HHsearch alignment for GI: 254780434 and conserved domain: pfam01645

>pfam01645 Glu_synthase Conserved region in glutamate synthase. This family represents a region of the glutamate synthase protein. This region is expressed as a separate subunit in the glutamate synthase alpha subunit from archaebacteria, or part of a large multidomain enzyme in other organisms. The aligned region of these proteins contains a putative FMN binding site and Fe-S cluster.
Probab=98.81  E-value=1.9e-07  Score=69.96  Aligned_cols=147  Identities=16%  Similarity=0.218  Sum_probs=86.3

Q ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             78877655542067552698303336532211000023432111122444556553126885178650577774888999
Q gi|254780434|r  149 FILDYVSGIRLFFTIASYFTINISSPNTPGLRSLQKKKNLERLLIHVMQTREEEKIKTGKFVPIFLKISPDLSEEELDDI  228 (362)
Q Consensus       149 ~~~dy~~~~~~~~~~aD~iEiNiSCPNt~g~~~~~~~~~l~~~l~~v~~~~~~~~~~~~~~~Pi~vKLsPd~~~~~i~~i  228 (362)
T Consensus       157 KVt~eIA~~R~~~~G~d~i-----SP~~--h~di~s~edL~~~I~~Lr~~--------~~~~PVgvKl~~~---~~~~~i  218 (367)
T pfam01645       157 KVSPEIARIRGSPPGVGLI-----SPPP--HHDIYSIEDLAQLIYDLKEI--------NPKAPISVKLVSG---HGVGTI  218 (367)
T ss_pred             HCCHHHHHHCCCCCCCCCC-----CCCC--CCCCCCHHHHHHHHHHHHHC--------CCCCCEEEEEECC---CCHHHH
T ss_conf             4489999680899998767-----8633--47889999999999999841--------7899459998147---768999


Q ss_pred             HHHHHHCCCCEEEEECC---CCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH-HH-HHCCCCEEEEEECCCCCHHHHH
Q ss_conf             99876449829998066---5553234577544632211356454246899999-99-7408974899967889999999
Q gi|254780434|r  229 AVEVLSHKVEGIIVSNT---TLSRKGVQCSDNHEQDGGLSGSPLFLKSTIALAK-IR-QRVGPKIAIIGTGGISSTKDAL  303 (362)
Q Consensus       229 a~~a~~~g~dGiv~~NT---~~~~~~~~~~~~~~~~GGlSG~~i~~~al~~i~~-i~-~~~~~~i~IIg~GGI~s~~Da~  303 (362)
T Consensus       219 a~~~aka~~D~I~IdG~eGGTGAaP~~~~d--------~~GlP~~-~~L~~~~~~L~~~glR~~V~liasGgl~t~~Dv~  289 (367)
T pfam01645       219 AAGVAKAGADIILIDGHDGGTGASPKTSIK--------HAGLPWE-LALAEVHQTLVENGLRDRVSLIADGGLRTGADVA  289 (367)
T ss_pred             HHHHHCCCCCEEEECCCCCCCCCCCHHHHH--------HCCCHHH-HHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHH
T ss_conf             998753678889971789867755488997--------4424699-9999999999870675764999769978889999


Q ss_pred             HHHHCCCCEEEECHHHHCC
Q ss_conf             9998399975452787706
Q gi|254780434|r  304 DKIMAGANLIQLYSAMIYE  322 (362)
Q Consensus       304 e~l~aGAs~VQi~Tali~~  322 (362)
T Consensus       290 ka~aLGAD~v~~gt~~m~A  308 (367)
T pfam01645       290 KAAALGADAVYIGTAALIA  308 (367)
T ss_pred             HHHHHCCCHHHHHHHHHHH
T ss_conf             9998565354234799998