RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780437|ref|YP_003064850.1| 30S ribosomal protein S21 [Candidatus Liberibacter asiaticus str. psy62] (95 letters) >gnl|CDD|144672 pfam01165, Ribosomal_S21, Ribosomal protein S21. Length = 57 Score = 48.7 bits (117), Expect = 3e-07 Identities = 30/55 (54%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Query: 22 VLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75 V V++N N+E ALR K+K++ G+LREL+ R YEKPS+KR R + EA RR RK Sbjct: 3 VKVKENENIESALRRFKRKVEKNGILRELRRRRFYEKPSEKRKRKRREARRRRRK 57 >gnl|CDD|31170 COG0828, RpsU, Ribosomal protein S21 [Translation, ribosomal structure and biogenesis]. Length = 67 Score = 41.0 bits (96), Expect = 7e-05 Identities = 29/63 (46%), Positives = 43/63 (68%) Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81 + + +++ALR K+K++ EG+LRE+K R YEKPS+KR R K+ A +R K +RK Sbjct: 5 KVRENEPLDKALRRFKRKVEKEGILREMKEREFYEKPSEKRKRKKAAARKRKFKRLRKEQ 64 Query: 82 QRE 84 QRE Sbjct: 65 QRE 67 >gnl|CDD|35534 KOG0313, KOG0313, KOG0313, Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]. Length = 423 Score = 27.6 bits (61), Expect = 0.81 Identities = 10/46 (21%), Positives = 18/46 (39%) Query: 50 KMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQHR 95 M + + + L+S + RR +K R+ P+ L H Sbjct: 215 TMLKIWSVETDEEDELESSSNRRRKKQKREKEGGTRTPLVTLEGHT 260 >gnl|CDD|31883 COG1697, COG1697, DNA topoisomerase VI, subunit A [DNA replication, recombination, and repair]. Length = 356 Score = 27.2 bits (60), Expect = 1.0 Identities = 12/47 (25%), Positives = 24/47 (51%) Query: 43 EGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVS 89 + V + L G +EK + V LK + R +R+ ++++ + PV Sbjct: 192 DAVFQRLVEEGFWEKENAILVTLKGQPDRATRRFLKRLNEELDLPVY 238 >gnl|CDD|143991 pfam00240, ubiquitin, Ubiquitin family. This family contains a number of ubiquitin-like proteins: SUMO (smt3 homologue), Nedd8, Elongin B, Rub1, and Parkin. A number of them are thought to carry a distinctive five-residue motif termed the proteasome-interacting motif (PIM), which may have a biologically significant role in protein delivery to proteasomes and recruitment of proteasomes to transcription sites. Length = 69 Score = 25.3 bits (56), Expect = 3.6 Identities = 8/19 (42%), Positives = 11/19 (57%) Query: 74 RKLMRKIAQREGAPVSRLR 92 +L KI +EG PV + R Sbjct: 19 SELKEKIEDKEGIPVDQQR 37 >gnl|CDD|99995 cd04299, GT1_Glycogen_Phosphorylase_like, This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences. Oligosaccharide phosphorylase catalyzes the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The members of this family are found in bacteria and Archaea.. Length = 778 Score = 25.2 bits (56), Expect = 3.8 Identities = 8/34 (23%), Positives = 15/34 (44%) Query: 62 RVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQHR 95 R +L+ I R+ +R+ R GA + + Sbjct: 438 RQQLRRRLIEFVRRRLRRQWLRRGASAEEIGEAD 471 >gnl|CDD|145371 pfam02181, FH2, Formin Homology 2 Domain. Length = 372 Score = 24.9 bits (55), Expect = 4.6 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 7/59 (11%) Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78 + L + +E+ LR L K E + ELK PS + + SE +R SRK + Sbjct: 150 LLELSKIPRLEERLRALLFKSTFEEEVEELK-------PSLETLEAASEELRESRKFKK 201 >gnl|CDD|36363 KOG1148, KOG1148, KOG1148, Glutaminyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 764 Score = 24.5 bits (53), Expect = 6.6 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Query: 50 KMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQ 93 + RG E+ S R R E++R MR EG R++Q Sbjct: 352 ERRGFNERLSPWRDRPIEESLRLFED-MRDGKYEEGEATLRMKQ 394 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.136 0.367 Gapped Lambda K H 0.267 0.0684 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,070,152 Number of extensions: 47987 Number of successful extensions: 249 Number of sequences better than 10.0: 1 Number of HSP's gapped: 248 Number of HSP's successfully gapped: 24 Length of query: 95 Length of database: 6,263,737 Length adjustment: 63 Effective length of query: 32 Effective length of database: 4,902,370 Effective search space: 156875840 Effective search space used: 156875840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 51 (23.5 bits)