HHsearch alignment for GI: 254780438 and conserved domain: PRK13306

>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional.
Probab=91.23  E-value=1.6  Score=25.15  Aligned_cols=121  Identities=13%  Similarity=0.150  Sum_probs=57.8

Q ss_pred             HHHHHHHHHHHHCCCCCEE--EEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             3788999998620269638--99725444414799997406614651121110244435643366688999876654156
Q gi|254780438|r  116 NQALLTKTVARLHNLGSRI--SLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMD  193 (261)
Q Consensus       116 ~~~~L~~~i~~l~~~girv--SLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lg  193 (261)
T Consensus        91 ~~~Ti~~~~~~A~~~g~~v~vdl~~~~~~e--~a~~~~~lgv~~~i~H~~~D~~~~g~-~~~~~~~~~ik~l~----~~~  163 (216)
T PRK13306         91 HIPTIKAALKVAKEFNGEIQIELYGNWTWE--QAQQWRDAGIQQVIYHRSRDAELAGV-AWGEKDLNKVKKLS----DMG  163 (216)
T ss_pred             CHHHHHHHHHHHHHHCCEEEEEEECCCCHH--HHHHHHHCCCCEEEEECCHHHHHCCC-CCCHHHHHHHHHHH----CCC
T ss_conf             979999999999980983699973787788--89999976998788760322442467-88877899999976----369


Q ss_pred             CEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2352078989877999997369963884259999999994099999999999974
Q gi|254780438|r  194 LQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQ  248 (261)
Q Consensus       194 L~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~~  248 (261)
T Consensus       164 ~~vaVaGGI~~~~~~~~~-~~~-~~ivIVGraIt~a---~dP~~aA~~i~~~I~~  213 (216)
T PRK13306        164 FKVSVTGGIVPEDLKLFK-GIP-IKTFIAGRAIRGA---KDPAEAARAFKDEIAK  213 (216)
T ss_pred             CEEEECCCCCHHHHHHHH-CCC-CCEEEECCCCCCC---CCHHHHHHHHHHHHHH
T ss_conf             829985998989999986-279-9899988523589---9999999999999998