Query         gi|254780438|ref|YP_003064851.1| pyridoxine 5'-phosphate synthase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 261
No_of_seqs    139 out of 1399
Neff          4.9 
Searched_HMMs 39220
Date          Sun May 29 16:21:54 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780438.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK05265 pyridoxine 5'-phospha 100.0       0       0  735.9  23.8  240    1-249     1-240 (240)
  2 pfam03740 PdxJ Pyridoxal phosp 100.0       0       0  715.7  23.1  238    3-248     1-239 (239)
  3 cd00003 PNPsynthase Pyridoxine 100.0       0       0  716.0  22.7  234    4-246     1-234 (234)
  4 TIGR00559 pdxJ pyridoxal phosp 100.0       0       0  699.9  21.8  238    4-248     1-265 (265)
  5 COG0854 PdxJ Pyridoxal phospha 100.0       0       0  657.3  21.5  240    3-250     1-242 (243)
  6 pfam05853 DUF849 Prokaryotic p  97.1   0.016   4E-07   38.9  11.5  120   25-152    27-159 (274)
  7 PRK08745 ribulose-phosphate 3-  96.9   0.058 1.5E-06   35.0  13.8  203   22-250    14-223 (223)
  8 PTZ00170 D-ribulose-5-phosphat  96.6    0.09 2.3E-06   33.7  12.4  192   34-252    27-224 (224)
  9 PRK08883 ribulose-phosphate 3-  96.0    0.18 4.6E-06   31.6  13.5  201   23-249    11-218 (220)
 10 COG1082 IolE Sugar phosphate i  95.8    0.22 5.6E-06   31.0  12.7  155   77-244    14-197 (274)
 11 pfam00834 Ribul_P_3_epim Ribul  95.8    0.22 5.7E-06   31.0  13.0  178   25-226    13-197 (201)
 12 PRK13209 L-xylulose 5-phosphat  95.6    0.21 5.4E-06   31.1   9.7  215   24-251    21-278 (283)
 13 PRK05581 ribulose-phosphate 3-  95.6    0.27 6.9E-06   30.4  13.2  198   23-247    15-219 (220)
 14 PRK08745 ribulose-phosphate 3-  95.0     0.4   1E-05   29.2  16.4  168    4-190    45-223 (223)
 15 PRK08005 ribulose-phosphate 3-  94.7    0.49 1.2E-05   28.6  12.0  188   25-244    14-209 (210)
 16 PRK09722 allulose-6-phosphate   94.6    0.52 1.3E-05   28.4  13.9  192   32-250    20-221 (227)
 17 cd04734 OYE_like_3_FMN Old yel  94.4    0.56 1.4E-05   28.2  10.3   17  148-164   148-164 (343)
 18 PRK11815 tRNA-dihydrouridine s  94.2   0.071 1.8E-06   34.4   4.1  169   73-249    69-274 (333)
 19 COG0269 SgbH 3-hexulose-6-phos  94.0    0.67 1.7E-05   27.7   9.2  142   83-249    72-215 (217)
 20 cd00429 RPE Ribulose-5-phospha  93.8    0.73 1.9E-05   27.4  11.7  192   25-242    13-210 (211)
 21 PRK09856 fructoselysine 3-epim  93.8    0.75 1.9E-05   27.3   9.8   44   23-66     12-58  (276)
 22 cd02803 OYE_like_FMN_family Ol  93.6    0.58 1.5E-05   28.1   7.9   27  203-230   292-318 (327)
 23 TIGR03471 HpnJ hopanoid biosyn  93.5    0.62 1.6E-05   27.9   7.8   84  116-199   259-342 (472)
 24 PRK09389 (R)-citramalate synth  93.5    0.43 1.1E-05   29.0   7.0  168   24-206    23-200 (487)
 25 pfam03932 CutC CutC family. Co  93.4    0.85 2.2E-05   27.0  15.9  172   27-221    10-197 (202)
 26 PRK05301 pyrroloquinoline quin  93.4    0.36 9.1E-06   29.6   6.6  124   26-165    52-194 (375)
 27 PRK05581 ribulose-phosphate 3-  93.4    0.86 2.2E-05   27.0  15.6  162    4-186    45-218 (220)
 28 PTZ00170 D-ribulose-5-phosphat  93.3     0.9 2.3E-05   26.8  15.5  164    4-188    46-220 (224)
 29 pfam01261 AP_endonuc_2 Xylose   93.1    0.94 2.4E-05   26.7   9.5  150   31-228     2-161 (201)
 30 TIGR02090 LEU1_arch isopropylm  92.9    0.34 8.5E-06   29.8   5.7   89  108-199    40-133 (371)
 31 pfam00682 HMGL-like HMGL-like.  92.8       1 2.6E-05   26.4  10.3  170   25-207    15-199 (237)
 32 cd02933 OYE_like_FMN Old yello  92.7     1.1 2.7E-05   26.3  11.3   18  147-164   158-175 (338)
 33 pfam01207 Dus Dihydrouridine s  92.7    0.41   1E-05   29.1   6.0  195   28-231    12-221 (309)
 34 PRK07094 biotin synthase; Prov  92.6     1.1 2.8E-05   26.2   8.2  134   80-226    72-218 (323)
 35 COG5012 Predicted cobalamin bi  92.0    0.33 8.4E-06   29.8   4.8   68   78-157   142-209 (227)
 36 COG3142 CutC Uncharacterized p  91.5     1.4 3.6E-05   25.4   7.6  107  103-224    93-201 (241)
 37 cd00429 RPE Ribulose-5-phospha  91.2     1.6   4E-05   25.2  13.3  146    4-165    41-198 (211)
 38 PRK13306 ulaD 3-keto-L-gulonat  91.2     1.6   4E-05   25.2  11.3  121  116-248    91-213 (216)
 39 PRK04452 acetyl-CoA decarbonyl  91.1     1.6 4.1E-05   25.1  11.6  159   13-188    64-235 (322)
 40 TIGR02631 xylA_Arthro xylose i  90.6     1.3 3.3E-05   25.7   6.7  159   23-226    31-220 (390)
 41 cd02801 DUS_like_FMN Dihydrour  90.6     1.3 3.3E-05   25.7   6.7  197   28-236    14-227 (231)
 42 cd02930 DCR_FMN 2,4-dienoyl-Co  90.4     1.8 4.7E-05   24.7  10.5   18  147-164   143-160 (353)
 43 cd02932 OYE_YqiM_FMN Old yello  89.8     2.1 5.2E-05   24.3  10.0   18  147-164   160-177 (336)
 44 TIGR03234 OH-pyruv-isom hydrox  89.7     1.7 4.4E-05   24.8   6.7  184    4-246     2-199 (254)
 45 cd02931 ER_like_FMN Enoate red  89.1     2.3 5.9E-05   24.0   9.2   17  147-163   156-172 (382)
 46 COG3246 Uncharacterized conser  89.1     1.2 3.1E-05   25.9   5.5   52   26-77     31-84  (298)
 47 pfam02679 ComA (2R)-phospho-3-  89.0     1.2   3E-05   26.0   5.5   77  115-201    52-135 (245)
 48 TIGR03470 HpnH hopanoid biosyn  88.2     2.6 6.7E-05   23.6   8.2   48  116-163   147-200 (318)
 49 cd04740 DHOD_1B_like Dihydroor  88.0     2.7 6.9E-05   23.5  12.0   87   72-160    93-185 (296)
 50 PRK10415 tRNA-dihydrouridine s  87.7     1.7 4.4E-05   24.8   5.6  191   28-228    24-229 (321)
 51 PRK11858 aksA trans-homoaconit  87.4     2.9 7.5E-05   23.3  13.6  171   25-212    27-212 (378)
 52 pfam00682 HMGL-like HMGL-like.  87.1    0.76 1.9E-05   27.3   3.5  106  144-253    70-182 (237)
 53 TIGR01037 pyrD_sub1_fam dihydr  87.1    0.42 1.1E-05   29.1   2.1   85   72-158    97-190 (308)
 54 pfam05690 ThiG Thiazole biosyn  87.0     2.6 6.6E-05   23.6   6.2  158   20-206    15-189 (246)
 55 PRK08091 ribulose-phosphate 3-  86.0     3.5 8.8E-05   22.8  12.3   45  118-162   171-215 (235)
 56 PRK13210 putative L-xylulose 5  85.9     3.5 8.9E-05   22.7  10.7  138   25-166    17-187 (284)
 57 PRK09997 hydroxypyruvate isome  85.9     3.5 8.9E-05   22.7   7.4   51    2-66      1-51  (258)
 58 PRK13523 NADPH dehydrogenase N  85.8     3.5   9E-05   22.7  10.1   18  147-164   148-165 (337)
 59 cd04735 OYE_like_4_FMN Old yel  85.8     3.5   9E-05   22.7   9.7   16  148-163   151-166 (353)
 60 PRK01222 N-(5'-phosphoribosyl)  85.8     3.5   9E-05   22.7   8.6  166   27-223    13-186 (212)
 61 PRK10550 tRNA-dihydrouridine s  85.6     1.1 2.9E-05   26.1   3.7  138   86-230    83-231 (312)
 62 PRK11572 copper homeostasis pr  85.1     3.8 9.7E-05   22.5  16.3  198   27-249    11-245 (248)
 63 cd00019 AP2Ec AP endonuclease   85.1     3.8 9.8E-05   22.5   8.3  176   25-248    11-206 (279)
 64 cd02929 TMADH_HD_FMN Trimethyl  85.0     3.9 9.8E-05   22.5   6.7  183   20-225    33-262 (370)
 65 PRK13803 bifunctional phosphor  84.8     3.9  0.0001   22.4   7.5   12  201-212   172-183 (611)
 66 pfam01208 URO-D Uroporphyrinog  84.6       4  0.0001   22.3   8.4   42  119-161   218-260 (337)
 67 PRK08195 4-hydroxy-2-ketovaler  84.6       4  0.0001   22.3   6.8  157   24-204    25-202 (337)
 68 PRK00915 2-isopropylmalate syn  84.0     4.2 0.00011   22.2  13.8  169   25-204    27-209 (511)
 69 PRK13958 N-(5'-phosphoribosyl)  84.0     4.3 0.00011   22.2   8.9  186   27-250    11-204 (207)
 70 PRK02048 4-hydroxy-3-methylbut  83.6     4.4 0.00011   22.1   6.6   19   28-47     96-114 (613)
 71 TIGR01464 hemE uroporphyrinoge  82.4     4.9 0.00012   21.8   7.2   95  118-214   219-349 (351)
 72 PRK00694 4-hydroxy-3-methylbut  82.1       5 0.00013   21.7   6.4   25   25-51     98-124 (606)
 73 cd04728 ThiG Thiazole synthase  82.0     5.1 0.00013   21.6  10.1  158   20-206    16-190 (248)
 74 cd02067 B12-binding B12 bindin  81.8     5.1 0.00013   21.6   6.4   74   73-158    31-106 (119)
 75 pfam00724 Oxidored_FMN NADH:fl  81.4     5.3 0.00013   21.5  11.5   85  147-232   237-325 (336)
 76 TIGR00381 cdhD CO dehydrogenas  80.9     1.4 3.5E-05   25.6   2.6   55   23-82    142-204 (401)
 77 cd04747 OYE_like_5_FMN Old yel  80.8     5.5 0.00014   21.4   6.0   19  147-165   150-168 (361)
 78 cd02069 methionine_synthase_B1  80.7     5.6 0.00014   21.3   6.4   64   79-156   127-190 (213)
 79 TIGR02146 LysS_fung_arch homoc  80.4     2.7 6.8E-05   23.6   4.0  168   14-203     5-202 (355)
 80 pfam01522 Polysacc_deac_1 Poly  80.4     5.7 0.00015   21.3   5.6   39   98-141     3-41  (123)
 81 PRK11840 bifunctional sulfur c  79.5     6.1 0.00016   21.1   8.7  159   20-206    91-265 (327)
 82 cd02911 arch_FMN Archeal FMN-b  79.3     6.2 0.00016   21.0   6.0  141   71-229    75-226 (233)
 83 PRK00208 thiG thiazole synthas  79.0     6.3 0.00016   21.0  10.2  158   20-206    17-191 (256)
 84 cd04722 TIM_phosphate_binding   78.7     6.4 0.00016   20.9  16.1  177   24-223    12-199 (200)
 85 COG0042 tRNA-dihydrouridine sy  77.9     2.9 7.4E-05   23.3   3.5  115  110-231   113-236 (323)
 86 TIGR00737 nifR3_yhdG putative   77.7     1.6 4.1E-05   25.1   2.1   24   23-46    158-181 (336)
 87 cd03465 URO-D_like The URO-D _  77.5     6.9 0.00018   20.7   9.0   95  118-214   208-328 (330)
 88 smart00052 EAL Putative diguan  76.2     7.5 0.00019   20.5   5.6  173   13-214    33-223 (241)
 89 PRK12344 putative alpha-isopro  76.2     5.2 0.00013   21.5   4.4  132   24-160    27-177 (530)
 90 PRK06256 biotin synthase; Vali  76.0     7.6 0.00019   20.4   8.1  201   10-226    22-238 (325)
 91 KOG3111 consensus               75.3     7.9  0.0002   20.3  13.8  159   12-189    54-220 (224)
 92 PRK13114 consensus              75.3     7.9  0.0002   20.3  19.9  212   22-257    22-265 (266)
 93 cd00405 PRAI Phosphoribosylant  74.8     8.1 0.00021   20.2   7.4  167   28-223    10-183 (203)
 94 cd00945 Aldolase_Class_I Class  74.8     8.1 0.00021   20.2  10.6  129   22-166    11-154 (201)
 95 KOG2335 consensus               74.6     1.8 4.7E-05   24.7   1.7   21  147-167   218-239 (358)
 96 COG1809 (2R)-phospho-3-sulfola  74.1     8.4 0.00022   20.1   8.0   82   76-166    25-115 (258)
 97 cd00860 ThrRS_anticodon ThrRS   73.6     8.7 0.00022   20.0   6.1   55   92-158     1-55  (91)
 98 COG2044 Predicted peroxiredoxi  72.5     9.1 0.00023   19.9   4.9   59   17-89     55-113 (120)
 99 PRK07028 bifunctional hexulose  72.4     9.3 0.00024   19.8   7.9  176   22-227    11-194 (429)
100 PRK07565 dihydroorotate dehydr  72.3     4.1 0.00011   22.2   3.1  150   72-229   105-274 (333)
101 cd04739 DHOD_like Dihydroorota  72.3     4.2 0.00011   22.2   3.1  151   71-229   102-272 (325)
102 PRK13118 consensus              72.0     9.4 0.00024   19.8  18.2  208   22-253    26-267 (269)
103 TIGR03128 RuMP_HxlA 3-hexulose  71.9     9.5 0.00024   19.8   8.7  101  117-227    88-190 (206)
104 PRK09989 hypothetical protein;  71.3     9.7 0.00025   19.7   6.8   50    2-65      1-50  (258)
105 PRK13307 bifunctional formalde  71.2     9.8 0.00025   19.6   9.1  159   83-256   216-388 (392)
106 cd01948 EAL EAL domain. This d  70.1      10 0.00026   19.5   5.2  160   24-214    44-222 (240)
107 PRK09545 znuA high-affinity zi  70.1     9.9 0.00025   19.6   4.6   11   52-62     61-71  (308)
108 TIGR02402 trehalose_TreZ malto  69.7     5.8 0.00015   21.2   3.4   43  147-196   127-186 (564)
109 TIGR03217 4OH_2_O_val_ald 4-hy  69.7      11 0.00027   19.4   7.1  122   25-160    25-162 (333)
110 COG0119 LeuA Isopropylmalate/h  69.7     8.8 0.00022   20.0   4.3   52  108-160   169-222 (409)
111 PRK00115 hemE uroporphyrinogen  68.8      11 0.00028   19.3   8.0   92  119-215   226-343 (347)
112 PRK12655 fructose-6-phosphate   68.3      11 0.00029   19.2  15.7  197   23-248     7-213 (220)
113 PRK13121 consensus              68.2      11 0.00029   19.2  19.5  206   21-250    25-263 (265)
114 cd04733 OYE_like_2_FMN Old yel  67.8      12 0.00029   19.2  11.9   76  147-222   155-255 (338)
115 COG0441 ThrS Threonyl-tRNA syn  67.3      12  0.0003   19.1   4.5   47   81-139   467-522 (589)
116 PRK08318 dihydropyrimidine deh  67.0     6.8 0.00017   20.8   3.3  133   27-160    28-199 (413)
117 PRK13305 sgbH 3-keto-L-gulonat  67.0      12  0.0003   19.1  10.5  123  115-249    90-214 (220)
118 PRK08508 biotin synthase; Prov  66.9      12 0.00031   19.1   8.4  142   74-226    33-189 (279)
119 PRK08444 hypothetical protein;  66.4      12 0.00031   19.0   5.6  128   81-221    83-234 (353)
120 PRK13113 consensus              66.3      12 0.00031   19.0  18.2  204   22-252    26-262 (263)
121 COG0502 BioB Biotin synthase a  66.3      12 0.00031   19.0   4.5  184   26-224    89-295 (335)
122 PRK13957 indole-3-glycerol-pho  66.1      12 0.00032   18.9   5.0   40   25-64     62-101 (247)
123 PRK09427 bifunctional indole-3  65.9      12 0.00032   18.9   8.2   66   28-98    269-337 (459)
124 PRK01362 putative translaldola  65.9      12 0.00032   18.9  15.7  192   25-248     9-211 (214)
125 CHL00162 thiG thiamin biosynth  65.9      13 0.00032   18.9   7.4  121   20-159    23-163 (267)
126 pfam12617 LdpA_C Iron-Sulfur b  64.8     2.8 7.2E-05   23.4   1.0   21   32-52      2-22  (182)
127 PRK13477 bifunctional pantoate  64.7      13 0.00033   18.8   7.2   37    9-46     33-92  (512)
128 COG2876 AroA 3-deoxy-D-arabino  64.2     7.2 0.00018   20.6   3.0   44  146-191   234-279 (286)
129 PRK13115 consensus              63.9      14 0.00035   18.7  18.5  205   22-253    33-267 (269)
130 PRK12656 fructose-6-phosphate   63.9      14 0.00035   18.7  14.6  196   24-246     8-213 (222)
131 PRK10605 N-ethylmaleimide redu  63.5      14 0.00035   18.6  12.7   18  147-164   165-182 (362)
132 PRK00380 panC pantoate--beta-a  63.0      14 0.00036   18.6   6.5   67   82-158     8-89  (283)
133 pfam00215 OMPdecase Orotidine   62.6      14 0.00036   18.5   5.0   39  122-162    42-86  (218)
134 PRK09195 gatY tagatose-bisphos  62.1      15 0.00037   18.5  10.6  182   28-226    33-235 (284)
135 COG1902 NemA NADH:flavin oxido  62.0      15 0.00037   18.4   7.0   36  195-231   291-326 (363)
136 TIGR01326 OAH_OAS_sulfhy O-ace  61.8     7.7  0.0002   20.4   2.8   65  120-195   110-177 (434)
137 COG2069 CdhD CO dehydrogenase/  61.6      10 0.00027   19.5   3.4   84   15-98    141-231 (403)
138 cd00859 HisRS_anticodon HisRS   61.1      15 0.00039   18.3   4.7   47  115-161    12-58  (91)
139 cd04726 KGPDC_HPS 3-Keto-L-gul  61.1      15 0.00039   18.3   7.5   20   30-49     70-89  (202)
140 cd00465 URO-D_CIMS_like The UR  60.7      15 0.00039   18.3   9.4   92  119-215   187-305 (306)
141 PRK11026 ftsX cell division pr  59.5      16 0.00041   18.2   6.1  105  120-229    55-170 (309)
142 pfam02569 Pantoate_ligase Pant  59.4      16 0.00041   18.2   7.1   65   82-158     9-90  (280)
143 PRK12737 gatY tagatose-bisphos  59.4      16 0.00041   18.1  10.1  183   27-226    32-235 (284)
144 COG0296 GlgB 1,4-alpha-glucan   58.9      14 0.00037   18.5   3.7  110   86-206   108-250 (628)
145 TIGR01163 rpe ribulose-phospha  58.0      17 0.00044   18.0  11.9  126   25-165    69-199 (216)
146 COG0284 PyrF Orotidine-5'-phos  57.7      15 0.00039   18.4   3.7   72   79-164    22-99  (240)
147 pfam00290 Trp_syntA Tryptophan  57.7      17 0.00044   17.9  20.1  200   21-248    17-255 (258)
148 pfam03129 HGTP_anticodon Antic  57.1      18 0.00045   17.9   5.9   56   94-159     1-56  (93)
149 cd01017 AdcA Metal binding pro  57.0      18 0.00045   17.9   4.8   44  117-161   206-250 (282)
150 pfam04055 Radical_SAM Radical   57.0      18 0.00045   17.9   7.4   82  129-210    74-158 (165)
151 TIGR02295 HpaD 3,4-dihydroxyph  56.8     4.6 0.00012   21.9   0.9   11  156-166   265-275 (312)
152 COG0036 Rpe Pentose-5-phosphat  56.6      18 0.00046   17.8  13.9  197   25-247    17-218 (220)
153 cd01966 Nitrogenase_NifN_1 Nit  56.3      18 0.00046   17.8  10.1  197   25-247   172-414 (417)
154 PRK04101 fosfomycin resistance  56.2      18 0.00047   17.8   3.9   63   91-168    43-124 (139)
155 cd02940 DHPD_FMN Dihydropyrimi  56.2      12  0.0003   19.1   2.9   81   80-160   112-199 (299)
156 PRK08208 coproporphyrinogen II  56.0      18 0.00047   17.8   6.0  104   53-162   112-235 (436)
157 TIGR02660 nifV_homocitr homoci  55.9      18 0.00047   17.8   4.6  102   98-206    93-201 (369)
158 pfam03102 NeuB NeuB family. Ne  55.5      19 0.00048   17.7   3.9   16   31-46      3-18  (240)
159 cd04730 NPD_like 2-Nitropropan  55.1      19 0.00048   17.7   9.2  178   28-242    17-203 (236)
160 KOG0636 consensus               54.9     4.9 0.00012   21.8   0.8  127    4-138   253-396 (466)
161 COG0635 HemN Coproporphyrinoge  53.4      20 0.00051   17.5   6.1  108   52-162   101-225 (416)
162 cd03307 Mta_CmuA_like MtaA_Cmu  52.7      21 0.00053   17.4   8.3   92  120-214   213-324 (326)
163 cd02070 corrinoid_protein_B12-  52.3      21 0.00053   17.4   6.5   65   79-157   121-187 (201)
164 PRK08673 3-deoxy-7-phosphohept  52.1      16  0.0004   18.3   3.0  131   81-221   107-261 (335)
165 PRK02991 D-serine dehydratase;  52.1      21 0.00054   17.3   5.8   74  129-203   180-272 (443)
166 PRK00043 thiE thiamine-phospha  51.6      22 0.00055   17.3  13.2  187   23-250    19-210 (210)
167 cd00560 PanC PanC  Pantoate-be  51.5      22 0.00055   17.3   6.8   14  145-158    77-90  (276)
168 cd01019 ZnuA Zinc binding prot  51.3      22 0.00055   17.3   7.3   45  117-162   214-259 (286)
