RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780437|ref|YP_003064850.1| 30S ribosomal protein S21 [Candidatus Liberibacter asiaticus str. psy62] (95 letters) >gnl|CDD|178952 PRK00270, rpsU, 30S ribosomal protein S21; Reviewed. Length = 64 Score = 51.4 bits (124), Expect = 5e-08 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Query: 22 VLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79 V VR+N +++ALR K+K++ G+LREL+ R YEKPS+KR R K+ A +R RK + + Sbjct: 4 VKVRENESIDKALRRFKRKVEKAGILRELRRREFYEKPSEKRKRKKAAARKRRRKKLAR 62 >gnl|CDD|129141 TIGR00030, S21p, ribosomal protein S21. This model describes bacterial ribosomal protein S21 and most mitochondrial and chloroplast equivalents. Length = 58 Score = 43.0 bits (102), Expect = 2e-05 Identities = 26/55 (47%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Query: 22 VLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75 V V++ ++ ALR K+K++ EG+LRELK R +YEKPS++R R + A +R RK Sbjct: 3 VKVKEGESIDSALRRFKRKLEKEGILRELKKRRYYEKPSERRRRKEKAAAKRIRK 57 >gnl|CDD|180177 PRK05636, PRK05636, replicative DNA helicase; Provisional. Length = 505 Score = 28.7 bits (64), Expect = 0.33 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Query: 2 LVFNAFRGIFSEGREISAVYV---LVRDNNVEQ 31 L+F A +FS+ +EI V V L R N++E+ Sbjct: 110 LIFQAIIDLFSDNKEIDPVIVAGRLDRTNDLER 142 >gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional. Length = 373 Score = 28.5 bits (64), Expect = 0.41 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 60 QKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLR 92 + RV+ ++ I+RSRK+ KIAQ E + LR Sbjct: 318 KIRVKHTAKVIKRSRKI-GKIAQIESKLLVALR 349 >gnl|CDD|162257 TIGR01219, Pmev_kin_ERG8, phosphomevalonate kinase, ERG8-type, eukaryotic branch. This enzyme is part of the mevalonate pathway, one of two alternative pathways for the biosynthesis of IPP. In an example of nonorthologous gene displacement, two different types of phosphomevalonate kinase are found - the animal type and this ERG8 type. This model represents plant and fungal forms of the ERG8 type of phosphomevalonate kinase. Length = 454 Score = 27.2 bits (60), Expect = 0.91 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 68 EAIRRSRKLMRKIAQREGAPVSRLRQ 93 EA+ R R+LMR+I + + Q Sbjct: 359 EAMLRIRRLMRQITEEASVDIEPESQ 384 >gnl|CDD|150324 pfam09618, Cas_Csy4, CRISPR-associated protein (Cas_Csy4). CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) is a widespread family of prokaryotic direct repeats with spacers of unique sequence between consecutive repeats. This protein family, typified by YPO2462 of Yersinia pestis, is a CRISPR-associated (Cas) family strictly associated with the Ypest subtype of CRISPR/Cas locus. It is designated Csy4, for CRISPR/Cas Subtype Ypest protein 4. Length = 182 Score = 26.0 bits (58), Expect = 2.1 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 61 KRVRLKSEAIRRSRKLMRK 79 RV+ KS R R+LM++ Sbjct: 96 SRVQAKSSPARLRRRLMKR 114 >gnl|CDD|168970 PRK07486, PRK07486, amidase; Provisional. Length = 484 Score = 25.7 bits (57), Expect = 2.5 Identities = 8/20 (40%), Positives = 11/20 (55%), Gaps = 1/20 (5%) Query: 51 MRGHYEKPSQKRVRLKSEAI 70 + Y P+ +R LK EAI Sbjct: 331 LLALYRDPA-RRALLKPEAI 349 >gnl|CDD|180152 PRK05589, PRK05589, peptide chain release factor 2; Provisional. Length = 325 Score = 25.5 bits (56), Expect = 3.4 