++.....   +.      .|....++ |.+=. .-.....+.++.+++ ..++++|+-.
T Consensus       102 E~~~~v~~a~~~gl~~I~Cv~~~~~~~~~~~l~~~~IAYEPvWAIGT-G~~as~~~~e~i~~~~~~~~~-~~~~i~ILYG  179 (223)
T PRK04302        102 DIEAAVERAKELGLESVVCTNNPETSAAAAALGPDAVAVEPPELIGT-GIPVSKAKPEVVTGTVEAVRK-VNPDVKVLCG  179 (223)
T ss_pred             CHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEEECCHHHHCC-CCCCCCCCHHHHHHHHHHHHH-HCCCCCEEEE
T ss_conf             27999999998699489972739988899865899899888898448-987662589999999999996-4799758997


Q ss_pred             CCCCCHHHHHHHHHCCCCEEEECHHHHC-CCHHHHHHHHHHHHHH
Q ss_conf             7889999999999839997545278770-6978999999999999
Q gi|254780434|r  294 GGISSTKDALDKIMAGANLIQLYSAMIY-EGISLPKRIIQGLSDF  337 (362)
Q Consensus       294 GGI~s~~Da~e~l~aGAs~VQi~Tali~-~Gp~~~~~I~~~L~~~  337 (362)
                      |||.+++|+..++..|+|-+-|++|.+- +.|.   .+.++|.+-
T Consensus       180 GsV~~~n~~~~~~~~~vDG~LVGgAsLkA~Dp~---~~l~~l~~~  221 (223)
T PRK04302        180 AGISTGEDVKAALELGADGVLLASGVVKAKDPE---AALRDLVSP  221 (223)
T ss_pred             CCCCHHHHHHHHHCCCCCEEEEEEEEEECCCHH---HHHHHHHHH
T ss_conf             846878899997468998589762566687999---999999975


No 316
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional
Probab=91.95  E-value=1  Score=24.59  Aligned_cols=153  Identities=16%  Similarity=0.112  Sum_probs=80.1

Q ss_pred             CCCCCCHHHHHHHHHHHH--HCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEE-CCCCCCCCCCCCCCHHHHHH
Q ss_conf             247777788999876410--001210001104542467887765554206755269830-33365322110000234321
Q gi|254780434|r  114 GFNNAGYHTVFSRLSKIQ--PTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTIN-ISSPNTPGLRSLQKKKNLER  190 (362)
Q Consensus       114 Gl~N~G~~~~~~~l~~~~--~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiN-iSCPNt~g~~~~~~~~~l~~  190 (362)
                      +|.-+|.+ -++-|++.+  .+.|+..-|.-           ..-++.+.+++|.+-|- ..|-||             +
T Consensus        59 sfrG~G~e-gL~~L~~vk~~~glpi~TdVh~-----------~~q~e~v~~~vDilQIpAfl~rqt-------------d  113 (250)
T PRK13397         59 SFQGLGLQ-GIRYLHEVCQEFGLLSVSEIMS-----------ERQLEEAYDYLDVIQVGARNMQNF-------------E  113 (250)
T ss_pred             CCCCCCHH-HHHHHHHHHHHCCCCEEEECCC-----------HHHHHHHHHHCCEEEECHHHHCCH-------------H
T ss_conf             76788888-9999999999839974884799-----------999999984474898772640498-------------9


Q ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             11122444556553126885178650577774888999998764498299980665553234577544632211356454
Q gi|254780434|r  191 LLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLF  270 (362)
Q Consensus       191 ~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~  270 (362)
                      ++.++          ..+.+||.+|=+-..+-.+....++.+.+.|.+.|.+|-.     +.      .++. .+-+-+.
T Consensus       114 Ll~a~----------a~t~kpV~iKkgq~~s~~~~~~a~eki~~~Gn~~i~l~ER-----G~------~gy~-~~~rn~~  171 (250)
T PRK13397        114 FLKTL----------SHIDKPILFKRGLMATIEEYLGALSYLQDTGKSNIILCER-----GV------RGYD-VETRNML  171 (250)
T ss_pred             HHHHH----------HHHCCEEEECCCCCCCHHHHHHHHHHHHHCCCCCEEEEEC-----CC------CCCC-CCCCCCH
T ss_conf             99998----------7309808978877799999999999999659982899828-----98------7555-6312570


Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEE----CCCCCHHH--HHHHHHCCCCEEEECH
Q ss_conf             24689999999740897489996----78899999--9999983999754527
Q gi|254780434|r  271 LKSTIALAKIRQRVGPKIAIIGT----GGISSTKD--ALDKIMAGANLIQLYS  317 (362)
Q Consensus       271 ~~al~~i~~i~~~~~~~i~IIg~----GGI~s~~D--a~e~l~aGAs~VQi~T  317 (362)
                        ....+-.+++..  .+|||--    .|-...--  |..-+.+|||-+.+=|
T Consensus       172 --d~~~ip~~~~~~--~~PVi~D~SHs~G~r~~v~~la~aA~a~G~dGlfiE~  220 (250)
T PRK13397        172 --DIMAVPIIQQKT--DLPIIVDVSHSTGRRDLLLPAAKIAKAVGANGIMMEV  220 (250)
T ss_pred             --HHHHHHHHHHHC--CCCEEEECCCCCCCCCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             --077779999615--9998992875478825289999999983999899982


No 317
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain.  TMADH is an iron-sulfur flavoprotein that catalyzes the oxidative demethylation of trimethylamine to form dimethylamine and formaldehyde. The protein forms a symetrical dimer with each subunit containing one 4Fe-4S cluster and one FMN cofactor.  It contains a unique flavin, in the form of a 6-S-cysteinyl FMN  which is bent by ~25 degrees along the N5-N10 axis of the flavin isoalloxazine ring. This modification of the conformation of the flavin is thought to facilitate catalysis.The closely related histamine dehydrogenase catalyzes oxidative deamination of histamine.
Probab=91.86  E-value=0.75  Score=25.54  Aligned_cols=98  Identities=17%  Similarity=0.254  Sum_probs=56.2

Q ss_pred             CCCHHHHH-------HHHHHHHHCCCCEEEEE--CCC--CCCCCCCCCCCCCCCCC-CCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             77748889-------99998764498299980--665--55323457754463221-13564542468999999974089
Q gi|254780434|r  219 DLSEEELD-------DIAVEVLSHKVEGIIVS--NTT--LSRKGVQCSDNHEQDGG-LSGSPLFLKSTIALAKIRQRVGP  286 (362)
Q Consensus       219 d~~~~~i~-------~ia~~a~~~g~dGiv~~--NT~--~~~~~~~~~~~~~~~GG-lSG~~i~~~al~~i~~i~~~~~~  286 (362)
                      .++.++|.       +.|+.|.++|.|||=+-  +.-  ..-..-.......++|| +-.+  ....++.+..+|+.+++
T Consensus       139 ~mt~~eI~~ii~~f~~AA~rA~~AGfDgVEIHaahGYLl~qFlSp~~N~RtDeYGGS~enR--~Rf~~Eii~aVr~~vg~  216 (370)
T cd02929         139 EMDKDDIKRVRRWYVDAALRARDAGFDIVYVYAAHGYLPLQFLLPRYNKRTDEYGGSLENR--ARFWRETLEDTKDAVGD  216 (370)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHCCCCCCCCCCCCCCCHHHH--HHHHHHHHHHHHHHHCC
T ss_conf             6899999999999999999999859898997711355999734774578777468988999--89999999999997199


Q ss_pred             CEEEE---------EECCCCCHHHHHHHHH---CCCCEEEECHH
Q ss_conf             74899---------9678899999999998---39997545278
Q gi|254780434|r  287 KIAII---------GTGGISSTKDALDKIM---AGANLIQLYSA  318 (362)
Q Consensus       287 ~i~II---------g~GGI~s~~Da~e~l~---aGAs~VQi~Ta  318 (362)
                      +++|.         +-+|..+.+|..+++.   ...|++.+..+
T Consensus       217 df~i~~R~s~~~~~~~~g~~~~~~~~~~~~~~~~~~d~~~vs~g  260 (370)
T cd02929         217 DCAVATRFSVDELIGPGGIESEGEGVEFVEMLDELPDLWDVNVG  260 (370)
T ss_pred             CCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             87599998941256889998889999999997365797998855