169 COG0766 MurA UDP-N-acetylgluco  50.9      18 0.00045   17.9   3.1  113   37-167   177-303 (421)
170 cd04724 Tryptophan_synthase_al  49.8      23 0.00058   17.1  20.5  200   22-246     9-238 (242)
171 COG0326 HtpG Molecular chapero  49.5      15 0.00038   18.4   2.5   39   39-79    172-210 (623)
172 cd06447 D-Ser-dehyd D-Serine d  49.5      23 0.00059   17.1   6.0   74  129-203   155-247 (404)
173 cd00738 HGTP_anticodon HGTP an  49.4      23 0.00059   17.1   6.4   58   92-158     1-58  (94)
174 PRK06267 hypothetical protein;  49.0      24  0.0006   17.0   5.4   45  180-225   153-204 (324)
175 pfam02638 DUF187 Uncharacteriz  48.3      20 0.00052   17.5   3.1   17   30-46    113-129 (394)
176 PRK12595 bifunctional 3-deoxy-  48.3      19  0.0005   17.6   3.0   26  147-173   308-335 (360)
177 smart00729 Elp3 Elongator prot  47.3      25 0.00064   16.9   6.5   81   80-161    99-187 (216)
178 PRK08599 coproporphyrinogen II  47.2      25 0.00064   16.8   6.6  106   52-163    65-189 (377)
179 cd00443 ADA_AMPD Adenosine/AMP  46.3      26 0.00066   16.8   4.6  113  104-228    71-200 (305)
180 COG1649 Uncharacterized protei  46.2      26 0.00066   16.7   4.2  125  106-243    52-199 (418)
181 PRK09776 putative sensor prote  46.2      26 0.00066   16.7   7.2   26  204-231  1023-1048(1116)
182 TIGR01307 pgm_bpd_ind 2,3-bisp  45.9      26 0.00066   16.7   3.3   40  161-201   416-455 (529)
183 PRK13122 consensus              45.9      26 0.00067   16.7  17.7  200   23-251    12-241 (242)
184 cd00717 URO-D Uroporphyrinogen  45.7      26 0.00067   16.7   8.9   93  118-214   215-333 (335)
185 TIGR00418 thrS threonyl-tRNA s  45.6      26 0.00067   16.7   4.1   37   89-136   493-529 (595)
186 PRK09196 fructose-1,6-bisphosp  45.2      27 0.00068   16.6   7.1  192   28-226    33-280 (347)
187 TIGR01325 O_suc_HS_sulf O-succ  45.2      27 0.00068   16.6   3.6   61  125-196   112-172 (386)
188 pfam01729 QRPTase_C Quinolinat  45.1      27 0.00068   16.6   9.5   85  121-224    67-156 (169)
189 pfam05913 DUF871 Bacterial pro  44.8      27 0.00069   16.6   4.8   78   73-163   111-197 (357)
190 PRK13397 3-deoxy-7-phosphohept  44.0      28 0.00071   16.5   3.4   53  100-160    52-104 (250)
191 PRK09249 coproporphyrinogen II  43.6      28 0.00072   16.5   5.3  112   52-167   118-244 (456)
192 COG0434 SgcQ Predicted TIM-bar  43.3      29 0.00073   16.4   6.9  186   20-227    26-236 (263)
193 PRK13813 orotidine 5'-phosphat  43.3      29 0.00073   16.4   4.5   68   80-162    15-88  (215)
194 cd00956 Transaldolase_FSA Tran  43.1      29 0.00073   16.4  10.2  188   25-244     8-207 (211)
195 COG2089 SpsE Sialic acid synth  42.7      29 0.00074   16.4   4.5   16   30-45     36-51  (347)
196 pfam00697 PRAI N-(5'phosphorib  42.7      29 0.00074   16.4   7.1  163   27-223     9-176 (195)
197 PRK13396 3-deoxy-7-phosphohept  42.5      28 0.00071   16.5   3.1  110   81-199   115-245 (352)
198 PRK13347 coproporphyrinogen II  42.4      29 0.00075   16.4   6.6  103   53-161   118-239 (453)
199 PRK11170 nagA N-acetylglucosam  42.4      29 0.00075   16.4   5.6   61   79-158   151-214 (381)
200 PRK12457 2-dehydro-3-deoxyphos  42.2      22 0.00055   17.3   2.5   25  147-172   223-249 (281)
201 PRK05198 2-dehydro-3-deoxyphos  42.1      26 0.00066   16.8   2.8   46  182-229   140-189 (264)
202 PRK11359 cAMP phosphodiesteras  41.7      30 0.00077   16.3   7.2   44  117-161   677-720 (799)
203 COG0167 PyrD Dihydroorotate de  41.7      23 0.00058   17.2   2.5  142   22-167   107-276 (310)
204 pfam06506 PrpR_N Propionate ca  41.6      30 0.00077   16.3   3.8  125   22-166    17-153 (169)
205 COG2022 ThiG Uncharacterized e  41.5      30 0.00077   16.3   5.2   29   20-48     23-51  (262)
206 PRK11059 regulatory protein Cs  41.1      31 0.00078   16.2   6.8   82  114-200   531-612 (642)
207 cd06061 PurM-like1 AIR synthas  41.0      31 0.00079   16.2   7.3   11  194-204   208-218 (298)
208 PRK01060 endonuclease IV; Prov  40.7      31  0.0008   16.2   8.2  172   25-250    13-209 (281)
209 PRK06806 fructose-bisphosphate  40.5      31  0.0008   16.2  10.2  192   26-242    31-244 (281)
210 TIGR02109 PQQ_syn_pqqE coenzym  40.5      20 0.00051   17.5   2.1   42  122-165   136-184 (363)
211 TIGR01361 DAHP_synth_Bsub phos  40.4      26 0.00067   16.7   2.7   21   28-48    214-236 (262)
212 PRK08493 NADH dehydrogenase su  40.3      29 0.00074   16.4   2.9   31   20-50    382-413 (819)
213 PRK13398 3-deoxy-7-phosphohept  40.1      32 0.00081   16.1   3.1   17  149-165   219-237 (266)
214 pfam00563 EAL EAL domain. This  39.9      32 0.00082   16.1   8.2  121   72-209    88-216 (233)
215 TIGR03569 NeuB_NnaB N-acetylne  39.6      32 0.00083   16.1   3.6   32   15-46      7-38  (329)
216 cd04737 LOX_like_FMN L-Lactate  39.5      23  0.0006   17.0   2.3  101  146-257   234-338 (351)
217 cd04743 NPD_PKS 2-Nitropropane  39.4      33 0.00083   16.0   8.6  111   28-167    18-143 (320)
218 PRK11197 lldD L-lactate dehydr  39.2      19 0.00048   17.7   1.8   98  146-257   258-362 (381)
219 TIGR02173 cyt_kin_arch cytidyl  39.2      22 0.00057   17.2   2.2   34  185-219    17-59  (173)
220 PRK07259 dihydroorotate dehydr  38.9      33 0.00085   16.0  13.0   88   71-160    94-188 (301)
221 TIGR00018 panC pantoate--beta-  38.7      33 0.00083   16.1   2.9   53   93-158    25-93  (310)
222 PRK07379 coproporphyrinogen II  38.7      33 0.00085   16.0   6.7  109   51-163    79-204 (399)
223 cd01018 ZntC Metal binding pro  38.6      34 0.00086   16.0   4.7   36   51-93     40-76  (266)
224 PRK06582 coproporphyrinogen II  38.2      34 0.00087   15.9   6.3   18   83-100   182-199 (390)
225 PRK03363 fixB putative electro  38.2      34 0.00087   15.9   3.1   40   30-69     41-80  (313)
226 PRK05628 coproporphyrinogen II  38.0      34 0.00087   15.9   6.4  105   53-163    74-197 (376)
227 COG2200 Rtn c-di-GMP phosphodi  37.6      35 0.00089   15.9   7.0  169   13-208    37-221 (256)
228 COG0414 PanC Panthothenate syn  37.4      16  0.0004   18.2   1.2  103   10-140    36-176 (285)
229 PRK12857 putative aldolase; Re  37.0      35  0.0009   15.8  10.0  183   27-226    32-235 (284)
230 pfam03009 GDPD Glycerophosphor  37.0      35  0.0009   15.8   3.3   34   16-49      2-37  (238)
231 PRK05904 coproporphyrinogen II  36.1      37 0.00094   15.7   6.3   92   70-165    89-194 (353)
232 PRK10060 RNase II stability mo  36.1      37 0.00094   15.7   6.9   46  186-233   547-593 (663)
233 cd03413 CbiK_C Anaerobic cobal  35.9      36 0.00092   15.8   2.8   61   73-138    36-99  (103)
234 TIGR01173 glmU UDP-N-acetylglu  35.8      22 0.00056   17.2   1.7   60  139-209   163-231 (461)
235 pfam01903 CbiX CbiX. The funct  35.8      37 0.00094   15.7   7.5   49   22-71     36-86  (106)
236 KOG2463 consensus               35.8      12 0.00029   19.2   0.2   22  220-241   341-362 (376)
237 PRK06801 hypothetical protein;  35.5      37 0.00095   15.6  10.6  184   26-226    31-236 (286)
238 pfam01373 Glyco_hydro_14 Glyco  35.4      38 0.00096   15.6   3.3   24   98-121   216-239 (399)
239 TIGR01072 murA UDP-N-acetylglu  35.0      16  0.0004   18.3   0.8   91   74-167   209-314 (443)
240 COG2222 AgaS Predicted phospho  34.5      37 0.00093   15.7   2.6   37   14-50     91-127 (340)
241 PRK08446 coproporphyrinogen II  34.1      39   0.001   15.5   5.8  105   54-162    68-187 (351)
242 cd00861 ProRS_anticodon_short   34.0      39   0.001   15.5   4.4   56   92-156     1-56  (94)
243 PRK13119 consensus              34.0      39   0.001   15.5  17.8  202   21-249    23-259 (261)
244 PRK08574 cystathionine gamma-s  34.0      40   0.001   15.5   3.7   15  127-142   112-126 (384)
245 pfam08915 tRNA-Thr_ED Archaea-  33.9      40   0.001   15.5   4.5   49  147-197    63-111 (137)
246 PRK08610 fructose-bisphosphate  33.7      40   0.001   15.4   7.9  139   71-226    80-236 (286)
247 TIGR02491 NrdG anaerobic ribon  33.4      20  0.0005   17.6   1.1   20  192-211    66-85  (158)
248 PRK09454 ugpQ cytoplasmic glyc  33.4      40   0.001   15.4   3.5   34   16-49     14-49  (249)
249 PRK09939 putative oxidoreducta  33.4      36 0.00091   15.8   2.4   77   13-89    213-296 (759)
250 PRK12653 fructose-6-phosphate   33.0      41   0.001   15.4  14.2  195   24-245     8-210 (220)
251 PRK09456 phosphatase; Provisio  31.8      35 0.00088   15.9   2.2   41  116-159   143-183 (199)
252 PRK07998 gatY putative fructos  31.7      43  0.0011   15.2   7.7  194   27-243    32-244 (283)
253 pfam06713 DUF1200 Protein of u  31.3      20 0.00052   17.5   0.9   34  150-183    38-71  (74)
254 PTZ00272 heat shock protein 83  31.3      40   0.001   15.4   2.4   21  121-141   477-497 (701)
255 pfam10188 Oscp1 Organic solute  31.2      44  0.0011   15.2   3.1   31  110-140   132-162 (173)
256 PRK02615 thiamine-phosphate py  31.1      44  0.0011   15.2  10.3  186   22-249   153-343 (345)
257 PRK00748 1-(5-phosphoribosyl)-  31.0      44  0.0011   15.2  11.2  112   24-141    29-168 (241)
258 PRK07896 nicotinate-nucleotide  30.9      44  0.0011   15.1   8.2   88  119-223   184-273 (288)
259 pfam01053 Cys_Met_Meta_PP Cys/  30.9      43  0.0011   15.2   2.5   11  129-140   114-124 (381)
260 PRK00143 trmU tRNA (5-methylam  30.8      25 0.00064   16.8   1.3   21  146-168   110-130 (355)
261 PRK12325 prolyl-tRNA synthetas  30.6      45  0.0011   15.1   6.4   13   51-63     73-85  (438)
262 PRK06460 hypothetical protein;  30.2      45  0.0012   15.1   2.9   16  150-165   177-192 (375)
263 PRK09250 fructose-bisphosphate  29.9      32  0.0008   16.2   1.7   45  116-160   177-236 (348)
264 COG0224 AtpG F0F1-type ATP syn  29.9      46  0.0012   15.0   3.7   61  104-167    77-140 (287)
265 PRK07709 fructose-bisphosphate  29.7      46  0.0012   15.0   7.2  139   71-226    80-236 (285)
266 TIGR01919 hisA-trpF bifunction  29.3      47  0.0012   15.0   3.2   49  111-162    58-107 (246)
267 cd00862 ProRS_anticodon_zinc P  29.1      47  0.0012   14.9   3.9   24   70-101    67-90  (202)
268 pfam00145 DNA_methylase C-5 cy  29.1      47  0.0012   14.9   3.1   49   80-138    90-140 (319)
269 PRK08949 consensus              29.0      47  0.0012   14.9   5.7  106   53-162    73-195 (378)
270 cd01998 tRNA_Me_trans tRNA met  29.0      29 0.00074   16.4   1.4  101   28-168    14-125 (349)
271 PRK12376 putative translaldola  28.9      48  0.0012   14.9  10.0  186   22-230    13-208 (238)
272 KOG0134 consensus               28.9      48  0.0012   14.9   2.8   16   29-44    179-194 (400)
273 KOG0103 consensus               28.8      44  0.0011   15.1   2.3   57   56-113   269-345 (727)
274 TIGR00657 asp_kinases aspartat  28.7      31  0.0008   16.2   1.5   83   83-166   139-247 (504)
275 COG0648 Nfo Endonuclease IV [D  28.3      49  0.0012   14.8   8.7   66  147-217    93-167 (280)
276 PRK08247 cystathionine gamma-s  28.0      49  0.0013   14.8   3.4   58  127-195   111-168 (366)
277 PRK00278 trpC indole-3-glycero  27.8      50  0.0013   14.8   5.9  175   23-228    69-245 (261)
278 KOG4222 consensus               27.7      11 0.00027   19.4  -1.0  119   31-162   116-247 (1281)
279 PRK12738 kbaY tagatose-bisphos  27.6      50  0.0013   14.8   7.5  185   25-226    30-235 (286)
280 PRK13112 consensus              27.6      50  0.0013   14.8  19.8  207   22-255    27-275 (279)
281 TIGR01302 IMP_dehydrog inosine  27.5      50  0.0013   14.8   2.6   86  116-206   263-355 (476)
282 COG5093 Uncharacterized conser  27.5      24 0.00062   16.9   0.8   41  178-220   127-167 (185)
283 PRK10658 alpha-xylosidase YicI  27.4      47  0.0012   15.0   2.2   38  108-146   317-354 (772)
284 TIGR02712 urea_carbox urea car  27.2      51  0.0013   14.7   3.3  128   27-199    14-160 (1226)
285 TIGR02104 pulA_typeI pullulana  27.0      50  0.0013   14.8   2.3   12  185-196   254-265 (655)
286 cd01965 Nitrogenase_MoFe_beta_  26.7      52  0.0013   14.7  13.5  213   24-247   169-425 (428)
287 PRK08202 purine nucleoside pho  26.4      51  0.0013   14.7   2.2   96  138-249   160-268 (272)
288 PRK09124 pyruvate dehydrogenas  26.3      29 0.00074   16.4   1.0   90  117-207   188-281 (574)
289 cd06594 GH31_glucosidase_YihQ   26.2      53  0.0014   14.6   4.9   65   78-142    20-95  (317)
290 COG1242 Predicted Fe-S oxidore  26.0      51  0.0013   14.7   2.2  115   32-173   109-236 (312)
291 PRK06702 O-acetylhomoserine am  25.9      54  0.0014   14.6   3.0   70   86-165   140-209 (432)
292 PRK00230 orotidine 5'-phosphat  25.9      54  0.0014   14.6   5.8   73   76-162    10-88  (231)
293 PRK09303 adaptive-response sen  25.8      54  0.0014   14.6   4.6   94   40-139    14-111 (378)
294 TIGR02370 pyl_corrinoid methyl  25.7      54  0.0014   14.5   3.9   67   79-157   125-193 (201)
295 PRK10624 L-1,2-propanediol oxi  25.7      54  0.0014   14.5   4.3   15  155-169   197-211 (381)
296 PRK07114 keto-hydroxyglutarate  25.4      55  0.0014   14.5  13.9  193   19-251    23-222 (223)
297 pfam06787 UPF0254 Uncharacteri  25.2      55  0.0014   14.5   4.1  106  131-247    43-160 (160)
298 PRK08661 prolyl-tRNA synthetas  24.9      56  0.0014   14.4   4.4   42   88-136   284-325 (478)
299 cd07376 PLPDE_III_DSD_D-TA_lik  24.9      56  0.0014   14.4   4.5  195    8-235     5-230 (345)
300 KOG0207 consensus               24.9      56  0.0014   14.4   5.0   71  119-204   727-797 (951)
301 pfam09176 Mpt_N Methylene-tetr  24.6      57  0.0014   14.4   3.4   32  109-141    50-81  (81)
302 cd02071 MM_CoA_mut_B12_BD meth  24.5      57  0.0014   14.4   6.8   72   80-164    39-111 (122)
303 cd01988 Na_H_Antiporter_C The   24.5      57  0.0015   14.4   5.2   49  113-161    51-101 (132)
304 PRK10517 magnesium-transportin  24.5      57  0.0015   14.4   3.5   50  117-167   550-599 (900)
305 PRK05742 nicotinate-nucleotide  24.3      57  0.0015   14.4   8.3   87  120-224   176-262 (277)
306 TIGR03457 sulphoacet_xsc sulfo  24.1      25 0.00065   16.8   0.3   37   53-91    182-224 (579)
307 TIGR03586 PseI pseudaminic aci  24.1      58  0.0015   14.3   5.0   27   20-46     13-39  (327)
308 TIGR00839 aspA aspartate ammon  24.1      48  0.0012   14.9   1.7  131   77-221   103-252 (469)
309 TIGR01344 malate_syn_A malate   24.0      39 0.00099   15.5   1.3   46   82-145   241-286 (522)
310 PRK09240 thiH thiamine biosynt  23.9      58  0.0015   14.3   5.2   60  106-168   128-187 (371)
311 TIGR01425 SRP54_euk signal rec  23.8      37 0.00095   15.7   1.1  109   78-200   220-338 (453)
312 cd02419 Peptidase_C39C A sub-f  23.6      24 0.00062   16.9   0.2   46  182-230    46-91  (127)
313 TIGR01212 TIGR01212 radical SA  23.5      59  0.0015   14.3   2.3  124   33-185   106-245 (307)
314 PRK08564 5'-methylthioadenosin  23.5      59  0.0015   14.3   2.3   97  138-251   137-248 (267)
315 PRK08385 nicotinate-nucleotide  23.3      60  0.0015   14.2   8.3  127   81-226   109-263 (279)
316 PRK01122 potassium-transportin  23.3      60  0.0015   14.2   3.5   58  117-183   452-509 (684)
317 PRK00507 deoxyribose-phosphate  23.3      60  0.0015   14.2   5.1  168   22-213    20-200 (221)
318 PRK10076 pyruvate formate lyas  23.2      60  0.0015   14.2   2.5   18  116-133    52-69  (213)
319 cd03415 CbiX_CbiC Archaeal sir  23.1      60  0.0015   14.2   3.3   23   23-45     43-65  (125)
320 pfam00218 IGPS Indole-3-glycer  23.1      60  0.0015   14.2   5.7  176   23-228    67-243 (254)
321 cd01137 PsaA Metal binding pro  22.6      62  0.0016   14.1   8.4   41  117-158   212-253 (287)
322 COG1533 SplB DNA repair photol  22.5      62  0.0016   14.1   4.2   48  118-165   169-223 (297)
323 PRK05660 coproporphyrinogen II  22.3      62  0.0016   14.1   6.6  105   52-162    72-195 (378)
324 PRK13586 1-(5-phosphoribosyl)-  22.0      63  0.0016   14.1  11.4  118   17-142    22-169 (231)
325 KOG0780 consensus               22.0      47  0.0012   15.0   1.3   30   73-102   195-224 (483)
326 PRK13135 consensus              21.9      64  0.0016   14.0  19.1  204   22-250    26-262 (267)
327 COG4882 Predicted aminopeptida  21.9      64  0.0016   14.0   2.0   39   20-58     98-136 (486)
328 PRK08133 O-succinylhomoserine   21.6      58  0.0015   14.3   1.8   74   82-165   135-208 (391)
329 COG0191 Fba Fructose/tagatose   21.5      65  0.0017   14.0   7.5  104  113-225   111-236 (286)
330 PRK00962 hypothetical protein;  21.3      65  0.0017   14.0   4.4  128  104-250    28-163 (164)
331 COG1454 EutG Alcohol dehydroge  21.3      65  0.0017   14.0   4.7   57  187-249   262-331 (377)
332 PRK06756 flavodoxin; Provision  21.3      65  0.0017   14.0   3.0   74   81-157    57-133 (138)
333 TIGR00642 mmCoA_mut_beta methy  21.0      42  0.0011   15.3   1.0  163   25-211   104-284 (642)
334 TIGR02050 gshA_cyan_rel unchar  20.8      67  0.0017   13.9   3.4   80  108-199    13-92  (297)
335 pfam04481 DUF561 Protein of un  20.6      68  0.0017   13.9   6.1  102  147-250   135-241 (243)
336 cd00959 DeoC 2-deoxyribose-5-p  20.4      68  0.0017   13.8   5.1  168   22-212    15-194 (203)
337 PRK05692 hydroxymethylglutaryl  20.4      68  0.0017   13.8  15.0  171   25-207    27-217 (287)
338 PRK09358 adenosine deaminase;   20.3      68  0.0017   13.8   5.8  109  105-226   102-222 (333)
339 pfam04748 Polysacc_deac_2 Dive  20.2      69  0.0018   13.8   7.5  169   22-223    30-204 (213)
340 cd03332 LMO_FMN L-Lactate 2-mo  20.1      69  0.0018   13.8   2.3  102  146-257   266-370 (383)