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 6/30 (20%) Query: 28 NVEQALRVLKKKMQGEGVLRELKMRGHYEK 57 N E A+++LK K L ELK R H EK Sbjct: 242 NKETAMKMLKSK------LVELKERAHKEK 265 >gnl|CDD|184698 PRK14476, PRK14476, nitrogenase molybdenum-cofactor biosynthesis protein NifN; Provisional. Length = 455 Score = 25.2 bits (56), Expect = 3.9 Identities = 9/26 (34%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQ 41 E++ + L D NVE+A+ + KK + Sbjct: 69 EVTTI--LGGDENVEEAILNICKKAK 92 >gnl|CDD|151389 pfam10942, DUF2619, Protein of unknown function (DUF2619). This bacterial family of proteins has no known function. Length = 69 Score = 24.5 bits (54), Expect = 6.0 Identities = 8/26 (30%), Positives = 18/26 (69%) Query: 10 IFSEGREISAVYVLVRDNNVEQALRV 35 + S E++A ++++ N+VE+AL + Sbjct: 2 LLSASIELTAALLMLKYNDVEKALAI 27 >gnl|CDD|180641 PRK06635, PRK06635, aspartate kinase; Reviewed. Length = 404 Score = 24.3 bits (54), Expect = 6.6 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Query: 16 EISAVYVLVRDNNVEQALRVLKK 38 EI + VL+ + +E A+R L + Sbjct: 378 EIK-ISVLIDEKYLELAVRALHE 399 >gnl|CDD|182217 PRK10062, PRK10062, hypothetical protein; Provisional. Length = 303 Score = 24.3 bits (53), Expect = 7.3 Identities = 13/37 (35%), Positives = 20/37 (54%) Query: 43 EGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79 E VL L+ R H E P+Q++ RL+ A + K + Sbjct: 104 EKVLHMLEARKHKEDPAQRQQRLEKLAAQDPLKFEKD 140 >gnl|CDD|183991 PRK13352, PRK13352, thiamine biosynthesis protein ThiC; Provisional. Length = 431 Score = 24.3 bits (54), Expect = 7.4 Identities = 5/17 (29%), Positives = 10/17 (58%) Query: 77 MRKIAQREGAPVSRLRQ 93 M +A++EG +R+ Sbjct: 16 MEYVAKKEGVDPEFIRE 32 >gnl|CDD|151314 pfam10865, DUF2703, Protein of unknown function (DUF2703). This family of protein has no known function. Length = 120 Score = 24.3 bits (53), Expect = 7.8 Identities = 9/46 (19%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71 +E A+ L++ ++ G+ L+ + R L+S I Sbjct: 22 GEALEAAVNELREALEPLGIEVVLEET-ELDPEEFARAPLESNRIW 66 >gnl|CDD|177793 PLN00203, PLN00203, glutamyl-tRNA reductase. Length = 519 Score = 24.3 bits (53), Expect = 7.9 Identities = 9/25 (36%), Positives = 15/25 (60%) Query: 71 RRSRKLMRKIAQREGAPVSRLRQHR 95 R +++ +++ G PVS LRQH Sbjct: 146 RGVKEVTEWMSKTSGIPVSELRQHL 170 >gnl|CDD|148491 pfam06898, YqfD, Putative stage IV sporulation protein YqfD. This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins. YqfD of Bacillus subtilis is known to be essential for efficient sporulation although its exact function is unknown. Length = 383 Score = 23.9 bits (52), Expect = 9.2 Identities = 8/25 (32%), Positives = 13/25 (52%) Query: 55 YEKPSQKRVRLKSEAIRRSRKLMRK 79 YE + K EA+ + +KL +K Sbjct: 319 YEVQDKVVKLTKEEAVEKGKKLAKK 343 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.136 0.367 Gapped Lambda K H 0.267 0.0699 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,561,561 Number of extensions: 89118 Number of successful extensions: 393 Number of sequences better than 10.0: 1 Number of HSP's gapped: 392 Number of HSP's successfully gapped: 54 Length of query: 95 Length of database: 5,994,473 Length adjustment: 63 Effective length of query: 32 Effective length of database: 4,633,169 Effective search space: 148261408 Effective search space used: 148261408 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 50 (23.1 bits)