No 318
>COG1954 GlpP Glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Transcription]
Probab=91.85  E-value=0.26  Score=28.67  Aligned_cols=66  Identities=21%  Similarity=0.298  Sum_probs=47.4

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHH
Q ss_conf             48889999987644982999806655532345775446322113564542468999999974089748999678899999
Q gi|254780434|r  222 EEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKD  301 (362)
Q Consensus       222 ~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~D  301 (362)
                      ...+....+.+++...|.+=+                     |-|  +.|   +.+.++.+++  .+|||+.|=|.+-+|
T Consensus       107 S~Al~~~~~~i~~~~pD~iEv---------------------LPG--v~P---kvi~~i~~~t--~~piIAGGLi~t~Ee  158 (181)
T COG1954         107 SIALEKGIKQIEKSEPDFIEV---------------------LPG--VMP---KVIKEITEKT--HIPIIAGGLIETEEE  158 (181)
T ss_pred             HHHHHHHHHHHHHCCCCEEEE---------------------CCC--CCH---HHHHHHHHHC--CCCEEECCCCCCHHH
T ss_conf             788998999998709987988---------------------675--439---9999998755--897773243053999


Q ss_pred             HHHHHHCCCCEEEE
Q ss_conf             99999839997545
Q gi|254780434|r  302 ALDKIMAGANLIQL  315 (362)
Q Consensus       302 a~e~l~aGAs~VQi  315 (362)
                      +.+.+.+||-+|--
T Consensus       159 v~~Al~aGA~avST  172 (181)
T COG1954         159 VREALKAGAVAVST  172 (181)
T ss_pred             HHHHHHHCCEEEEE
T ss_conf             99999717679851


No 319
>PRK08999 hypothetical protein; Provisional
Probab=91.74  E-value=1.1  Score=24.44  Aligned_cols=77  Identities=14%  Similarity=0.114  Sum_probs=51.2

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHH
Q ss_conf             88999998764498299980665553234577544632211356454246899999997408974899967889999999
Q gi|254780434|r  224 ELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDAL  303 (362)
Q Consensus       224 ~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~  303 (362)
                      ...++. .|.+.|+|.++++.-      ..+...         +...++.....+++.+..  .+|+++.|||. .+|.-
T Consensus       235 ~~~e~~-~A~~~g~Dyi~lsPV------~~T~sh---------p~~~~lGw~~f~~l~~~~--~iPv~ALGGi~-~~dl~  295 (312)
T PRK08999        235 NAEELA-HAQQLGVDFAVLSPV------QPTASH---------PGAPPLGWDGFAALIAGV--PLPVYALGGMG-PGDLE  295 (312)
T ss_pred             CHHHHH-HHHHHCCCEEEECCC------CCCCCC---------CCCCCCCHHHHHHHHHHC--CCCEEEECCCC-HHHHH
T ss_conf             999999-998708996998154------464789---------999967899999999738--99989988889-99999


Q ss_pred             HHHHCCCCEEEECHHH
Q ss_conf             9998399975452787
Q gi|254780434|r  304 DKIMAGANLIQLYSAM  319 (362)
Q Consensus       304 e~l~aGAs~VQi~Tal  319 (362)
                      +-+.+||.-|-.-+++
T Consensus       296 ~a~~~Ga~GiA~Ir~~  311 (312)
T PRK08999        296 EAREHGAQGIAGIRGF  311 (312)
T ss_pred             HHHHHCCEEEEEEEEC
T ss_conf             9998099699776315


No 320
>PRK08227 aldolase; Validated
Probab=91.64  E-value=1.1  Score=24.36  Aligned_cols=142  Identities=12%  Similarity=0.149  Sum_probs=72.8