No 1  
>PRK05265 pyridoxine 5'-phosphate synthase; Provisional
Probab=100.00  E-value=0  Score=735.89  Aligned_cols=240  Identities=39%  Similarity=0.592  Sum_probs=231.6

Q ss_pred             CCCCCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCC
Q ss_conf             98453322144322322078868998999999997499899982478833488899999887400013674158883485
Q gi|254780438|r    1 MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPN   80 (261)
Q Consensus         1 M~t~LsVNidhiAtLRnaRg~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~   80 (261)
                      |||+||||||||||||||||+++|||++||.+|+++||||||||||||||||||+||++|++++     ++||||||+|+
T Consensus         1 ~m~~LsVNid~iAtLRnaRg~~~Pd~~~~a~~~~~~Ga~gITvH~R~DrRHI~~~Dv~~l~~~~-----~~~lNiE~apt   75 (240)
T PRK05265          1 MMIRLGVNIDHIATLRNARGTNYPDPVRAALIAEEAGADGITVHLREDRRHIRDRDVRRLRETL-----KTRLNLEMAAT   75 (240)
T ss_pred             CCCEEEECHHHEEHHHHCCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHC-----CCCEEEECCCC
T ss_conf             9856732332200234148999999999999999839985895268863446625699999864-----86368711881


Q ss_pred             HHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEE
Q ss_conf             68999998507212897101655533357822133378899999862026963899725444414799997406614651
Q gi|254780438|r   81 ETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIEL  160 (261)
Q Consensus        81 ~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VEl  160 (261)
                      ++|+++|+++||+|||||||+|+|+|||||||+.++.++|+++++.|+++|||||||||||++|  +++|+++|+|+|||
T Consensus        76 ~e~i~ia~~~kP~qvtLVPe~r~e~TTegGld~~~~~~~L~~~i~~lk~~gIrvSLFiDPd~~~--i~~a~~~Gad~VEl  153 (240)
T PRK05265         76 EEMLDIALEIKPHQVTLVPEKREELTTEGGLDVAGQFDKLKPAIARLKDAGIRVSLFIDPDPEQ--IEAAAEVGADRIEL  153 (240)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHH--HHHHHHHCCCEEEE
T ss_conf             8899999984998599888998862678893776578999999999986598179972798789--99999849399998


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             12111024443564336668899987665415623520789898779999973699638842599999999940999999
Q gi|254780438|r  161 YTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF  240 (261)
Q Consensus       161 hTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~  240 (261)
                      |||+||+++.++. ...++++|+.+|++|+++||+|||||||||+|++. +++||+|+||||||||||||||+||++||+
T Consensus       154 hTG~Ya~a~~~~~-~~~el~~i~~aa~~A~~lGL~VnAGHgLn~~Nl~~-i~~ip~i~EvsIGHaiI~eAl~~Gl~~aV~  231 (240)
T PRK05265        154 HTGPYADAKTEAE-QAAELERIAEAAALAASLGLGVNAGHGLNYHNVKP-IAAIPGIEELNIGHAIIARALFVGLEEAVR  231 (240)
T ss_pred             ECHHHHHHCCCCH-HHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHHHH-HHCCCCCEEEECCHHHHHHHHHHHHHHHHH
T ss_conf             3478786357521-99999999999999998698785378988777899-844899748845799999999974999999


Q ss_pred             HHHHHHHHH
Q ss_conf             999999741
Q gi|254780438|r  241 CFRRACGQH  249 (261)
Q Consensus       241 ~~~~ii~~~  249 (261)
                      +|+++|++.
T Consensus       232 ~~~~ii~~~  240 (240)
T PRK05265        232 EMKALMDEA  240 (240)
T ss_pred             HHHHHHHHC
T ss_conf             999999639


No 2  
>pfam03740 PdxJ Pyridoxal phosphate biosynthesis protein PdxJ. Members of this family belong to the PdxJ family that catalyses the condensation of 1-deoxy-d-xylulose-5-phosphate (DXP) and 1-amino-3-oxo-4-(phosphohydroxy)propan-2-one to form pyridoxine 5'-phosphate (PNP). This reaction is involved in de novo synthesis of pyridoxine (vitamin B6) and pyridoxal phosphate.
Probab=100.00  E-value=0  Score=715.67  Aligned_cols=238  Identities=39%  Similarity=0.643  Sum_probs=228.2

Q ss_pred             CCCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHH
Q ss_conf             45332214432232207886899899999999749989998247883348889999988740001367415888348568
Q gi|254780438|r    3 TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNET   82 (261)
Q Consensus         3 t~LsVNidhiAtLRnaRg~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e   82 (261)
                      +|||||||||||||||||+++|||++||.+|+++||||||||||||||||||+||+.|++++     ++||||||+|+++
T Consensus         1 mrL~VNidhiAtLRnaRg~~~Pd~~~aa~~~~~~GadgITvHlReDrRHI~d~Dv~~l~~~~-----~~~lNlE~~~~~e   75 (239)
T pfam03740         1 MRLGVNIDHIATLRNARGTPYPDPVEAALIAERAGADGITVHLREDRRHIQDRDVEVLKELI-----RTRFNIEMAPTEE   75 (239)
T ss_pred             CEEEEEECCEEEHHHCCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHC-----CCCEEECCCCHHH
T ss_conf             93226301021012058999989999999999839986895258876545237899999972-----8746775687499


Q ss_pred             HHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECC
Q ss_conf             99999850721289710165553335782213337889999986202696389972544441479999740661465112
Q gi|254780438|r   83 FLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYT  162 (261)
Q Consensus        83 ~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhT  162 (261)
                      |+++|+++||+|||||||+|+|+|||||||+.++.++|++++++|+++|||||||||||++|  +++|+++|+|+|||||
T Consensus        76 mi~ia~~~kP~qvtLVPE~r~elTTegGld~~~~~~~L~~~i~~lk~~girvSlFIDpd~~~--i~~a~~~Gad~VElhT  153 (239)
T pfam03740        76 MLELALKTKPHQVTLVPEKREEITTEGGLDVVAQLEKLKPAIRRLKNAGIRVSLFIDPDPEQ--IEAAKIVGADRIELHT  153 (239)
T ss_pred             HHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECCCHHH--HHHHHHCCCCEEEEEC
T ss_conf             99999984998589888999873568880633406899999999860785389970799899--9999980929998504


Q ss_pred             CCCHHHHHHHHHH-HHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHH
Q ss_conf             1110244435643-366688999876654156235207898987799999736996388425999999999409999999
Q gi|254780438|r  163 GPYGACYNNPQQE-RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC  241 (261)
Q Consensus       163 G~Ya~a~~~~~~~-~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~  241 (261)
                      |+||+++...++. ..++++|++++++|+++||+|||||||||+|++.| +++|+|+||||||||||||||+||++||++
T Consensus       154 G~YA~a~~~~~~~~~~~l~~i~~aa~~A~~lGL~VnAGHgLn~~Nl~~l-~~i~~i~EvnIGHaiI~~al~~Gl~~aV~~  232 (239)
T pfam03740       154 GPYADAHNDAEQAREELLERLAAGAALAFDLGLVVNAGHGLTYHNVKPV-AKIPPIAELNIGHSLVAEALFVGLAKAVLE  232 (239)
T ss_pred             HHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHHHHH-HCCCCCEEEECCHHHHHHHHHHHHHHHHHH
T ss_conf             7788775131555799999999999999874985746789887669998-528997488556999999999749999999


Q ss_pred             HHHHHHH
Q ss_conf             9999974
Q gi|254780438|r  242 FRRACGQ  248 (261)
Q Consensus       242 ~~~ii~~  248 (261)
                      |+++|++
T Consensus       233 ~~~ii~r  239 (239)
T pfam03740       233 MKALMKR  239 (239)
T ss_pred             HHHHHCC
T ss_conf             9998668


No 3  
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism. In bacteria, formation of pyridoxine 5'-phosphate is a step in the biosynthesis of vitamin B6. PNP synthase, a homooctameric enzyme, catalyzes the final step in PNP biosynthesis, the condensation of 1-amino-acetone 3-phosphate and 1-deoxy-D-xylulose 5-phosphate. PNP synthase adopts a TIM barrel topology, intersubunit contacts are mediated by three ''extra'' helices, generating a tetramer of symmetric dimers with shared active sites; the open state has been proposed to accept substrates and to release products, while most of the catalytic events are likely to occur in the closed state; a hydrophilic channel running through the center of the barrel was identified as the essential structural feature that enables PNP synthase to release water molecules produced during the reaction from the closed,
Probab=100.00  E-value=0  Score=716.01  Aligned_cols=234  Identities=38%  Similarity=0.632  Sum_probs=225.9

Q ss_pred             CCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHH
Q ss_conf             53322144322322078868998999999997499899982478833488899999887400013674158883485689
Q gi|254780438|r    4 SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETF   83 (261)
Q Consensus         4 ~LsVNidhiAtLRnaRg~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~   83 (261)
                      |||||||||||||||||+++|||++||.+|+++|||||||||||||||||++||++|++++     ++||||||+|+++|
T Consensus         1 kL~VNidhiAtlRnaRg~~~Pd~~~~a~~~~~~GadgITvHlR~DrRHI~~~Dv~~l~~~~-----~~~lNlE~a~~~em   75 (234)
T cd00003           1 RLGVNIDHVATLRNARGTNYPDPVEAALLAEKAGADGITVHLREDRRHIQDRDVRLLRELV-----RTELNLEMAPTEEM   75 (234)
T ss_pred             CCCEECCCEEEHHHCCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHC-----CCCEEECCCCCHHH
T ss_conf             9745201010023148999999999999999839985895248876667545799999865-----85546612793899


Q ss_pred             HHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCC
Q ss_conf             99998507212897101655533357822133378899999862026963899725444414799997406614651121
Q gi|254780438|r   84 LNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTG  163 (261)
Q Consensus        84 i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG  163 (261)
                      +++|++++|+|||||||+|+|+|||||||+.+++++|++++++|+++|||||||||||++|  +++|+++|+|+||||||
T Consensus        76 i~ia~~~kP~~vtLVPe~r~elTTegGld~~~~~~~L~~~i~~lk~~~IrvSLFIDPd~~q--i~~a~~~Gad~VElhTG  153 (234)
T cd00003          76 LEIALEVKPHQVTLVPEKREELTTEGGLDVAGQAEKLKPIIERLKDAGIRVSLFIDPDPEQ--IEAAKEVGADRVELHTG  153 (234)
T ss_pred             HHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHH--HHHHHHHCCCEEEEECH
T ss_conf             9999984998789878887864178892665478899999999986598279972798789--99999849399998247


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             11024443564336668899987665415623520789898779999973699638842599999999940999999999
Q gi|254780438|r  164 PYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR  243 (261)
Q Consensus       164 ~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~  243 (261)
                      +||++|...+ ...++++|+.+|++|+++||+|||||||||+|+++| ++||+|+||||||||||||+|+||++||++|+
T Consensus       154 ~Ya~a~~~~~-~~~el~~i~~aa~~A~~lGL~VnAGHgLn~~Nl~~i-~~ip~i~EvnIGHaiI~esl~~Gl~~aV~~~~  231 (234)
T cd00003         154 PYANAYDKAE-REAELERIAKAAKLARELGLGVNAGHGLNYENVKPI-AKIPGIAELNIGHAIISRALFVGLEEAVREMK  231 (234)
T ss_pred             HHHHHCCCHH-HHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHHHHH-HCCCCCEEEECCHHHHHHHHHHHHHHHHHHHH
T ss_conf             8786348103-999999999999999985987854789887679998-55899728855799999999974999999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254780438|r  244 RAC  246 (261)
Q Consensus       244 ~ii  246 (261)
                      ++|
T Consensus       232 ~ii  234 (234)
T cd00003         232 DLI  234 (234)
T ss_pred             HHC
T ss_conf             759


