HHsearch alignment for GI: 254780438 and conserved domain: COG3142

>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism].
Probab=91.48  E-value=1.4  Score=25.42  Aligned_cols=107  Identities=21%  Similarity=0.191  Sum_probs=70.5

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEE--ECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             55333578221333788999998620269638997--2544441479999740661465112111024443564336668
Q gi|254780438|r  103 HQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLF--ADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN  180 (261)
Q Consensus       103 ~elTTegGldv~~~~~~L~~~i~~l~~~girvSLF--IDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~  180 (261)
T Consensus        93 G~lt~dg~iD~----~~le~Li~aA~gL~vTFHrAFD~~~d~~-~ale~li~~Gv~RILTsGg~-~sa~e-------g~~  159 (241)
T COG3142          93 GALTADGNIDM----PRLEKLIEAAGGLGVTFHRAFDECPDPL-EALEQLIELGVERILTSGGK-ASALE-------GLD  159 (241)
T ss_pred             EEECCCCCCCH----HHHHHHHHHCCCCCEEEEHHHHHCCCHH-HHHHHHHHCCCCEEECCCCC-CCHHH-------HHH
T ss_conf             54668986388----9999999870687624316656337999-99999997697378647886-75556-------079


Q ss_pred             HHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHH
Q ss_conf             89998766541562352078989877999997369963884259
Q gi|254780438|r  181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGH  224 (261)
Q Consensus       181 ~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGH  224 (261)
T Consensus       160 ~l~~li~~a~-gri~Im~GaGV~~~N~~~l~~-~tg~~e~H~s~  201 (241)
T COG3142         160 LLKRLIEQAK-GRIIIMAGAGVRAENIAELVL-LTGVTEVHGSA  201 (241)
T ss_pred             HHHHHHHHHC-CCEEEEECCCCCHHHHHHHHH-HCCCHHHHHCC
T ss_conf             9999999836-987998679889899999998-50803200024