Q ss_pred             HCCCCCEE--EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC---CCCHHH-HHHHHHHHH
Q ss_conf             06755269--830333653221100002343211112244455655312688517865057---777488-899999876
Q gi|254780434|r  160 FFTIASYF--TINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISP---DLSEEE-LDDIAVEVL  233 (362)
Q Consensus       160 ~~~~aD~i--EiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsP---d~~~~~-i~~ia~~a~  233 (362)
                      +.-+||++  -+|+.+++        +.+.+..+ ..+...      .....+|+++=..+   ...+.+ +.-.++.+.
T Consensus       131 vrlGAdAVsv~v~iGs~~--------E~~~l~~l-g~v~~e------~~~~GmPlla~~~~g~~~~~d~~~va~aaRia~  195 (291)
T PRK08227        131 VRLNVCAVAAQVFIGSEY--------ETQSIKNI-IQLVDA------GLRYGMPTMAVTAVGKDMVRDARYFSLATRIAA  195 (291)
T ss_pred             HHCCCCEEEEEEECCCCH--------HHHHHHHH-HHHHHH------HHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHH
T ss_conf             867997899986359932--------89999999-999999------998299879983468777777899999999999


Q ss_pred             HCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCC-CHHHH----HHHHHC
Q ss_conf             4498299980665553234577544632211356454246899999997408974899967889-99999----999983
Q gi|254780434|r  234 SHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAKIRQRVGPKIAIIGTGGIS-STKDA----LDKIMA  308 (362)
Q Consensus       234 ~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~-s~~Da----~e~l~a  308 (362)
                      |.|+|-|-.--|                         +   +..+++-..+  .+|++-.||=. +-.|+    .+-|.+
T Consensus       196 ELGADiVKt~yt-------------------------~---e~f~~Vv~a~--pvPVliaGG~k~~d~e~L~~v~~a~~a  245 (291)
T PRK08227        196 EMGAQIIKTYYV-------------------------E---KGFERITAGC--PVPIVIAGGKKLPERDALEMCYQAIDQ  245 (291)
T ss_pred             HHCCCEEECCCC-------------------------H---HHHHHHHHCC--CCCEEEECCCCCCHHHHHHHHHHHHHC
T ss_conf             978998850697-------------------------3---4599999648--997899679989869999999999976


Q ss_pred             CCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCCCHHHHH
Q ss_conf             999754527877069789999999999999983899778961
Q gi|254780434|r  309 GANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEVNFENIR  350 (362)
Q Consensus       309 GAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~si~e~i  350 (362)
                      ||+=|-++.- +|+-+. ...+.+.|....  |.=.|++|+.
T Consensus       246 Ga~Gv~~GRN-VfQ~~~-P~~~~~Al~~iV--He~~s~~eA~  283 (291)
T PRK08227        246 GASGVDMGRN-IFQSDA-PVAMIKAVHAVV--HHNETAKEAY  283 (291)
T ss_pred             CCCEEEECCH-HHCCCC-HHHHHHHHHHHH--CCCCCHHHHH
T ss_conf             9936872400-235899-899999999986--5999999999


No 321
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro: IPR005991    This family of proteins, often annotated as a putative IMP dehydrogenase, are related to IMP dehydrogenase and GMP reductase and restricted to the high GC Gram-positive bacteria..
Probab=91.30  E-value=0.4  Score=27.36  Aligned_cols=75  Identities=20%  Similarity=0.294  Sum_probs=52.8

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHHH--HCCCHHHHHHHHHHHH--HHHHHC
Q ss_conf             564542468999999974089748999678899999999998399975452787--7069789999999999--999983
Q gi|254780434|r  266 GSPLFLKSTIALAKIRQRVGPKIAIIGTGGISSTKDALDKIMAGANLIQLYSAM--IYEGISLPKRIIQGLS--DFLNKE  341 (362)
Q Consensus       266 G~~i~~~al~~i~~i~~~~~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Tal--i~~Gp~~~~~I~~~L~--~~l~~~  341 (362)
                      |+|-+...++|-.+.++ ++.+  |-+-|||.+++|+.-.+.|||+-|+++|=|  .|+-|+   ++..+-.  .|-+..
T Consensus       311 GrPqfsavleCa~~a~~-~G~h--~WadGG~r~PrdvalalaaGasnvm~GsWf~GtyesPG---dl~~~~~~~~ykes~  384 (476)
T TIGR01303       311 GRPQFSAVLECAAEARK-LGKH--VWADGGVRHPRDVALALAAGASNVMVGSWFAGTYESPG---DLRRDADGRAYKESF  384 (476)
T ss_pred             CCCHHHHHHHHHHHHHH-CCCE--EEECCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCC---CHHHHCCCCHHHHHH
T ss_conf             87137899898899986-0772--64068867637777766506430244110035547851---011100474013453