No 4  
>TIGR00559 pdxJ pyridoxal phosphate biosynthetic protein PdxJ; InterPro: IPR004569    Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal). PLP is a versatile catalyst, acting as a coenzyme in a multitude of reactions, including decarboxylation, deamination and transamination , , . PLP-dependent enzymes are primarily involved in the biosynthesis of amino acids and amino acid-derived metabolites, but they are also found in the biosynthetic pathways of amino sugars and in the synthesis or catabolism of neurotransmitters; pyridoxal phosphate can also inhibit DNA polymerases and several steroid receptors . Inadequate levels of pyridoxal phosphate in the brain can cause neurological dysfunction, particularly epilepsy .   PLP enzymes exist in their resting state as a Schiff base, the aldehyde group of PLP forming a linkage with the epsilon-amino group of an active site lysine residue on the enzyme. The alpha-amino group of the substrate displaces the lysine epsilon-amino group, in the process forming a new aldimine with the substrate. This aldimine is the common central intermediate for all PLP-catalyzed reactions, enzymatic and non-enzymatic .   In Escherichia coli, the pdx genes involved in vitamin B6 have been characterised , , . This entry represents PdxJ, which catalyses the condensation of 1-amino-3-oxo-4-(phosphohydroxy)propan-2-one and 1-deoxy-D-xylulose-5-phosphate to form pyridoxine-5'-phosphate. The product of the PdxJ reaction is then oxidized by PdxH to pyridoxal 5'-phosphate.; GO: 0008615 pyridoxine biosynthetic process, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=699.91  Aligned_cols=238  Identities=34%  Similarity=0.578  Sum_probs=228.1

Q ss_pred             CCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHCC-CCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHH
Q ss_conf             5332214432232207886899899999999749-989998247883348889999988740001367415888348568
Q gi|254780438|r    4 SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSG-ASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNET   82 (261)
Q Consensus         4 ~LsVNidhiAtLRnaRg~~~P~~~~~a~~~~~~G-adgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e   82 (261)
                      +||||||||||||||||+.+|||++||.+|+++| ||||||||||||||||++||+.|++++     .+|+||||+|++|
T Consensus         1 rLgvNvdhiaTLR~aR~t~~P~~l~aalia~~~Gkad~ITvHLReDrRHI~~~Dv~~L~~~~-----~~~~NlE~~~~ee   75 (265)
T TIGR00559         1 RLGVNVDHIATLRNARGTYEPDPLEAALIAEQAGKADGITVHLREDRRHIQDRDVLKLKEIL-----TTPINLEMAPTEE   75 (265)
T ss_pred             CCCCCCHHEEEHHHCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCHHHHHHHHHHC-----CCCCCCCCCCHHH
T ss_conf             98743013323224168899748899999876288552233388885458867899999873-----8740111585189


Q ss_pred             HHHHHHHHC--CCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEE
Q ss_conf             999998507--212897101655533357822133378899999862026963899725444414799997406614651
Q gi|254780438|r   83 FLNLCERYK--PEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIEL  160 (261)
Q Consensus        83 ~i~ia~~ik--P~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VEl  160 (261)
                      |++|++++|  |+|||||||+|+|+||||||||.+++++|+.++++++++||+|||||||+.+|  |++|.+.|+|+|||
T Consensus        76 ~~~~~~~~knkP~~vTlVPe~r~evTtegGLDva~~~dkL~~~~~~~~~~GI~vSlFId~~~d~--i~~A~e~g~~~iE~  153 (265)
T TIGR00559        76 MIEIAVEIKNKPEKVTLVPEKRDEVTTEGGLDVARLKDKLKELVKRLHEAGIEVSLFIDADKDQ--ISAAAEVGADRIEI  153 (265)
T ss_pred             HHHHHHHHCCCCCEEEECCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCHHH--HHHHHHCCCCEEEE
T ss_conf             9999998558997387416988603026440001104679999999986798587742544688--89999708984885


Q ss_pred             CCCCCHHHHHH-------------------HHHHHHHHHH----HHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCC-C
Q ss_conf             12111024443-------------------5643366688----9998766541562352078989877999997369-9
Q gi|254780438|r  161 YTGPYGACYNN-------------------PQQERIFLNK----LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIP-Y  216 (261)
Q Consensus       161 hTG~Ya~a~~~-------------------~~~~~~el~~----i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip-~  216 (261)
                      |||+||++|++                   |++.+.||.+    |+++|.+|+++||+|||||||||.||..|++..+ +
T Consensus       154 hTg~YA~~~~~~~~nannqihaisvlkdksP~e~~~el~~aflq~~~as~~A~~~GL~v~AGHgL~y~Nvk~~~~~l~GY  233 (265)
T TIGR00559       154 HTGVYANLYNKLYSNANNQIHAISVLKDKSPKELKEELQRAFLQIKKASVYAKSLGLKVNAGHGLNYHNVKEFAKILEGY  233 (265)
T ss_pred             ECCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHCCCCH
T ss_conf             02246898887741001321223111158868999999899999999999998749868614888778999998617401


Q ss_pred             CEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             63884259999999994099999999999974
Q gi|254780438|r  217 ISEISVGHAFAATALECGVKEAVFCFRRACGQ  248 (261)
Q Consensus       217 I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~~  248 (261)
                      ++||||||||||+|++.||++||++|+++|++
T Consensus       234 l~ElnIGHa~va~Av~~GLe~ai~em~~l~~~  265 (265)
T TIGR00559       234 LDELNIGHAIVAKAVLLGLEEAIREMRDLIKE  265 (265)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             10241138999999997499999999998519


No 5  
>COG0854 PdxJ Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism]
Probab=100.00  E-value=0  Score=657.31  Aligned_cols=240  Identities=39%  Similarity=0.597  Sum_probs=229.8

Q ss_pred             CCCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHH
Q ss_conf             45332214432232207886899899999999749989998247883348889999988740001367415888348568
Q gi|254780438|r    3 TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNET   82 (261)
Q Consensus         3 t~LsVNidhiAtLRnaRg~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e   82 (261)
                      ++|||||||||||||+||..||||+.+|.+|+.+|||||||||||||||||++||..|++++     +++|||||+||+|
T Consensus         1 ~~LgVNidhIAtLRnaR~t~~Pd~v~aa~iA~~aGAdgITvHlReDrRHI~d~Dv~~lr~~~-----~~~~NlE~a~teE   75 (243)
T COG0854           1 MLLGVNIDHIATLRNARGTPYPDPVEAAFIAEQAGADGITVHLREDRRHIQDRDVRILRALI-----DTRFNLEMAPTEE   75 (243)
T ss_pred             CCCEECHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCEEECCCCCCCCCCHHHHHHHHHHC-----CCCEECCCCCHHH
T ss_conf             93100189999999724999998799999999739872371458540215144589999971-----3544004374489


Q ss_pred             HHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECC
Q ss_conf             99999850721289710165553335782213337889999986202696389972544441479999740661465112
Q gi|254780438|r   83 FLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYT  162 (261)
Q Consensus        83 ~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhT  162 (261)
                      |++++++++|+|||||||+|+|+|||||||+.++.++|++++.+|++.|||||||||||++|  |++|+++||++|||||
T Consensus        76 ml~ia~~~kP~~vtLVPe~r~evTTegGlD~~~~~~~l~~~v~~L~~~GirVSLFiD~d~~q--i~aa~~~gA~~IELhT  153 (243)
T COG0854          76 MLAIALKTKPHQVTLVPEKREEVTTEGGLDVAGQLDKLRDAVRRLKNAGIRVSLFIDPDPEQ--IEAAAEVGAPRIELHT  153 (243)
T ss_pred             HHHHHHHCCCCEEEECCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCHHH--HHHHHHHCCCEEEEEC
T ss_conf             99999855987478578964641455563355002469999999985797699972799899--9999984998799843


Q ss_pred             CCCHHHHH--HHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             11102444--3564336668899987665415623520789898779999973699638842599999999940999999
Q gi|254780438|r  163 GPYGACYN--NPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF  240 (261)
Q Consensus       163 G~Ya~a~~--~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~  240 (261)
                      |+||++++  ...+...+|.++..++.+|.++||.|||||||+|.||+++. ++|.|.||||||+||++|+|+||++||+
T Consensus       154 G~Ya~~~~~~~~~~~~~el~rl~~~a~~A~~lGL~VnAGHgLty~Nv~~~a-~~~~i~ElnIGH~iia~Av~~Gl~~aV~  232 (243)
T COG0854         154 GPYADAHDAAEQARADAELERLAKAAKLAAELGLKVNAGHGLTYHNVKPLA-AIPPLAELNIGHSIIARAVFVGLEEAVR  232 (243)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCCCCCCCHHHHH-CCCCCEEECCCHHHHHHHHHHHHHHHHH
T ss_conf             665664786778879999999999999999739457458886503628785-4675103411089999999960799999


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999997410
Q gi|254780438|r  241 CFRRACGQHL  250 (261)
Q Consensus       241 ~~~~ii~~~~  250 (261)
                      +|+++|+..+
T Consensus       233 ~m~~~~~~~~  242 (243)
T COG0854         233 EMKRLMKRAR  242 (243)
T ss_pred             HHHHHHHHCC
T ss_conf             9999987633


No 6  
>pfam05853 DUF849 Prokaryotic protein of unknown function (DUF849). This family consists of several hypothetical prokaryotic proteins with no known function.
Probab=97.13  E-value=0.016  Score=38.89  Aligned_cols=120  Identities=22%  Similarity=0.238  Sum_probs=80.7

Q ss_pred             CHHHHHHHHHHCCCCEEEEECC--CCCCCCCHHHHHH-HHHHHCCCCCCCEEEEEEC-----CCHHHHHHHHHHCCCEEE
Q ss_conf             9899999999749989998247--8833488899999-8874000136741588834-----856899999850721289
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTVHPR--PDQRHIRYTDLPE-IRRLIDEQFPKAELNIEGY-----PNETFLNLCERYKPEQIT   96 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITvH~R--~DrRHI~~~Dv~~-l~~~~~~~~~~~elNiEg~-----p~~e~i~ia~~ikP~qvt   96 (261)
                      .+.+.|..|.++||.-+-+|.|  +|.+|..|-+.|. +-.-+....+++-+|+-..     ..++-+..+...+|+.|+
T Consensus        27 Eia~~A~~c~~AGAsivH~HvRd~~dG~~s~d~~~y~e~i~~Ir~~~pd~ii~~Ttg~~~~~~~eeR~~~v~~~~Pd~aS  106 (274)
T pfam05853        27 EIAEEAVAAAEAGAAIVHLHVRDPEDGRPSQDPELFREVLERIREAVPDVIINLTTGGSPGMTVEERLAPVEALRPEMAS  106 (274)
T ss_pred             HHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHCCCCEEE
T ss_conf             99999999997087389988447888990688999999999999878996899457877889888999999860988577


Q ss_pred             EEECCCCCCCCCCCCC-----HHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHH
Q ss_conf             7101655533357822-----1333788999998620269638997254444147999974
Q gi|254780438|r   97 LVPDDPHQLTSDHGWD-----FLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKL  152 (261)
Q Consensus        97 LVPe~r~elTTegGld-----v~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~  152 (261)
                      |=+-     |...++-     .......+..+...+++.||++.+=+. |+.  .+..+..
T Consensus       107 l~~g-----s~nf~~~~~d~v~~n~~~~~~~~~~~~~~~gi~pe~e~y-d~g--~l~~~~~  159 (274)
T pfam05853       107 LNMG-----SMNFGLYSRDMVFPNTPADVEEFAARMQEAGVKPEFECF-DVG--HLRNAAR  159 (274)
T ss_pred             ECCC-----CCCCCCCCCCCEECCCHHHHHHHHHHHHHCCCCEEEEEE-CHH--HHHHHHH
T ss_conf             4466-----643565677720139999999999999985991499997-799--9999999


No 7  
>PRK08745 ribulose-phosphate 3-epimerase; Provisional
Probab=96.88  E-value=0.058  Score=35.03  Aligned_cols=203  Identities=12%  Similarity=0.107  Sum_probs=130.1

Q ss_pred             CCCCHHHHHHHHHHCCCCEEEEEC-----CCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEE
Q ss_conf             689989999999974998999824-----788334888999998874000136741588834856899999850721289
Q gi|254780438|r   22 PWPNLVHIGKIALQSGASGLTVHP-----RPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQIT   96 (261)
Q Consensus        22 ~~P~~~~~a~~~~~~GadgITvH~-----R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvt   96 (261)
                      ++=++-+....++++|+|.|-+--     =|. =-.-+.-+..+++.....  ..+..|=-.+-+.+++...+..++.+|
T Consensus        14 d~~~L~~ei~~l~~~g~d~iHiDImDG~FVpN-~t~g~~~i~~ir~~~~~~--plDvHLMv~~P~~~i~~~~~aGad~i~   90 (223)
T PRK08745         14 DFARLGEEVDNVLKAGADWVHFDVMDNHYVPN-LTIGPMVCQALRKHGITA--PIDVHLMVEPVDRIVPDFADAGATTIS   90 (223)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCC-CCCCHHHHHHHHHHCCCC--CEEEEEEECCHHHHHHHHHHCCCCEEE
T ss_conf             99999999999997699989982767970775-570959999999618997--537789833989999999973997899


Q ss_pred             EEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             71016555333578221333788999998620269638997254444147999974066146511211102444356433
Q gi|254780438|r   97 LVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER  176 (261)
Q Consensus        97 LVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~  176 (261)
                      +=+|...               .+..++..+++.|+++.+=+.|+.....++...+ -+|.|=+=|-.-  -|...+...
T Consensus        91 ~H~Ea~~---------------~~~~~i~~ik~~g~k~GlalnP~T~~~~l~~~l~-~~D~VliMtV~P--Gf~GQ~f~~  152 (223)
T PRK08745         91 FHPEASR---------------HVHRTIQLIKSHGCQAGLVLNPATPVDILDWVLP-ELDLVLVMSVNP--GFGGQAFIP  152 (223)
T ss_pred             EEECCCC---------------CHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH-HCCEEEEEEECC--CCCCCCCCH
T ss_conf             9606442---------------9999999999839844677469998799999886-479899987569--988754568


Q ss_pred             HHHHHHHHHHHHHHHC--CCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6668899987665415--6235207898987799999736996388425999999999409999999999997410
Q gi|254780438|r  177 IFLNKLAITAQLAQKM--DLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQHL  250 (261)
Q Consensus       177 ~el~~i~~aa~~A~~l--gL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~~~~  250 (261)
                      ..++|+++..++..+.  ...+-.-=|.|.+|++.+. + -+.+-+--|-+|....   -+.++|+++|+.+.+.|
T Consensus       153 ~~l~KI~~l~~~~~~~~~~~~I~VDGGI~~~ti~~l~-~-aGad~~V~GSaiF~~~---d~~~~i~~lr~~~~~~~  223 (223)
T PRK08745        153 SALDKLRAIRKKIDALGKPIRLEIDGGVKADNIGAIA-A-AGADTFVAGSAIFNAP---DYAQVIAQMRAAVAAVR  223 (223)
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHH-H-CCCCEEEECHHHHCCC---CHHHHHHHHHHHHHHCC
T ss_conf             8999999999999864999459997887989999999-8-6999999741775799---99999999999998659


No 8  
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional
Probab=96.61  E-value=0.09  Score=33.71  Aligned_cols=192  Identities=15%  Similarity=0.130  Sum_probs=122.6

Q ss_pred             HHCCCCEEEE-----ECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEECCCCCCCCC
Q ss_conf             9749989998-----24788334888999998874000136741588834856899999850721289710165553335
Q gi|254780438|r   34 LQSGASGLTV-----HPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSD  108 (261)
Q Consensus        34 ~~~GadgITv-----H~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~r~elTTe  108 (261)
                      .++|+|.|-+     |-=|.- -.-+.-|..|++-+...  ..+..|-...-+.+++-..+..++.+|+=+|....    
T Consensus        27 ~~~g~d~lHiDImDG~FVpN~-t~g~~~v~~ir~~~~~~--~lDvHLMv~~P~~~i~~~~~~gad~I~~H~E~~~~----   99 (224)
T PTZ00170         27 EGGGADWLHVDVMDGHFVPNL-SFGPPVVSSLRKHLPNT--FLDVHLMVSDPERWVDSFAKAGASQFTFHIEATED----   99 (224)
T ss_pred             HCCCCCEEEEECCCCCCCCCC-CCCHHHHHHHHHHCCCC--CEEEEEEECCHHHHHHHHHHCCCCEEEECCCCCCC----
T ss_conf             405997899944058507765-74978999999717998--64689986388887999986289679985001339----


Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHH-CCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             78221333788999998620269638997254444147999974-06614651121110244435643366688999876
Q gi|254780438|r  109 HGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKL-TGADCIELYTGPYGACYNNPQQERIFLNKLAITAQ  187 (261)
Q Consensus       109 gGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~-~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~  187 (261)
                                 ...+++.+++.|+++.|=+.|+..-..++.-.+ .-+|.|=+-|-.=  -|...+....-++|+++.-+
T Consensus       100 -----------~~~~i~~ik~~g~k~GlAlnP~T~i~~l~~~l~~~~iD~VLlMsV~P--Gf~GQ~Fi~~~l~KI~~lr~  166 (224)
T PTZ00170        100 -----------PKAVARKIRAAGMQVGVALKPKTPAEELFPLIDAGLVDMVLVMTVEP--GFGGQSFMHDMMPKVRQLRQ  166 (224)
T ss_pred             -----------HHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEEECC--CCCCCCCCHHHHHHHHHHHH
T ss_conf             -----------99999999971476455607999879999997114457899985569--98762145889999999985


Q ss_pred             HHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             65415623520789898779999973699638842599999999940999999999999741056
Q gi|254780438|r  188 LAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQHLDN  252 (261)
Q Consensus       188 ~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~~~~~~  252 (261)
                      ..  ..+.+-+-=|.|.+|++.+. . -+.+-+-.|-+|...   -...++|+++|+.+++...+
T Consensus       167 ~~--~~~~I~VDGGIn~~ti~~l~-~-aGad~~V~GSaiF~~---~d~~~~i~~lr~~i~~~~~~  224 (224)
T PTZ00170        167 RY--PHLNIQVDGGINPDTIDLAA-E-AGANVIVAGTSIFKA---NDRKESIETLRRSVQKHLSN  224 (224)
T ss_pred             CC--CCCEEEEECCCCHHHHHHHH-H-CCCCEEEECHHHHCC---CCHHHHHHHHHHHHHHHCCC
T ss_conf             48--99759995899989999999-8-699999978588679---99999999999999976239


No 9  
>PRK08883 ribulose-phosphate 3-epimerase; Provisional
Probab=96.05  E-value=0.18  Score=31.63  Aligned_cols=201  Identities=13%  Similarity=0.127  Sum_probs=129.3

Q ss_pred             CCCHHHHHHHHHHCCCCEEEEE-----CCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEE
Q ss_conf             8998999999997499899982-----47883348889999988740001367415888348568999998507212897
Q gi|254780438|r   23 WPNLVHIGKIALQSGASGLTVH-----PRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITL   97 (261)
Q Consensus        23 ~P~~~~~a~~~~~~GadgITvH-----~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtL   97 (261)
                      +=++.+....++++|+|.|-+-     -=|. =-.-+.-+..|++.....  ..+..|-...-+.+++-..+..++.+|+
T Consensus        11 ~~~L~~ei~~l~~~g~d~lHiDIMDG~FVPN-itfg~~~v~~ir~~~t~~--~~DvHLMv~~P~~~i~~~~~aGad~I~~   87 (220)
T PRK08883         11 FARLGEDVEKVLAAGADVVHFDVMDNHYVPN-LTFGAPICKALRDYGITA--PIDVHLMVKPVDRIIPDFAKAGASMITF   87 (220)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCCCCC-CCCCHHHHHHHHHHCCCC--CEEEEEEECCHHHHHHHHHHCCCCEEEE
T ss_conf             9999999999997699989981778985886-566989999999658998--7578998338888899999759988998


Q ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHH
Q ss_conf             10165553335782213337889999986202696389972544441479999740661465112111024443564336
Q gi|254780438|r   98 VPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI  177 (261)
Q Consensus        98 VPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~  177 (261)
                      =+|.     ++          .+..+++.+++.|+++.|=+.|+.....++.-.+ -+|.|=+=|-.-.  |...+....
T Consensus        88 H~Ea-----~~----------~~~~~i~~Ik~~g~k~GlalnP~T~~~~l~~~l~-~~D~VLvMtV~PG--f~GQ~f~~~  149 (220)
T PRK08883         88 HVEA-----SE----------HVDRTLQLIKEHGCQAGVVLNPATPLAHLEYIMD-KVDLILLMSVNPG--FGGQSFIPH  149 (220)
T ss_pred             CCCC-----CC----------CHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH-HCCEEEEEEECCC--CCCCCCCHH
T ss_conf             5776-----54----------9999999999859966888479998799999997-4697999874589--887545577


Q ss_pred             HHHHHHHHHHHHHHC--CCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             668899987665415--623520789898779999973699638842599999999940999999999999741
Q gi|254780438|r  178 FLNKLAITAQLAQKM--DLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQH  249 (261)
Q Consensus       178 el~~i~~aa~~A~~l--gL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~~~  249 (261)
                      .++|+++..++..+.  .+.+-.-=|.|.+|++.+. + -+.+-+--|-+|....   -.+++|+++|+.+.+.
T Consensus       150 ~l~Ki~~l~~~~~~~~~~~~I~VDGGI~~~ti~~l~-~-aGad~~V~GS~iF~~~---d~~~~i~~lr~~~~~~  218 (220)
T PRK08883        150 TLDKLRAVRKMIDASGRDIRLEIDGGVKVDNIREIA-E-AGADMFVAGSAIFGQP---DYKAVIDEMRAELAKV  218 (220)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHH-H-CCCCEEEECHHHHCCC---CHHHHHHHHHHHHHHH
T ss_conf             999999999988744998079998987899999999-8-7999999682674899---9999999999999984


No 10 
>COG1082 IolE Sugar phosphate isomerases/epimerases [Carbohydrate transport and metabolism]
Probab=95.84  E-value=0.22  Score=31.01  Aligned_cols=155  Identities=18%  Similarity=0.241  Sum_probs=91.9

Q ss_pred             ECCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEE-------EECCCCCCH----
Q ss_conf             348568999998507212897101655533357822133378899999862026963899-------725444414----
Q gi|254780438|r   77 GYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISL-------FADGNGNEH----  145 (261)
Q Consensus        77 g~p~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSL-------FIDpd~~q~----  145 (261)
                      ..+.+++++.+.+.-.+.+-+.|         +++-...... +..+.+.+++.|+.++.       |++|+....    
T Consensus        14 ~~~l~~~l~~~~~~G~~gvEl~~---------~~~~~~~~~~-~~~l~~~l~~~gl~i~~~~~~~~~~~~~~~~~~~~~~   83 (274)
T COG1082          14 ELPLEEILRKAAELGFDGVELSP---------GDLFPADYKE-LAELKELLADYGLEITSLAPFSNNLLSPDEEEREEAL   83 (274)
T ss_pred             CCCHHHHHHHHHHHCCCEEEECC---------CCCCCCCHHH-HHHHHHHHHHCCCEEEEECCCCCCCCCCCHHHHHHHH
T ss_conf             78989999999985977586357---------7665645011-9999999997697489822556655787668899899


Q ss_pred             -----HHHHHHHCCCCEEEECCCCCHHHHHH--HHHH-HHHHHHHHHHHHHHHHCCCEEEE---CCCCCHHHHH----HH
Q ss_conf             -----79999740661465112111024443--5643-36668899987665415623520---7898987799----99
Q gi|254780438|r  146 -----SLQAAKLTGADCIELYTGPYGACYNN--PQQE-RIFLNKLAITAQLAQKMDLQINA---GHDLTIQNIP----NL  210 (261)
Q Consensus       146 -----~i~~a~~~Gad~VElhTG~Ya~a~~~--~~~~-~~el~~i~~aa~~A~~lgL~VnA---GHgLn~~Nl~----~~  210 (261)
                           .++.|.++|++.|=.++|.++.....  +... +...+.+.+.+.+|...|+++..   .|.-++-+..    .+
T Consensus        84 ~~~~~~i~~a~~lg~~~vv~~~g~~~~~~~~~~~~~~~~~~~~~l~~l~~~a~~~~i~l~~e~~~~~~~~~~~~~~~~~~  163 (274)
T COG1082          84 EELKRAIELAKELGAKVVVVHPGLGAGADDPDSPEEARERWAEALEELAEIAEELGIGLALENHHHPGNVVETGADALDL  163 (274)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCEECCHHHHHHH
T ss_conf             99999999999849988999547776766665604568999999999999999809807972645777620685899999


Q ss_pred             HHHCCC--C-EEEEEHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             973699--6-388425999999999409999999999
Q gi|254780438|r  211 INAIPY--I-SEISVGHAFAATALECGVKEAVFCFRR  244 (261)
Q Consensus       211 i~~Ip~--I-~EvsIGHaiIseAl~~GL~~aI~~~~~  244 (261)
                      +..+..  + -.+-+||+.+...   ..-..++++..
T Consensus       164 ~~~~~~~~v~~~lD~~H~~~~~~---d~~~~~~~~~~  197 (274)
T COG1082         164 LREVDSPNVGLLLDTGHAFFAGE---DPLEAIRKLGD  197 (274)
T ss_pred             HHHCCCCCEEEEEEHHHHHHHCC---CHHHHHHHHHC
T ss_conf             98556887799988677878477---77999998427


No 11 
>pfam00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family. This enzyme catalyses the conversion of D-ribulose 5-phosphate into D-xylulose 5-phosphate.
Probab=95.82  E-value=0.22  Score=30.97  Aligned_cols=178  Identities=15%  Similarity=0.165  Sum_probs=113.9

Q ss_pred             CHHHHHHHHHHCCCCEEEEEC-----CCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEE
Q ss_conf             989999999974998999824-----788334888999998874000136741588834856899999850721289710
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTVHP-----RPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVP   99 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITvH~-----R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVP   99 (261)
                      ++.+-...+.++|+|.|-+-.     =|. =-.-+..+..+++...  . ..+..|-..--+.+++-..+..++.+|+=.
T Consensus        13 ~l~~~i~~l~~~g~d~iHiDimDG~FVpn-~t~g~~~i~~ir~~t~--~-~~DvHLMv~~P~~~i~~~~~~g~d~i~~H~   88 (201)
T pfam00834        13 HLGEEIKAVENAGADWLHVDVMDGHFVPN-LTIGPLVVEALRPLTE--L-PLDVHLMVEEPDRIIPDFAEAGADIISFHA   88 (201)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCC-CCCCHHHHHHHHHCCC--C-CEEEEEEEECHHHHHHHHHHCCCCEEEECH
T ss_conf             99999999997699989982767972775-5558779999986389--9-638999983776639999873998899754


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             16555333578221333788999998620269638997254444147999974066146511211102444356433666
Q gi|254780438|r  100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFL  179 (261)
Q Consensus       100 e~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el  179 (261)
                      |.-+               .+..+++.+++.|+++.|=+.|+..-..++.-.+ -+|.|=+-|-.-.  |...+.....+
T Consensus        89 E~~~---------------~~~~~i~~ik~~g~k~GlAlnP~T~~~~l~~~l~-~iD~VLvMtV~PG--f~GQ~f~~~~l  150 (201)
T pfam00834        89 EASD---------------HPHRTIQLIKEAGAKAGLVLNPATPLDAIEYLLD-DLDLVLLMSVNPG--FGGQSFIPSVL  150 (201)
T ss_pred             HHHH---------------CHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHH-HCCEEEEEEECCC--CCCCCCCHHHH
T ss_conf             4413---------------7999999998649726888569986028887674-2798999886689--88764567799


Q ss_pred             HHHHHHHHHHHHC--CCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHH
Q ss_conf             8899987665415--6235207898987799999736996388425999
Q gi|254780438|r  180 NKLAITAQLAQKM--DLQINAGHDLTIQNIPNLINAIPYISEISVGHAF  226 (261)
Q Consensus       180 ~~i~~aa~~A~~l--gL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHai  226 (261)
                      +|+++..++..+.  .+.+-+-=|.|.+|++.+. + -+.+-+-.|-+|
T Consensus       151 ~KI~~lr~~~~~~~~~~~I~vDGGIn~~ti~~l~-~-~Gad~~V~GSai  197 (201)
T pfam00834       151 PKIRKVRKMIDEGGLDTLIEVDGGVNLDNIPQIA-E-AGADVLVAGSAV  197 (201)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHH-H-CCCCEEEECCEE
T ss_conf             9999999999826998079998988899999999-8-799999978002


No 12 
>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed
Probab=95.62  E-value=0.21  Score=31.15  Aligned_cols=215  Identities=12%  Similarity=0.076  Sum_probs=115.4

Q ss_pred             CCHHHHHHHHHHCCCCEEEEEC-CCCCC----CCCHHHHHHHHHHHCCCCCCCEEEEEE------CC----C--------
Q ss_conf             9989999999974998999824-78833----488899999887400013674158883------48----5--------
Q gi|254780438|r   24 PNLVHIGKIALQSGASGLTVHP-RPDQR----HIRYTDLPEIRRLIDEQFPKAELNIEG------YP----N--------   80 (261)
Q Consensus        24 P~~~~~a~~~~~~GadgITvH~-R~DrR----HI~~~Dv~~l~~~~~~~~~~~elNiEg------~p----~--------   80 (261)
                      =+..+.-.+|.++|-|+|-+-. -+|.|    ...++.+..|++.+...  +++++==+      +|    +        
T Consensus        21 ~sw~e~~~~ak~~Gfd~iElsiDe~d~~~~rL~w~~~~~~~ir~~~~~~--gi~i~s~cls~~~~~Pl~S~D~~~R~~~~   98 (283)
T PRK13209         21 ECWLEKLRIAKTAGFDFVEMSVDETDERLARLDWSREQRLALVNALVET--GFRVNSMCLSAHRRFPLGSEDDAVRAQGL   98 (283)
T ss_pred             CCHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC--CCCCEEEECCCCCCCCCCCCCHHHHHHHH
T ss_conf             9999999999985998799842685310035899999999999999981--99860330545557999997999999999


Q ss_pred             ---HHHHHHHHHHCCCEEEEEECCC-CCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECC----CCCCHHHHHHHH
Q ss_conf             ---6899999850721289710165-55333578221333788999998620269638997254----444147999974
Q gi|254780438|r   81 ---ETFLNLCERYKPEQITLVPDDP-HQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADG----NGNEHSLQAAKL  152 (261)
Q Consensus        81 ---~e~i~ia~~ikP~qvtLVPe~r-~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDp----d~~q~~i~~a~~  152 (261)
                         .+.+++|.+..-..+.++|-.. .+..++-.|..  -.+.|++++....+.||..++=.-+    +..++.++....
T Consensus        99 e~~~kaI~lA~~LGi~~I~lag~dv~~~~~~~e~~~~--f~e~L~~~~~~A~~~gV~L~iE~~~~~f~~t~~~~~~~i~~  176 (283)
T PRK13209         99 EIMRKAIQLAQDLGIRVIQLAGYDVYYEEANNETRRR--FIDGLKESVEMASRYSVTLAFEIMDTPFMGSISKALGYAHY  176 (283)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHH--HHHHHHHHHHHHHHHCCEEEEEECCHHHHCCHHHHHHHHHH
T ss_conf             9999999999980999899688766788785999999--99999999999998599899942553432159999999996


Q ss_pred             CCCCEEEEC--CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCE---------EEECCC-CCHHHHHHHHHHCCCCEEE
Q ss_conf             066146511--2111024443564336668899987665415623---------520789-8987799999736996388
Q gi|254780438|r  153 TGADCIELY--TGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQ---------INAGHD-LTIQNIPNLINAIPYISEI  220 (261)
Q Consensus       153 ~Gad~VElh--TG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~---------VnAGHg-Ln~~Nl~~~i~~Ip~I~Ev  220 (261)
                      +|.+.+-+|  ||..... .  .....++.+.   ..+....-++         |-.|.| +|+.-+-..+.++.+=--+
T Consensus       177 v~sP~l~v~~D~gn~~~~-~--~d~~~~i~~~---~~~I~~vH~kD~~~g~~~~vp~G~G~vdf~~vf~aLk~~gY~G~~  250 (283)
T PRK13209        177 LNSPWFQLYPDIGNLSAW-D--NDVQMELQAG---IGHIVAFHVKDTKPGVFKNVPFGEGVVDFERAFKTLKQSGYCGPY  250 (283)
T ss_pred             CCCCCEEEEECHHHHHHC-C--CCHHHHHHHH---HHHEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCE
T ss_conf             699728999445779875-6--9999999972---445689853147799767578988850889999999997997628


Q ss_pred             EEHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             4259999999994099999999999974105
Q gi|254780438|r  221 SVGHAFAATALECGVKEAVFCFRRACGQHLD  251 (261)
Q Consensus       221 sIGHaiIseAl~~GL~~aI~~~~~ii~~~~~  251 (261)
                      .|=-+   .--..-....|++.++-+.+..+
T Consensus       251 ~iE~w---~~~~~~~~~~i~~a~~f~~~~~~  278 (283)
T PRK13209        251 LIEMW---SETAEDPAAEVAKARDFVKARMA  278 (283)
T ss_pred             EEEEE---CCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             99984---18995789999999999999998


No 13 
>PRK05581 ribulose-phosphate 3-epimerase; Validated
Probab=95.60  E-value=0.27  Score=30.40  Aligned_cols=198  Identities=15%  Similarity=0.151  Sum_probs=127.1

Q ss_pred             CCCHHHHHHHHHHCCCCEEEEEC-----CCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEE
Q ss_conf             89989999999974998999824-----7883348889999988740001367415888348568999998507212897
Q gi|254780438|r   23 WPNLVHIGKIALQSGASGLTVHP-----RPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITL   97 (261)
Q Consensus        23 ~P~~~~~a~~~~~~GadgITvH~-----R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtL   97 (261)
                      +=++.+-...+.++|++.+-+--     =|. =-..+..+..|++...  . .....|-..--+.+++-..+..++.+|+
T Consensus        15 ~~~l~~~i~~l~~~g~~~lHiDImDG~FVpn-~t~g~~~v~~i~~~t~--~-~~DvHLMv~~P~~~i~~~~~~g~d~I~~   90 (220)
T PRK05581         15 FARLGEEVKAVEAAGADWIHVDVMDGHFVPN-LTIGPPVVEAIRKVTK--L-PLDVHLMVENPDRYVPDFAKAGADIITF   90 (220)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCCCCC-CCCCHHHHHHHHHHCC--C-CEEEEEEEECHHHHHHHHHHCCCCEEEE
T ss_conf             9999999999997699989995757844775-5639999999984189--9-6478999718888799999739988998


Q ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHH
Q ss_conf             10165553335782213337889999986202696389972544441479999740661465112111024443564336
Q gi|254780438|r   98 VPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI  177 (261)
Q Consensus        98 VPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~  177 (261)
                      =.|.-+               .+..+++.+++.|+++.|=+.|+.....++.-.+ -+|.|=+-|-.-.  |...+....
T Consensus        91 H~Ea~~---------------~~~~~i~~ik~~g~k~Glalnp~T~~~~l~~~l~-~iD~VlvMtV~PG--f~GQ~f~~~  152 (220)
T PRK05581         91 HVEASE---------------HIHRLLQLIKEAGIKAGLVLNPATPLEYLEYVLP-LLDLVLLMSVNPG--FGGQKFIPE  152 (220)
T ss_pred             CCCCCC---------------CHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH-HHCEEEEEEECCC--CCCCCCCHH
T ss_conf             167502---------------7999999999749970467669999899999987-4152589986588--787645566


Q ss_pred             HHHHHHHHHHHHHHC--CCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             668899987665415--6235207898987799999736996388425999999999409999999999997
Q gi|254780438|r  178 FLNKLAITAQLAQKM--DLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACG  247 (261)
Q Consensus       178 el~~i~~aa~~A~~l--gL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~  247 (261)
                      -++|+++..++..+.  .+.+..-=|.|.+|++.+. . -+.+-+-.|-+|....   -.+++|+++|+.+.
T Consensus       153 ~l~ki~~l~~~~~~~~~~~~I~VDGGIn~~~i~~l~-~-~Gad~~V~GS~iF~~~---d~~~~i~~lk~~~~  219 (220)
T PRK05581        153 VLEKIREVRKLIDERGLDILIEVDGGVNAENIKECA-E-AGADVFVAGSAVFGAP---DYKEAIDELRAELA  219 (220)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHH-H-CCCCEEEECHHHHCCC---CHHHHHHHHHHHHC
T ss_conf             999999999999845997559997898989999999-7-7999999794885799---99999999999853


No 14 
>PRK08745 ribulose-phosphate 3-epimerase; Provisional
Probab=95.05  E-value=0.4  Score=29.24  Aligned_cols=168  Identities=17%  Similarity=0.270  Sum_probs=109.5