Q ss_pred             CCCCH
Q ss_conf             89977
Q gi|254780434|r  342 NEVNF  346 (362)
Q Consensus       342 G~~si  346 (362)
                      |..|-
T Consensus       385 Gmas~  389 (476)
T TIGR01303       385 GMASK  389 (476)
T ss_pred             HHHHH
T ss_conf             14568


No 322
>PRK08508 biotin synthase; Provisional
Probab=91.26  E-value=1.2  Score=24.11  Aligned_cols=193  Identities=13%  Similarity=0.074  Sum_probs=104.1

Q ss_pred             CCHHHHHHHHHHHH---HCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCC--CCCCCCCCCCHHHHHHHH
Q ss_conf             77788999876410---0012100011045424678877655542067552698303336--532211000023432111
Q gi|254780434|r  118 AGYHTVFSRLSKIQ---PTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINISSP--NTPGLRSLQKKKNLERLL  192 (362)
Q Consensus       118 ~G~~~~~~~l~~~~---~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiSCP--Nt~g~~~~~~~~~l~~~l  192 (362)
                      .-+|.+.+-++..+   ++.-+-+|+|--     ..++|..   ....++|.+-.|+--.  ..+.   ......+++-+
T Consensus        72 ~~~e~v~~~v~~Ik~~~~~l~~c~slG~l-----~~e~~~~---LkeAGvdrY~hNlETs~~~y~~---I~tThty~dRl  140 (279)
T PRK08508         72 KKLEYVAKAAKAVKKEVPGLHLIACNGMA-----SVEQLKE---LKKAGIFSYNHNLETSKEFFPK---ICTTHSWEERF  140 (279)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCCC-----CHHHHHH---HHHCCCCEECCCCCCCHHHHCC---CCCCCCHHHHH
T ss_conf             44999999999986337993576117857-----9999999---9983971230766767687576---58998889999


Q ss_pred             HHHHHHHHHHHHHCCCCC--EEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             122444556553126885--178650577774888999998764498299980665553234577544632211356454
Q gi|254780434|r  193 IHVMQTREEEKIKTGKFV--PIFLKISPDLSEEELDDIAVEVLSHKVEGIIVSNTTLSRKGVQCSDNHEQDGGLSGSPLF  270 (362)
Q Consensus       193 ~~v~~~~~~~~~~~~~~~--Pi~vKLsPd~~~~~i~~ia~~a~~~g~dGiv~~NT~~~~~~~~~~~~~~~~GGlSG~~i~  270 (362)
                      ..+...+.     ..-.+  =.++-|.  .+.++..+++-.+.+.++|- |-+|..+..++++-. ..    .++    .
T Consensus       141 ~tl~~~k~-----aGl~vCsGgIiGlG--Et~edrve~a~~L~eL~~ds-VPIN~liPi~GTPLe-~~----~l~----~  203 (279)
T PRK08508        141 QTCLNAKE-----AGLGLCSGGIFGLG--ESWEDRISMLKSLASLSPHS-TPINFFIPNPALPLD-TP----TLS----A  203 (279)
T ss_pred             HHHHHHHH-----CCCEEECCCEEECC--CCHHHHHHHHHHHHHCCCCE-ECCCCCCCCCCCCCC-CC----CCC----H
T ss_conf             99999998-----19948678544789--99899999999998389987-515676589999888-89----999----9


Q ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCCCC-HHHH-HHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             2468999999974089748999678899-9999-999983999754527877069789999999999999983899
Q gi|254780434|r  271 LKSTIALAKIRQRVGPKIAIIGTGGISS-TKDA-LDKIMAGANLIQLYSAMIYEGISLPKRIIQGLSDFLNKENEV  344 (362)
Q Consensus       271 ~~al~~i~~i~~~~~~~i~IIg~GGI~s-~~Da-~e~l~aGAs~VQi~Tali~~Gp~~~~~I~~~L~~~l~~~G~~  344 (362)
                      .-.++.|+.+|=.. ++..|--+||-.. -.|. ...+++||+.+.++--+--.|...-.+     .+.+++.||.
T Consensus       204 ~e~lr~iAl~Rlil-P~a~Ir~agGRe~~l~~~q~~~~~aGaN~i~~G~yLTt~G~~~~~D-----~~mi~~lG~~  273 (279)
T PRK08508        204 DEALEIVRLAKEAL-PNARLMVAGGREVVFGERQYEIFEAGANAIVIGDYLTTKGEAPKKD-----IEKLKSLGFE  273 (279)
T ss_pred             HHHHHHHHHHHHHC-CCCEEEECCCHHHHCHHHHHHHHHHCCCEEEECCCCCCCCCCHHHH-----HHHHHHCCCE
T ss_conf             99999999999978-9876562465244556369999984684688866527899786799-----9999986993


No 323
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase; InterPro: IPR006268   These sequences are one of at least three types of phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase). This enzyme catalyzes the first of 7 steps in the biosynthesis of chorismate, that last common precursor of all three aromatic amino acids and of PABA, ubiquinone and menaquinone. Some members of this family, including an experimentally characterised member from Bacillus subtilis, are bifunctional, with a chorismate mutase domain N-terminal to this region. The member of this family from Synechocystis PCC 6803, CcmA, was shown to be essential for carboxysome formation. However, no other candidate for this enzyme is present in that species, chorismate biosynthesis does occur, other species having this protein lack carboxysomes but appear to make chorismate, and a requirement of CcmA for carboxysome formation does not prohibit a role in chorismate biosynthesis.; GO: 0016832 aldehyde-lyase activity, 0009073 aromatic amino acid family biosynthetic process.
Probab=91.20  E-value=0.55  Score=26.45  Aligned_cols=93  Identities=16%  Similarity=0.276  Sum_probs=63.9

Q ss_pred             HCCCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCEEEEECC-CCCCC----CCCCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             00121000110454246788776555420675526983033-36532----21100002343211112244455655312
Q gi|254780434|r  132 PTSPIGINLGANKDSKDFILDYVSGIRLFFTIASYFTINIS-SPNTP----GLRSLQKKKNLERLLIHVMQTREEEKIKT  206 (362)
Q Consensus       132 ~~~pi~vsI~~~~~s~~~~~dy~~~~~~~~~~aD~iEiNiS-CPNt~----g~~~~~~~~~l~~~l~~v~~~~~~~~~~~  206 (362)
                      .++||..==|-    ...+++|...+|.+        ++=+ |||+-    |-|.+.......-.+.+|-.      .|.
T Consensus       131 ~~KPVLLKRG~----~aTi~EwL~AAEYI--------l~~GsN~~ViLCERGIRTfE~~TR~TLD~saV~~------~K~  192 (262)
T TIGR01361       131 QGKPVLLKRGM----GATIEEWLEAAEYI--------LSEGSNGNVILCERGIRTFEKSTRNTLDLSAVPL------LKK  192 (262)
T ss_pred             CCCCEEEECCC----CHHHHHHHHHHHHH--------HHCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHH------HHH
T ss_conf             37975530772----15899999999999--------8468899548997585676300245333789999------986


Q ss_pred             CCCCEEEEECCCCCCH-HHHHHHHHHHHHCCCCEEEE
Q ss_conf             6885178650577774-88899999876449829998
Q gi|254780434|r  207 GKFVPIFLKISPDLSE-EELDDIAVEVLSHKVEGIIV  242 (362)
Q Consensus       207 ~~~~Pi~vKLsPd~~~-~~i~~ia~~a~~~g~dGiv~  242 (362)
                      .++.||+|=-|.=... +-+..+|+++...|+||+.+
T Consensus       193 ~tHLPi~VDPSH~~GrRdLV~plA~AA~A~GADgl~i  229 (262)
T TIGR01361       193 ETHLPIIVDPSHAAGRRDLVLPLAKAAIAAGADGLMI  229 (262)
T ss_pred             CCCCCEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             0589878718798762457889999989757473689


No 324
>PRK09282 pyruvate carboxylase subunit B; Validated
Probab=91.11  E-value=1.3  Score=24.01  Aligned_cols=87  Identities=14%  Similarity=0.191  Sum_probs=45.4

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECC
Q ss_conf             05777748