Q ss_pred             CCCCCCHHHHHHHHCCCCC--------CCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             5332214432232207886--------89989999999974998999824788334888999998874000136741588
Q gi|254780438|r    4 SVSVNLNAVAVLRNRRNLP--------WPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNI   75 (261)
Q Consensus         4 ~LsVNidhiAtLRnaRg~~--------~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNi   75 (261)
                      +++...+.|..||.- ..+        .-+|........++|||-||+|.--. +|+. +.+..+++    +  +...-+
T Consensus        45 N~t~g~~~i~~ir~~-~~~~plDvHLMv~~P~~~i~~~~~aGad~i~~H~Ea~-~~~~-~~i~~ik~----~--g~k~Gl  115 (223)
T PRK08745         45 NLTIGPMVCQALRKH-GITAPIDVHLMVEPVDRIVPDFADAGATTISFHPEAS-RHVH-RTIQLIKS----H--GCQAGL  115 (223)
T ss_pred             CCCCCHHHHHHHHHH-CCCCCEEEEEEECCHHHHHHHHHHCCCCEEEEEECCC-CCHH-HHHHHHHH----C--CCCEEE
T ss_conf             557095999999961-8997537789833989999999973997899960644-2999-99999998----3--984467


Q ss_pred             EECCCHH--HHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHH-HHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHH
Q ss_conf             8348568--999998507212897101655533357822133-3788999998620269638997254444147999974
Q gi|254780438|r   76 EGYPNET--FLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQ-NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKL  152 (261)
Q Consensus        76 Eg~p~~e--~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~-~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~  152 (261)
                      -.+|...  .++-.+. .-++|.+.-..|+-    +|+.+.. -.++++..-+.+...+-.+.+.+|-..++..+....+
T Consensus       116 alnP~T~~~~l~~~l~-~~D~VliMtV~PGf----~GQ~f~~~~l~KI~~l~~~~~~~~~~~~I~VDGGI~~~ti~~l~~  190 (223)
T PRK08745        116 VLNPATPVDILDWVLP-ELDLVLVMSVNPGF----GGQAFIPSALDKLRAIRKKIDALGKPIRLEIDGGVKADNIGAIAA  190 (223)
T ss_pred             EECCCCCHHHHHHHHH-HCCEEEEEEECCCC----CCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHH
T ss_conf             7469998799999886-47989998756998----875456889999999999998649994599978879899999998


Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             06614651121110244435643366688999876654
Q gi|254780438|r  153 TGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQ  190 (261)
Q Consensus       153 ~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~  190 (261)
                      .|||.+=.=+.-    |+.+ .....+++++.++..|+
T Consensus       191 aGad~~V~GSai----F~~~-d~~~~i~~lr~~~~~~~  223 (223)
T PRK08745        191 AGADTFVAGSAI----FNAP-DYAQVIAQMRAAVAAVR  223 (223)
T ss_pred             CCCCEEEECHHH----HCCC-CHHHHHHHHHHHHHHCC
T ss_conf             699999974177----5799-99999999999998659


No 15 
>PRK08005 ribulose-phosphate 3-epimerase; Validated
Probab=94.70  E-value=0.49  Score=28.64  Aligned_cols=188  Identities=11%  Similarity=0.117  Sum_probs=115.3

Q ss_pred             CHHHHHHHHHHCCCCEEEEECCCCCCC------CCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEE
Q ss_conf             989999999974998999824788334------88899999887400013674158883485689999985072128971
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTVHPRPDQRH------IRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLV   98 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITvH~R~DrRH------I~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLV   98 (261)
                      ++-+-.+.++++|+|.|  |.-==--|      .-+..+..+++...  . .....+-..--+.+++-..+..++.+|+=
T Consensus        14 ~L~~ei~~l~~~g~d~l--HiDIMDG~FVPNitfg~~~v~~ir~~t~--~-p~DvHLMv~~P~~~i~~~~~~g~d~it~H   88 (210)
T PRK08005         14 RYAEALTALHDAPLGSL--HLDIEDTSFINNITFGMKTIQAVAQYTR--H-PLSFHLMVSSPQRWLPWLAAIRPGWIFIH   88 (210)
T ss_pred             HHHHHHHHHHHCCCCEE--EEECCCCCCCCCCCCCHHHHHHHHHCCC--C-CEEEEEEECCHHHHHHHHHHCCCCEEEEE
T ss_conf             99999999997799989--9828889827745629899999986189--9-80799986888999999997299859993


Q ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHC--CCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             0165553335782213337889999986202696389972544441479999740--66146511211102444356433
Q gi|254780438|r   99 PDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLT--GADCIELYTGPYGACYNNPQQER  176 (261)
Q Consensus        99 Pe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~--Gad~VElhTG~Ya~a~~~~~~~~  176 (261)
                      +|....               ...+++.+++.|+++.|=+.|+..   ++....+  -.|.|=+=|-.-.  |...+...
T Consensus        89 ~Ea~~~---------------~~~~i~~Ik~~g~k~GlAlnP~T~---i~~~~~~l~~vD~VLvMtV~PG--f~GQ~Fi~  148 (210)
T PRK08005         89 AESVQN---------------PSEILADIRAIGAKAGLALNPATP---LLPYRYLALQLDALMIMTSEPD--GRGQQFIA  148 (210)
T ss_pred             CCCCCC---------------HHHHHHHHHHCCCEEEEEECCCCC---HHHHHHHHHCCCEEEEEEECCC--CCCCCCCH
T ss_conf             567769---------------999999999749807888379998---7998730400798999877899--98721178


Q ss_pred             HHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             66688999876654156235207898987799999736996388425999999999409999999999
Q gi|254780438|r  177 IFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR  244 (261)
Q Consensus       177 ~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~~  244 (261)
                      ..++|+++.-++..+.  .+-+-=|.|.+|++.+ .+ -+.+-+-.|-+|...   --..++|.++|.
T Consensus       149 ~~~~KI~~~r~~~~~~--~I~vDGGIn~~t~~~~-~~-aGad~~V~GSaiF~~---~d~~~~i~~lr~  209 (210)
T PRK08005        149 AMCEKVSQSREHFPAA--ECWADGGITLRAARLL-AA-AGAQHLVIGRALFTT---ANYDVTLSQFTA  209 (210)
T ss_pred             HHHHHHHHHHHHCCCC--CEEEECCCCHHHHHHH-HH-CCCCEEEECHHHHCC---CCHHHHHHHHHC
T ss_conf             8999999999628778--8899788788999999-98-699999979065369---999999999863


No 16 
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional
Probab=94.57  E-value=0.52  Score=28.43  Aligned_cols=192  Identities=13%  Similarity=0.101  Sum_probs=114.5

Q ss_pred             HHHHCCCCEEEEE-----CCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEECCCCCCC
Q ss_conf             9997499899982-----47883348889999988740001367415888348568999998507212897101655533
Q gi|254780438|r   32 IALQSGASGLTVH-----PRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLT  106 (261)
Q Consensus        32 ~~~~~GadgITvH-----~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~r~elT  106 (261)
                      .+++.|+|.|-+-     -=| .=-.-+.-+..|++....   ..+..|-..--+.+++-..+..++.+|+=+|.-+   
T Consensus        20 ~~~~~~~d~iHiDIMDG~FVP-N~tfgp~~v~~ir~~t~~---p~DvHLMv~~P~~~i~~~~~~gad~It~H~Ea~~---   92 (227)
T PRK09722         20 EFLDSKADYFHIDIMDGHFVP-NLTLSPFFVSQVKKLASK---PLDCHLMVTRPQDYIAQLADAGADFITLHPETIN---   92 (227)
T ss_pred             HHHHCCCCEEEEECCCCCCCC-CCCCCHHHHHHHHHCCCC---CEEEEEEECCHHHHHHHHHHCCCCEEEECHHHCC---
T ss_conf             999748988999561686078-545186599999744899---6478999658888899998549989995656505---


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             35782213337889999986202696389972544441479999740661465112111024443564336668899987
Q gi|254780438|r  107 SDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITA  186 (261)
Q Consensus       107 TegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa  186 (261)
                                 .....++..+++.|+++.|=+.|+..-..++.-.. -+|.|=+-|-.=  -|...+.....++|+++..
T Consensus        93 -----------~~~~~~i~~Ik~~g~k~GlAlnP~Tpi~~i~~~l~-~vD~VLvMsV~P--Gf~GQ~Fi~~~l~KI~~lr  158 (227)
T PRK09722         93 -----------GQAFRLIDEIRRAGMKVGLVLNPETPVEAIKYYIH-LADKVTVMTVDP--GFAGQPFIPEMLDKIAELK  158 (227)
T ss_pred             -----------CCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHH-HCCEEEEEEECC--CCCCCCCCHHHHHHHHHHH
T ss_conf             -----------65999999999869972233389998668876674-379899998889--9987656688999999999


Q ss_pred             HHHHHCC--CEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHH---HHHHHHHHHHHHHHHHH
Q ss_conf             6654156--2352078989877999997369963884259999999994---09999999999997410
Q gi|254780438|r  187 QLAQKMD--LQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALEC---GVKEAVFCFRRACGQHL  250 (261)
Q Consensus       187 ~~A~~lg--L~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~---GL~~aI~~~~~ii~~~~  250 (261)
                      ++..+.|  +.+-.-=|.|.+|++.++.  -+.+-+=-|-|    |+|-   ++++++..+++-+.+..
T Consensus       159 ~~~~~~~~~~~I~VDGGI~~~~i~~~~~--aGAd~~V~Gss----aiF~~~~~i~~~~~~l~~~~~~~~  221 (227)
T PRK09722        159 AWREREGLEYEIEVDGSCNQKTYEKLMA--AGADVFIVGTS----GLFNHAENIDEAWDIMTAQILAAT  221 (227)
T ss_pred             HHHHHCCCCCEEEEECCCCHHHHHHHHH--CCCCEEEECCH----HHCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             9998259982699989888999999998--69999997748----974899999999999999999986


No 17 
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase. One member of this subgroup, the Sinorhizobium meliloti stachydrine utilization protein stcD, has been idenified as a putative N-methylproline demethylase.
Probab=94.42  E-value=0.56  Score=28.20  Aligned_cols=17  Identities=24%  Similarity=0.348  Sum_probs=8.6

Q ss_pred             HHHHHCCCCEEEECCCC
Q ss_conf             99974066146511211
Q gi|254780438|r  148 QAAKLTGADCIELYTGP  164 (261)
Q Consensus       148 ~~a~~~Gad~VElhTG~  164 (261)
                      +.|++.|+|.||||-+.
T Consensus       148 ~~A~~AGfDgVEIH~ah  164 (343)
T cd04734         148 RRCQAGGLDGVELQAAH  164 (343)
T ss_pred             HHHHHCCCCEEEECCCC
T ss_conf             99997399889844577


No 18 
>PRK11815 tRNA-dihydrouridine synthase A; Provisional
Probab=94.21  E-value=0.071  Score=34.41  Aligned_cols=169  Identities=15%  Similarity=0.233  Sum_probs=79.2

Q ss_pred             EEEEECCCHHHHH---HHHHHCCCEEEE---EECCCCCCCCC-CCCCHHHHHHHHHHHHHHHCCC-CCEEEEE----ECC
Q ss_conf             5888348568999---998507212897---10165553335-7822133378899999862026-9638997----254
Q gi|254780438|r   73 LNIEGYPNETFLN---LCERYKPEQITL---VPDDPHQLTSD-HGWDFLQNQALLTKTVARLHNL-GSRISLF----ADG  140 (261)
Q Consensus        73 lNiEg~p~~e~i~---ia~~ikP~qvtL---VPe~r~elTTe-gGldv~~~~~~L~~~i~~l~~~-girvSLF----IDp  140 (261)
                      +-|=|+--+.|.+   ++.+..++.+-|   -|-++  ++.. .|--+.++.+...++++.++++ ++.||+=    +|.
T Consensus        69 vQl~G~dp~~la~Aa~i~~~~g~d~IDlN~GCP~~k--V~~g~~Ga~Lm~~p~~v~~iv~a~~~a~~~PVTvK~RlG~d~  146 (333)
T PRK11815         69 LQLGGSDPADLAEAAKLAEDWGYDEINLNVGCPSDR--VQNGRFGACLMAEPELVADCVKAMKDAVSIPVTVKHRIGIDD  146 (333)
T ss_pred             EEECCCCHHHHHHHHHHHHHCCCCEECCCCCCCHHH--HHCCCEEHHHHCCHHHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             997479999999999999873988535238998688--732780178707999999999999873488535786316777


Q ss_pred             -CCCC---HHHHHHHHCCCCEEEECCCCCHHHHH---HHHHH-HHHHHHHHHHHHHHHHC-CCEEEECCC-CCHHHHHHH
Q ss_conf             -4441---47999974066146511211102444---35643-36668899987665415-623520789-898779999
Q gi|254780438|r  141 -NGNE---HSLQAAKLTGADCIELYTGPYGACYN---NPQQE-RIFLNKLAITAQLAQKM-DLQINAGHD-LTIQNIPNL  210 (261)
Q Consensus       141 -d~~q---~~i~~a~~~Gad~VElhTG~Ya~a~~---~~~~~-~~el~~i~~aa~~A~~l-gL~VnAGHg-Ln~~Nl~~~  210 (261)
                       |...   .-++...+.|++.+-+|-=.   ++-   ++++. .+---++...++...+. .+.|-+-=| .+++..   
T Consensus       147 ~d~~~~l~~f~~~~~~aG~~~i~vH~R~---a~l~Glspk~nR~ippl~~~~v~~lk~~~p~ipvi~NGdI~s~~~~---  220 (333)
T PRK11815        147 QDSYEFLCDFVDTVAEAGCDRFIVHARK---AWLKGLSPKENREIPPLDYDRVYRLKRDFPHLTIEINGGIKTLEEA---  220 (333)
T ss_pred             CCHHHHHHHHHHHHHHCCCCEEEEEEHH---HHHCCCCHHHHCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCHHHH---
T ss_conf             7528999999999997599889996027---8772678777505873048999999976678718845996999999---


Q ss_pred             HHHCCCCEEEEEHHHHHH--------HHHHHH-------HHHHHHHHHHHHHHH
Q ss_conf             973699638842599999--------999940-------999999999999741
Q gi|254780438|r  211 INAIPYISEISVGHAFAA--------TALECG-------VKEAVFCFRRACGQH  249 (261)
Q Consensus       211 i~~Ip~I~EvsIGHaiIs--------eAl~~G-------L~~aI~~~~~ii~~~  249 (261)
                      ...+.+.+-|-||-+.+.        ++.++|       ..+.+..|.+-+.+.
T Consensus       221 ~~~l~~~DGVMiGRga~~nPwif~~id~~~~g~~~~~~s~~ei~~~~~~y~~~~  274 (333)
T PRK11815        221 KEHLQHVDGVMIGRAAYHNPYLLAEVDRELFGEPAPVPSREEVLEAMLPYIEAH  274 (333)
T ss_pred             HHHHHCCCEEEEHHHHHCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             999855996211486755997899999998489999999999999999999999


No 19 
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism]
Probab=94.05  E-value=0.67  Score=27.70  Aligned_cols=142  Identities=15%  Similarity=0.159  Sum_probs=99.6

Q ss_pred             HHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEE--EEEECCCCCCHHHHHHHHCCCCEEEE
Q ss_conf             9999985072128971016555333578221333788999998620269638--99725444414799997406614651
Q gi|254780438|r   83 FLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRI--SLFADGNGNEHSLQAAKLTGADCIEL  160 (261)
Q Consensus        83 ~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girv--SLFIDpd~~q~~i~~a~~~Gad~VEl  160 (261)
                      ..+++-+---|++|..              ...+...++..++.-++.|+.+  -|+-..||.+ ..+..+++|+|.+.+
T Consensus        72 e~~ma~~aGAd~~tV~--------------g~A~~~TI~~~i~~A~~~~~~v~iDl~~~~~~~~-~~~~l~~~gvd~~~~  136 (217)
T COG0269          72 EARMAFEAGADWVTVL--------------GAADDATIKKAIKVAKEYGKEVQIDLIGVWDPEQ-RAKWLKELGVDQVIL  136 (217)
T ss_pred             HHHHHHHCCCCEEEEE--------------ECCCHHHHHHHHHHHHHCCCEEEEEEECCCCHHH-HHHHHHHHCCCEEEE
T ss_conf             9999997389879998--------------0488899999999999839869998516899999-999999718978999


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             12111024443564336668899987665415623520789898779999973699638842599999999940999999
Q gi|254780438|r  161 YTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF  240 (261)
Q Consensus       161 hTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~  240 (261)
                      |+|-=+.+....- ....|.++    +-..++|..|-..-|++.++++.|+ .++ .+=|-.|-+|...   -+-.++.+
T Consensus       137 H~g~D~q~~G~~~-~~~~l~~i----k~~~~~g~~vAVaGGI~~~~i~~~~-~~~-~~ivIvGraIt~a---~dp~~~a~  206 (217)
T COG0269         137 HRGRDAQAAGKSW-GEDDLEKI----KKLSDLGAKVAVAGGITPEDIPLFK-GIG-ADIVIVGRAITGA---KDPAEAAR  206 (217)
T ss_pred             EECCCHHHHCCCC-CHHHHHHH----HHHHCCCCEEEEECCCCHHHHHHHH-CCC-CCEEEECCHHCCC---CCHHHHHH
T ss_conf             7043476508994-17789999----9862368359986687887889986-489-9799988221489---99799999


Q ss_pred             HHHHHHHHH
Q ss_conf             999999741
Q gi|254780438|r  241 CFRRACGQH  249 (261)
Q Consensus       241 ~~~~ii~~~  249 (261)
                      +|++.+++.
T Consensus       207 ~~~~~i~~~  215 (217)
T COG0269         207 KFKEEIDKI  215 (217)
T ss_pred             HHHHHHHCC
T ss_conf             999986425


No 20 
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE). This enzyme catalyses the interconversion of D-ribulose 5-phosphate (Ru5P) into D-xylulose 5-phosphate, as part of the Calvin cycle (reductive pentose phosphate pathway) in chloroplasts and in the oxidative pentose phosphate pathway. In the Calvin cycle Ru5P is phosphorylated by phosphoribulose kinase to ribulose-1,5-bisphosphate, which in turn is used by RubisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase) to incorporate CO2 as the central step in carbohydrate synthesis.
Probab=93.83  E-value=0.73  Score=27.43  Aligned_cols=192  Identities=15%  Similarity=0.163  Sum_probs=118.0

Q ss_pred             CHHHHHHHHHHCCCCEEEEECCC----CCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEEC
Q ss_conf             98999999997499899982478----83348889999988740001367415888348568999998507212897101
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTVHPRP----DQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPD  100 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITvH~R~----DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe  100 (261)
                      ++.+-...+.++|++.+-+-.=-    ..=-.-..-+..|++...  + ..+..|=..--+.+++...+..++.+|+=+|
T Consensus        13 ~l~~~i~~~~~~g~d~lHiDimDG~Fvpn~t~g~~~v~~i~~~t~--~-~~DvHLMv~~P~~~i~~~~~~g~d~I~~H~E   89 (211)
T cd00429          13 NLGEELKRLEEAGADWIHIDVMDGHFVPNLTFGPPVVKALRKHTD--L-PLDVHLMVENPERYIEAFAKAGADIITFHAE   89 (211)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCC--C-CEEEEEEECCHHHHHHHHHHHCCCEEEECCC
T ss_conf             999999999976999899957579727866759899999987579--9-7058998718877699999709988998643


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             65553335782213337889999986202696389972544441479999740661465112111024443564336668
Q gi|254780438|r  101 DPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN  180 (261)
Q Consensus       101 ~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~  180 (261)
                      .-               ..+..+++.+++.|+++.|=+.|+..-..++.-.+. +|.|=+=|-.=  -|...+....-++
T Consensus        90 ~~---------------~~~~~~i~~ik~~g~~~Glal~p~T~~~~l~~~l~~-~D~vliMtV~P--Gf~GQ~f~~~~~~  151 (211)
T cd00429          90 AT---------------DHLHRTIQLIKELGMKAGVALNPGTPVEVLEPYLDE-VDLVLVMSVNP--GFGGQKFIPEVLE  151 (211)
T ss_pred             CC---------------CCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHH-HCEEEEEEECC--CCCCCCCCHHHHH
T ss_conf             22---------------089999999997398723575489998999999975-15227987468--8788754567999


Q ss_pred             HHHHHHHHHH--HCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8999876654--1562352078989877999997369963884259999999994099999999
Q gi|254780438|r  181 KLAITAQLAQ--KMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF  242 (261)
Q Consensus       181 ~i~~aa~~A~--~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~  242 (261)
                      |+++..++-.  ..++.+-+-=|.|.+|++.+. . -+.+-+-.|-+|....   -+.++++++
T Consensus       152 ki~~l~~~~~~~~~~~~I~vDGGI~~~~i~~l~-~-~Gad~~V~GS~iF~~~---d~~~~i~~l  210 (211)
T cd00429         152 KIRKLRELIPENNLNLLIEVDGGINLETIPLLA-E-AGADVLVAGSALFGSD---DYAEAIKEL  210 (211)
T ss_pred             HHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHH-H-CCCCEEEECHHHHCCC---CHHHHHHHH
T ss_conf             999999999864998599996785989999999-8-5999999793775899---999999971


No 21 
>PRK09856 fructoselysine 3-epimerase; Provisional
Probab=93.76  E-value=0.75  Score=27.35  Aligned_cols=44  Identities=16%  Similarity=0.237  Sum_probs=28.8

Q ss_pred             CCCHHHHHHHHHHCCCCEEEEE---CCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             8998999999997499899982---4788334888999998874000
Q gi|254780438|r   23 WPNLVHIGKIALQSGASGLTVH---PRPDQRHIRYTDLPEIRRLIDE   66 (261)
Q Consensus        23 ~P~~~~~a~~~~~~GadgITvH---~R~DrRHI~~~Dv~~l~~~~~~   66 (261)
                      .-++-++...+.+.|-|||-+=   |-.--=-++..++..+++++..
T Consensus        12 ~~ple~a~~~aa~lGydgVEi~~~~ph~~~~~~~~~~~~~ik~l~~~   58 (276)
T PRK09856         12 RLPIEHAFRDASELGYDGIEIWGGRPHAFAPDLKAGGIKQIKALAQT   58 (276)
T ss_pred             CCCHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             99999999999984999899737876546765465579999999998


No 22 
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day.  Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.
Probab=93.62  E-value=0.58  Score=28.12  Aligned_cols=27  Identities=11%  Similarity=0.176  Sum_probs=14.7

Q ss_pred             CHHHHHHHHHHCCCCEEEEEHHHHHHHH
Q ss_conf             9877999997369963884259999999
Q gi|254780438|r  203 TIQNIPNLINAIPYISEISVGHAFAATA  230 (261)
Q Consensus       203 n~~Nl~~~i~~Ip~I~EvsIGHaiIseA  230 (261)
                      +.+.....++. ...+=|.+|-.+|++-
T Consensus       292 ~~~~a~~~l~~-g~~D~V~~gR~~iadP  318 (327)
T cd02803         292 DPEVAEEILAE-GKADLVALGRALLADP  318 (327)
T ss_pred             CHHHHHHHHHC-CCCCHHHHHHHHHHCC
T ss_conf             99999999988-9931258669999791


No 23 
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ. One of the well-described hopanoid intermediates is bacteriohopanetetrol. In the conversion from hopene several reactions must occur in the side chain for which a radical mechanism might be reasonable. These include the four (presumably anaerobic) hydroxylations and a methyl shift.
Probab=93.47  E-value=0.62  Score=27.94  Aligned_cols=84  Identities=12%  Similarity=0.073  Sum_probs=53.9

Q ss_pred             HHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCE
Q ss_conf             37889999986202696389972544441479999740661465112111024443564336668899987665415623
Q gi|254780438|r  116 NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQ  195 (261)
Q Consensus       116 ~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~  195 (261)
                      +.++...+.+.+++.++.-+...-.+.+.+.++..++-|...|-+=...-+...-+.-.....++++.++.+.+++.||.
T Consensus       259 ~~~r~~eic~~i~~l~i~W~~~~Rv~~d~E~l~~mk~AGc~~v~~GiESgsq~iL~~i~K~~t~e~~~~av~~~k~~GI~  338 (472)
T TIGR03471       259 DKPRAEEIARKLGPLGVTWSCNARANVDYETLKVMKENGLRLLLVGYESGDQQILKNIKKGLTVEIARRFTRDCHKLGIK  338 (472)
T ss_pred             CHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHCCEEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCE
T ss_conf             99999999999987698278763034899999999983984899803758999999853899899999999988757987


Q ss_pred             EEEC
Q ss_conf             5207
Q gi|254780438|r  196 INAG  199 (261)
Q Consensus       196 VnAG  199 (261)
                      |++-
T Consensus       339 v~~~  342 (472)
T TIGR03471       339 VHGT  342 (472)
T ss_pred             EEEE
T ss_conf             9999


No 24 
>PRK09389 (R)-citramalate synthase; Provisional
Probab=93.46  E-value=0.43  Score=29.01  Aligned_cols=168  Identities=13%  Similarity=0.130  Sum_probs=100.3

Q ss_pred             CCHHHHHHHHHHCCCCEEEE-ECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEE-EECC
Q ss_conf             99899999999749989998-247883348889999988740001367415888348568999998507212897-1016
Q gi|254780438|r   24 PNLVHIGKIALQSGASGLTV-HPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITL-VPDD  101 (261)
Q Consensus        24 P~~~~~a~~~~~~GadgITv-H~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtL-VPe~  101 (261)
                      .+=++.|+...+.|.|-|-+ .|.--     +.|...++.+..... +.++--=+-+..+=++.+.+...+.|++ .|-.
T Consensus        23 eeKl~ia~~L~~lGv~~IE~G~P~~s-----~~d~e~v~~i~~~~~-~~~i~~~~r~~~~di~~~~~a~~~~v~i~~~tS   96 (487)
T PRK09389         23 EEKLEIARKLDELGVDVIEAGSAITS-----KGERESIKLVAEQGL-NAEICSFARALKVDIDAALECDVDSVHLVVPTS   96 (487)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCC-----HHHHHHHHHHHHCCC-CCEEEEECCCCHHHHHHHHHCCCCEEEEEECCC
T ss_conf             99999999999769999997588788-----439999999984799-978998755648769999857979899996268


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEC------CCCCCHHHHHHHHCCCCEEEECCCCCHHHH--HHHH
Q ss_conf             55533357822133378899999862026963899725------444414799997406614651121110244--4356
Q gi|254780438|r  102 PHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFAD------GNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQ  173 (261)
Q Consensus       102 r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFID------pd~~q~~i~~a~~~Gad~VElhTG~Ya~a~--~~~~  173 (261)
                      +-+++.--|++.....+...+.++..++.|.+|....+      |+.-...+++|.+.|||+|=|     |+-.  ..|.
T Consensus        97 ~~h~~~~l~~s~ee~l~~~~~~v~~ak~~g~~v~~~~ED~sr~~~~fl~e~~~~a~~aga~~i~l-----~DTvG~~~P~  171 (487)
T PRK09389         97 DLHIEYKLRKTREEVLEMAVEAVEYAKDHGLIVELSGEDASRADLDFLKELYRAGIEAGADRICF-----CDTVGILTPE  171 (487)
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCC-----CCCCCCCCHH
T ss_conf             99999886799999999999999999974977999210665557799999999999738996224-----8888887999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHH
Q ss_conf             433666889998766541562352078989877
Q gi|254780438|r  174 QERIFLNKLAITAQLAQKMDLQINAGHDLTIQN  206 (261)
Q Consensus       174 ~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~N  206 (261)
                      +....++.+++    ....-|++|+=-|+-+-.
T Consensus       172 ~~~~~i~~l~~----~~~~~i~vH~HND~GlAv  200 (487)
T PRK09389        172 RSYELFKRLSE----SLKIPISIHCHNDFGLAT  200 (487)
T ss_pred             HHHHHHHHHCC----CCCCEEEEEECCCCCHHH
T ss_conf             99999863004----678548997059977799


No 25 
>pfam03932 CutC CutC family. Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF. A mutation in one or more of these genes results in an increased copper sensitivity. Members of this family are between 200 and 300 amino acids in length are found in both eukaryotes and bacteria.
Probab=93.43  E-value=0.85  Score=26.98  Aligned_cols=172  Identities=19%  Similarity=0.181  Sum_probs=103.9

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH-----------HHH---HHHHHHCC
Q ss_conf             9999999974998999824788334888999998874000136741588834856-----------899---99985072
Q gi|254780438|r   27 VHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE-----------TFL---NLCERYKP   92 (261)
Q Consensus        27 ~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~-----------e~i---~ia~~ikP   92 (261)
                      ++-|..|+++|||-|-+--+-+.==.+| +...++..+..  .++|..+=.-|..           .|.   ..+.+..-
T Consensus        10 ~~~a~~A~~~GAdRIELCs~L~~GGlTP-s~~~i~~~~~~--~~ipv~vMIRPR~G~F~Ys~~E~~~M~~dI~~~~~~G~   86 (202)
T pfam03932        10 IESLLAAQAGGADRVELCANLAVGGLTP-SYGVIKSAAQR--AKIPVYVMIRPRGGDFVYSDHELKAMLEDILKAVELGA   86 (202)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCCC-CHHHHHHHHHH--CCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             9999999984999998626766689798-99999999986--59974999842799886498999999999999998698


Q ss_pred             CEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEC--CCCCCHHHHHHHHCCCCEEEECCCCCHHHHH
Q ss_conf             12897101655533357822133378899999862026963899725--4444147999974066146511211102444
Q gi|254780438|r   93 EQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFAD--GNGNEHSLQAAKLTGADCIELYTGPYGACYN  170 (261)
Q Consensus        93 ~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFID--pd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~  170 (261)
                      +-+-+     .-||.+|.+|..    .++..+...+...+----=+|  +||. .+++...++|+++|==.-|+ ..+..
T Consensus        87 ~GvV~-----G~L~~d~~iD~~----~~~~li~~a~~l~~TFHRAfD~~~d~~-~al~~L~~lG~~rILTSGg~-~~a~~  155 (202)
T pfam03932        87 PGVVL-----GALTADGEIDTK----RMEKLIEAAGGLGVTFHRAFDMCPDPE-EALEQLIELGCERVLTSGGP-LSALE  155 (202)
T ss_pred             CEEEE-----EEECCCCCCCHH----HHHHHHHHHCCCCEEEECHHHCCCCHH-HHHHHHHHCCCCEEECCCCC-CCHHH
T ss_conf             97899-----888899982999----999999974688559862043059999-99999997599878757997-87667


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             356433666889998766541562352078989877999997369963884
Q gi|254780438|r  171 NPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEIS  221 (261)
Q Consensus       171 ~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~Evs  221 (261)
                      .       ++.+++..+++.. .+++=+|=|+|.+|++.+++ ...+.|++
T Consensus       156 g-------~~~L~~l~~~a~~-~i~Im~GgGI~~~N~~~l~~-~~g~~~~H  197 (202)
T pfam03932       156 G-------LEKLASLVAQAGG-RISIMAGAGVNAENIAELRQ-LTGVAEVH  197 (202)
T ss_pred             H-------HHHHHHHHHHCCC-CEEEEECCCCCHHHHHHHHH-HHCCCEEE
T ss_conf             4-------9999999996599-84999579989999999999-71994885


No 26 
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional
Probab=93.43  E-value=0.36  Score=29.58  Aligned_cols=124  Identities=19%  Similarity=0.109  Sum_probs=75.9

Q ss_pred             HHHHHHHHHHCCCCEEEEE-----CCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEE---CCCHHHHHHHHHHCCCEEEE
Q ss_conf             8999999997499899982-----478833488899999887400013674158883---48568999998507212897
Q gi|254780438|r   26 LVHIGKIALQSGASGLTVH-----PRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEG---YPNETFLNLCERYKPEQITL   97 (261)
Q Consensus        26 ~~~~a~~~~~~GadgITvH-----~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg---~p~~e~i~ia~~ikP~qvtL   97 (261)
                      .......+.+.|+-.|++.     +|+|        +.+|-+...+.  ....++--   -.++++++...+...+.|.+
T Consensus        52 ~~~~id~l~~~Gv~~v~~tGGEPllr~D--------~~ei~~~a~~~--G~~~~l~TNG~lit~~~a~~L~~~gl~~v~v  121 (375)
T PRK05301         52 WIRVLREARALGVLQLHFSGGEPLLRKD--------LEELVAHARRL--GLYTNLITSGVGLTEARLAALKAAGLDHIQL  121 (375)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCCC--------HHHHHHHHHHC--CCEEEEEECCCCCCHHHHHHHHHHCCCEEEE
T ss_conf             9999999998699889961865245668--------99999999976--9758996067455799999998509988999


Q ss_pred             E-----ECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECC------CCCCHHHHHHHHCCCCEEEECCCCC
Q ss_conf             1-----016555333578221333788999998620269638997254------4441479999740661465112111
Q gi|254780438|r   98 V-----PDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADG------NGNEHSLQAAKLTGADCIELYTGPY  165 (261)
Q Consensus        98 V-----Pe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDp------d~~q~~i~~a~~~Gad~VElhTG~Y  165 (261)
                      =     ||.-+.++-     +.+.+++....++.+++.|++|++-.=.      +.. ..++.+.++|+++++|++=.|
T Consensus       122 SlDg~~~e~hD~~rG-----~~G~f~~~~~~i~~l~~~Gi~v~i~~ti~r~N~~~l~-~i~~la~~lGv~~~~l~~~~~  194 (375)
T PRK05301        122 SFQDSDPELADRIAG-----TRGAFAQKLEVARLVKAHGYPLTLNAVIHRHNIDQIP-RIIELAVELGADRLELANTQY  194 (375)
T ss_pred             ECCCCCHHHHHHHCC-----CCCHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHH-HHHHHHHHCCCCEEEEEEEEE
T ss_conf             567798778777637-----8862999999999999749816999872305688899-999999972998289876567


No 27 
>PRK05581 ribulose-phosphate 3-epimerase; Validated
Probab=93.41  E-value=0.86  Score=26.95  Aligned_cols=162  Identities=15%  Similarity=0.194  Sum_probs=101.2

Q ss_pred             CCCCCCHHHHHHHHCCCCCC--------CCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             53322144322322078868--------9989999999974998999824788334888999998874000136741588
Q gi|254780438|r    4 SVSVNLNAVAVLRNRRNLPW--------PNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNI   75 (261)
Q Consensus         4 ~LsVNidhiAtLRnaRg~~~--------P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNi   75 (261)
                      +++...+.|.-||+-  .+.        =+|..+.....++|||-||+|.---.      |+..+.+.+++.  +.+.-|
T Consensus        45 n~t~g~~~v~~i~~~--t~~~~DvHLMv~~P~~~i~~~~~~g~d~I~~H~Ea~~------~~~~~i~~ik~~--g~k~Gl  114 (220)
T PRK05581         45 NLTIGPPVVEAIRKV--TKLPLDVHLMVENPDRYVPDFAKAGADIITFHVEASE------HIHRLLQLIKEA--GIKAGL  114 (220)
T ss_pred             CCCCCHHHHHHHHHH--CCCCEEEEEEEECHHHHHHHHHHCCCCEEEECCCCCC------CHHHHHHHHHHC--CCCEEE
T ss_conf             556399999999841--8996478999718888799999739988998167502------799999999974--997046


Q ss_pred             EECCCHHH---HHHHHHHCCCEEEEEECCCCCCCCCCCCCHHH-HHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHH
Q ss_conf             83485689---99998507212897101655533357822133-378899999862026963899725444414799997
Q gi|254780438|r   76 EGYPNETF---LNLCERYKPEQITLVPDDPHQLTSDHGWDFLQ-NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAK  151 (261)
Q Consensus        76 Eg~p~~e~---i~ia~~ikP~qvtLVPe~r~elTTegGldv~~-~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~  151 (261)
                      -.+|....   ..+...  =++|.+.--.|+-    +|..+.. -.++++..-+.+.+.+-.+-+-+|-..++..+..+.
T Consensus       115 alnp~T~~~~l~~~l~~--iD~VlvMtV~PGf----~GQ~f~~~~l~ki~~l~~~~~~~~~~~~I~VDGGIn~~~i~~l~  188 (220)
T PRK05581        115 VLNPATPLEYLEYVLPL--LDLVLLMSVNPGF----GGQKFIPEVLEKIREVRKLIDERGLDILIEVDGGVNAENIKECA  188 (220)
T ss_pred             EECCCCCHHHHHHHHHH--HCEEEEEEECCCC----CCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHH
T ss_conf             76699998999999874--1525899865887----87645566999999999999845997559997898989999999


Q ss_pred             HCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             40661465112111024443564336668899987
Q gi|254780438|r  152 LTGADCIELYTGPYGACYNNPQQERIFLNKLAITA  186 (261)
Q Consensus       152 ~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa  186 (261)
                      +.|||.+=.=++-|    +.+. ....++.++++.
T Consensus       189 ~~Gad~~V~GS~iF----~~~d-~~~~i~~lk~~~  218 (220)
T PRK05581        189 EAGADVFVAGSAVF----GAPD-YKEAIDELRAEL  218 (220)
T ss_pred             HCCCCEEEECHHHH----CCCC-HHHHHHHHHHHH
T ss_conf             77999999794885----7999-999999999985


No 28 
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional
Probab=93.25  E-value=0.9  Score=26.79  Aligned_cols=164  Identities=17%  Similarity=0.151  Sum_probs=100.9

Q ss_pred             CCCCCCHHHHHHHHCCCCCCC--------CHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             533221443223220788689--------989999999974998999824788334888999998874000136741588
Q gi|254780438|r    4 SVSVNLNAVAVLRNRRNLPWP--------NLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNI   75 (261)
Q Consensus         4 ~LsVNidhiAtLRnaRg~~~P--------~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNi   75 (261)
                      +++...+-|.-||+.- .+.|        +|..+.....++|||-||+|.-- -.|+. +-+..+++.      +...-+
T Consensus        46 N~t~g~~~v~~ir~~~-~~~~lDvHLMv~~P~~~i~~~~~~gad~I~~H~E~-~~~~~-~~i~~ik~~------g~k~Gl  116 (224)
T PTZ00170         46 NLSFGPPVVSSLRKHL-PNTFLDVHLMVSDPERWVDSFAKAGASQFTFHIEA-TEDPK-AVARKIRAA------GMQVGV  116 (224)
T ss_pred             CCCCCHHHHHHHHHHC-CCCCEEEEEEECCHHHHHHHHHHCCCCEEEECCCC-CCCHH-HHHHHHHHH------CCCEEE
T ss_conf             6574978999999717-99864689986388887999986289679985001-33999-999999971------476455


Q ss_pred             EECCCHHHHHHHH---HHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHH
Q ss_conf             8348568999998---5072128971016555333578221333788999998620269638997254444147999974
Q gi|254780438|r   76 EGYPNETFLNLCE---RYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKL  152 (261)
Q Consensus        76 Eg~p~~e~i~ia~---~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~  152 (261)
                      -.+|...+-.+-.   +-.-++|.+---.|+-    +|=.+   ....-+-++.+++..-...+.+|-..++..+..+.+
T Consensus       117 AlnP~T~i~~l~~~l~~~~iD~VLlMsV~PGf----~GQ~F---i~~~l~KI~~lr~~~~~~~I~VDGGIn~~ti~~l~~  189 (224)
T PTZ00170        117 ALKPKTPAEELFPLIDAGLVDMVLVMTVEPGF----GGQSF---MHDMMPKVRQLRQRYPHLNIQVDGGINPDTIDLAAE  189 (224)
T ss_pred             EECCCCCHHHHHHHHHHCCCCEEEEEEECCCC----CCCCC---CHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHH
T ss_conf             60799987999999711445789998556998----76214---588999999998548997599958999899999998


Q ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             066146511211102444356433666889998766
Q gi|254780438|r  153 TGADCIELYTGPYGACYNNPQQERIFLNKLAITAQL  188 (261)
Q Consensus       153 ~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~  188 (261)
                      .|||.+=.=+.-    |+... .+..++.++++++.
T Consensus       190 aGad~~V~GSai----F~~~d-~~~~i~~lr~~i~~  220 (224)
T PTZ00170        190 AGANVIVAGTSI----FKAND-RKESIETLRRSVQK  220 (224)
T ss_pred             CCCCEEEECHHH----HCCCC-HHHHHHHHHHHHHH
T ss_conf             699999978588----67999-99999999999997


No 29 
>pfam01261 AP_endonuc_2 Xylose isomerase-like TIM barrel. This TIM alpha/beta barrel structure is found in xylose isomerase and in endonuclease IV (EC:3.1.21.2). This domain is also found in the N termini of bacterial myo-inositol catabolism proteins. These are involved in the myo-inositol catabolism pathway, and is required for growth on myo-inositol in Rhizobium leguminosarum bv. viciae.
Probab=93.13  E-value=0.94  Score=26.67  Aligned_cols=150  Identities=17%  Similarity=0.214  Sum_probs=86.2

Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCC
Q ss_conf             99997499899982478833488899999887400013674158883485689999985072128971016555333578
Q gi|254780438|r   31 KIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHG  110 (261)
Q Consensus        31 ~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~r~elTTegG  110 (261)
                      ..+.++|.+||-++.+....=..+..+..+++.+..      .||+..               .++.          -..
T Consensus         2 ~~a~~~G~~~vE~~~~~~~~~~~~~~~~~l~~~~~~------~gl~i~---------------~~~~----------~~~   50 (201)
T pfam01261         2 ELAAELGFDGVELFFDDPRPASDKLEIEELKALLKE------YGLEIT---------------SLNP----------SLG   50 (201)
T ss_pred             HHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHHHH------CCCEEE---------------EEEC----------CCC
T ss_conf             789967999999736887644572589999999997------099799---------------9977----------865


Q ss_pred             CCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             22133378899999862026963899725444414799997406614651121110244435643366688999876654
Q gi|254780438|r  111 WDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQ  190 (261)
Q Consensus       111 ldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~  190 (261)
                      +.. ......+..++.++                +.++.|+++|+..|=+++|.+.......+......+.+++.+.+|.
T Consensus        51 ~~~-~~~~~r~~~~~~~~----------------~~l~~a~~lG~~~i~~~~g~~~~~~~~~~~~~~~~~~l~~~~~~a~  113 (201)
T pfam01261        51 LLE-PDEREREAALEALK----------------RAIELAAALGAKVVVVHPGGALPGEDREEALDRLAESLNELAELAE  113 (201)
T ss_pred             CCC-CCHHHHHHHHHHHH----------------HHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             458-89899999999999----------------9999999739958998268878899999999999999999999887


Q ss_pred             HCCCE----EEECCCC---CHHHHHHHHHHCCC---CEEEEEHHHHHH
Q ss_conf             15623----5207898---98779999973699---638842599999
Q gi|254780438|r  191 KMDLQ----INAGHDL---TIQNIPNLINAIPY---ISEISVGHAFAA  228 (261)
Q Consensus       191 ~lgL~----VnAGHgL---n~~Nl~~~i~~Ip~---I~EvsIGHaiIs  228 (261)
                      +.|+.    -+.+-..   +.+.+..+++.++.   =-.+-+||..+.
T Consensus       114 ~~gi~i~iE~~~~~~~~~~~~~~~~~l~~~v~~~~~~~~~D~~h~~~~  161 (201)
T pfam01261       114 EYGVKLALENHPGTGVELGYFEEALRLIEEVDSPNVGLCLDTGHAFAA  161 (201)
T ss_pred             HCCEEEEEEECCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHC
T ss_conf             557389999879988678999999999986499865511056899981


No 30 
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases; InterPro: IPR011830   Methanogenic archaea contain three closely related homologs of the 2-isopropylmalate synthases (LeuA) represented by IPR005671 from INTERPRO. Two of these in Methanococcus janaschii (MJ1392 - CimA ; MJ0503 - AksA ) have been characterised as catalyzing alternative reactions leaving the third (MJ1195) as the presumptive LeuA enzyme. CimA is citramalate (2-methylmalate) synthase, which condenses acetyl-CoA with pyruvate. This enzyme is believed to be involved in the biosynthesis of isoleucine in methanogens and possibly other species lacking threonine dehydratase. AksA is a homocitrate synthase which also produces (homo)2-citrate and (homo)3-citrate in the biosynthesis of Coenzyme B which is restricted solely to methanogenic archaea. Methanogens, then should and apparently do contain all three of these enzymes. Unfortunately, phylogenetic trees do not resolve into three unambiguous clades, making assignment of function to particular genes problematic. Other archaea, which lack a threonine dehydratase (mainly Euryarchaeota), should contain both CimA and LeuA genes. This is true for archaeoglobus fulgidis, but not for the Pyrococci which have none in this clade, but one in IPR005671 from INTERPRO and one in IPR005675 from INTERPRO which may fulfil these roles. Proteins from other species, which have only one hit to this entry and lack threonine dehydratase, are very likely to be LeuA enzymes.; GO: 0046912 transferase activity transferring acyl groups acyl groups converted into alkyl on transfer, 0019752 carboxylic acid metabolic process.
Probab=92.88  E-value=0.34  Score=29.76  Aligned_cols=89  Identities=18%  Similarity=0.265  Sum_probs=56.1

Q ss_pred             CCCCCHHHHHH--HHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEEC--CCCCHHHHHHH-HHHHHHHHHH
Q ss_conf             57822133378--8999998620269638997254444147999974066146511--21110244435-6433666889
Q gi|254780438|r  108 DHGWDFLQNQA--LLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELY--TGPYGACYNNP-QQERIFLNKL  182 (261)
Q Consensus       108 egGldv~~~~~--~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElh--TG~Ya~a~~~~-~~~~~el~~i  182 (261)
                      |-|+-+.+..+  -.|.+.+.. ..+..+.=|.=+.+.  +|+.|.++|+|+|=+.  |-|.=-.|.-+ +....-|++.
T Consensus        40 EAGfpi~S~GE~~aiK~I~~~v-GLnAEI~~l~RA~k~--DID~AidcgvdsIh~fiaTSpiH~KYKl~~K~~devle~~  116 (371)
T TIGR02090        40 EAGFPIASEGEFEAIKKIAEEV-GLNAEICSLARALKK--DIDKAIDCGVDSIHTFIATSPIHLKYKLKNKSRDEVLEKA  116 (371)
T ss_pred             ECCCCCCCHHHHHHHHHHHHHC-CCCEEEEEEECCCCC--CHHHHHHCCCCEEEEEECCCHHHHHCCCCCCCHHHHHHHH
T ss_conf             5476314514578999999862-896355101026731--0015643698778998048857872348887899999999


Q ss_pred             HHHHHHHHHCCCEEEEC
Q ss_conf             99876654156235207
Q gi|254780438|r  183 AITAQLAQKMDLQINAG  199 (261)
Q Consensus       183 ~~aa~~A~~lgL~VnAG  199 (261)
                      .+|.+||++.||.|-=+
T Consensus       117 veAvEYAKEHGLiVEfS  133 (371)
T TIGR02090       117 VEAVEYAKEHGLIVEFS  133 (371)
T ss_pred             HHHHHHHHHCCCEEEEC
T ss_conf             99898775257355317


No 31 
>pfam00682 HMGL-like HMGL-like. This family contains a diverse set of enzymes. These include various aldolases and a region of pyruvate carboxylase.
Probab=92.84  E-value=1  Score=26.40  Aligned_cols=170  Identities=13%  Similarity=0.129  Sum_probs=102.2

Q ss_pred             CHHHHHHHHHHCCCCEEEE-ECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEC----CCHHHHHHHHHHCCCEEEEE-
Q ss_conf             9899999999749989998-24788334888999998874000136741588834----85689999985072128971-
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTV-HPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGY----PNETFLNLCERYKPEQITLV-   98 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITv-H~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~----p~~e~i~ia~~ikP~qvtLV-   98 (261)
                      +-+..+....++|.+.|-| +|.     ..++|+..++.+.. ..++.++.-=..    +.+..++.+.+...+.++++ 
T Consensus        15 ~K~~i~~~L~~~Gv~~IEvg~~~-----~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~e~~~~~g~~~i~i~~   88 (237)
T pfam00682        15 EKLAIARALDEAGVDEIEVGFPF-----MSPTDFESVRAIAE-VLKKAKIQALLRPVEHDIDAAVEAAKGAGADRVHVFI   88 (237)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCC-----CCCCHHHHHHHHHH-HCCCCCCCCEEECCCHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             99999999998498989995775-----89735999997765-0258751010003410499999999967999999961


Q ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEE------CCCCCCHHHHHHHHCCCCEEEEC-CCCCHHHHHH
Q ss_conf             0165553335782213337889999986202696389972------54444147999974066146511-2111024443
Q gi|254780438|r   99 PDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFA------DGNGNEHSLQAAKLTGADCIELY-TGPYGACYNN  171 (261)
Q Consensus        99 Pe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFI------Dpd~~q~~i~~a~~~Gad~VElh-TG~Ya~a~~~  171 (261)
                      |-.....-..-|++.....+.+++++...++.|++|++..      |++.-.+.++.+.+.|+|+|-|- |--+    ..
T Consensus        89 ~~se~~~~~n~~~s~~~~l~~~~~~i~~a~~~g~~v~f~~~~~~~~~~~~~~~~~~~~~~~G~~~i~l~DT~G~----~~  164 (237)
T pfam00682        89 ATSDLHRKYKLNKDREEVADRAVAAVEAARSAGIDVELGCEDAGRTDLAFLIEVVEVAQEAGATRINIADTVGV----LT  164 (237)
T ss_pred             ECCHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCC----CC
T ss_conf             05787899885789999999999999999986990588405123247889999999998619857973686455----79


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCEEEE--CCCCCHHHH
Q ss_conf             564336668899987665415623520--789898779
Q gi|254780438|r  172 PQQERIFLNKLAITAQLAQKMDLQINA--GHDLTIQNI  207 (261)
Q Consensus       172 ~~~~~~el~~i~~aa~~A~~lgL~VnA--GHgLn~~Nl  207 (261)
                      |.+....+..+++..   .+.-+.+|.  --||-.-|.
T Consensus       165 P~~v~~lv~~l~~~~---~~~~i~~H~Hn~~Gla~aN~  199 (237)
T pfam00682       165 PNEAADLISALKDRV---PPVIIEVHCHNDLGMAVANS  199 (237)
T ss_pred             HHHHHHHHHHHHHCC---CCCCEEEEECCCCCHHHHHH
T ss_conf             899999999999708---98715887448867299999


No 32 
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes.
Probab=92.71  E-value=1.1  Score=26.27  Aligned_cols=18  Identities=22%  Similarity=0.204  Sum_probs=11.4

Q ss_pred             HHHHHHCCCCEEEECCCC
Q ss_conf             999974066146511211
Q gi|254780438|r  147 LQAAKLTGADCIELYTGP  164 (261)
Q Consensus       147 i~~a~~~Gad~VElhTG~  164 (261)
                      -..|++.|+|.||||.+.
T Consensus       158 A~ra~~AGfDgVEiHaaH  175 (338)
T cd02933         158 ARNAIEAGFDGVEIHGAN  175 (338)
T ss_pred             HHHHHHCCCCEEEEECCC
T ss_conf             999998399999982244


No 33 
>pfam01207 Dus Dihydrouridine synthase (Dus). Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also in some archae. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. It is likely that different family members have different substrate specificities, which may overlap. Dus 1 from Saccharomyces cerevisiae acts on pre-tRNA-Phe, while Dus 2 acts on pre-tRNA-Tyr and pre-tRNA-Leu. Dus 1 is active as a single subunit, requiring NADPH or NADH, and is stimulated by the presence of FAD. Some family members may be targeted to the mitochondria and even have a role in mitochondria.
Probab=92.67  E-value=0.41  Score=29.15  Aligned_cols=195  Identities=11%  Similarity=0.134  Sum_probs=100.3

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCC--HHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHH---CCCEEEE---EE
Q ss_conf             99999997499899982478833488--8999998874000136741588834856899999850---7212897---10
Q gi|254780438|r   28 HIGKIALQSGASGLTVHPRPDQRHIR--YTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERY---KPEQITL---VP   99 (261)
Q Consensus        28 ~~a~~~~~~GadgITvH~R~DrRHI~--~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~i---kP~qvtL---VP   99 (261)
                      .|=.+|.+.|+..++.-+==--+.+.  ......+........ .+-+-|=|+--+.|.+-+..+   ..+.+=|   -|
T Consensus        12 ~fR~l~~~~g~~~l~~TEmv~a~~l~~~~~~~~~~~~~~~~e~-P~~~Ql~G~dp~~~~~aa~~~~~~g~d~IDlN~GCP   90 (309)
T pfam01207        12 PFRRLVREYGAGDLVVTEMVTAKAQLRPEKQRELMLPELEEPT-PLAVQLGGSDPALLAEAAKLVADLGADIIDINMGCP   90 (309)
T ss_pred             HHHHHHHHHCCCCEEEECCEEEHHHHCCCHHHHHHCCCCCCCC-CEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             9999999979592999798997135438875887420076789-728999369999999999998863999896518999


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CCEEEEE----ECCCCC--CHHHHHHHHCCCCEEEECCCCCHHHHHHH
Q ss_conf             1655533357822133378899999862026-9638997----254444--14799997406614651121110244435
Q gi|254780438|r  100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNL-GSRISLF----ADGNGN--EHSLQAAKLTGADCIELYTGPYGACYNNP  172 (261)
Q Consensus       100 e~r~elTTegGldv~~~~~~L~~~i~~l~~~-girvSLF----IDpd~~--q~~i~~a~~~Gad~VElhTG~Ya~a~~~~  172 (261)
                      -+.- .....|=-+.++.+.+.++++.+++. ++.||.=    .|.+.+  ..-++.+.+.|++.|-+|-=.-...|..+
T Consensus        91 ~~~v-~~~g~GsaLl~~p~~~~~iv~a~~~~~~~PVtvK~RlG~d~~~~~~~~~~~~l~~~G~~~itvH~Rt~~q~~~g~  169 (309)
T pfam01207        91 AKKV-TRGGAGAALLRDPDLVAQIVKAVVKAVDIPVTVKIRIGWDESHENAVEIARRVEDAGAQALTVHGRTRAQNYEGP  169 (309)
T ss_pred             HHHH-CCCCCCEEHHHCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCHHHCCCCC
T ss_conf             9998-789977625417789999999999755885467543378876388999999998468887999676324026786


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHH
Q ss_conf             64336668899987665415623520789898779999973699638842599999999
Q gi|254780438|r  173 QQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATAL  231 (261)
Q Consensus       173 ~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl  231 (261)
                      .... .+.++++    +.+.-+-.| |-=.+++-....++ -...+-|=||-..+.+--
T Consensus       170 a~w~-~i~~~k~----~~~ipvi~N-Gdi~~~~d~~~~l~-~tg~dgvMigRga~~nPw  221 (309)
T pfam01207       170 ADWD-AIKQVKQ----AVSIPVIAN-GDITDAEDAQRCLS-YTGADGVMIGRGALGNPW  221 (309)
T ss_pred             CCHH-HHHHHHH----HCCCCEEEE-CCCCCHHHHHHHHH-HHCCCEEEECHHHHHCCH
T ss_conf             5418-9999998----589828980-89488999999986-109999998489774988


No 34 
>PRK07094 biotin synthase; Provisional
Probab=92.59  E-value=1.1  Score=26.17  Aligned_cols=134  Identities=15%  Similarity=0.198  Sum_probs=81.8

Q ss_pred             CHHHHHHHHHHCC---CEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCC-CCCEEEEEECCCCCCHHHHHHHHCCC
Q ss_conf             5689999985072---1289710165553335782213337889999986202-69638997254444147999974066
Q gi|254780438|r   80 NETFLNLCERYKP---EQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHN-LGSRISLFADGNGNEHSLQAAKLTGA  155 (261)
Q Consensus        80 ~~e~i~ia~~ikP---~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~-~girvSLFIDpd~~q~~i~~a~~~Ga  155 (261)
                      .+|+++.|...+-   ..+||          -+|+|-....+.+..+++.+|+ .++.+.+-+- ..+..+.+..++.|+
T Consensus        72 ~eeI~~~A~~a~~~G~~~~~l----------qsG~~~~~~~e~~~~ii~~Ik~~~~l~i~lSlG-~l~~e~~~~Lk~AG~  140 (323)
T PRK07094         72 PEEILECAKKAYELGYGTIVL----------QSGEDPYYTDEKIADIIKEIKKELDVAITLSLG-ERSYEEYKAWKEAGA  140 (323)
T ss_pred             HHHHHHHHHHHHHCCCCEEEE----------ECCCCCCCCHHHHHHHHHHHHHCCCCEEEEECC-CCCHHHHHHHHHCCC
T ss_conf             999999999999869988999----------648998866999999999986059945997578-799999999998597


Q ss_pred             CEEEECCCCCHHH-HHHHHHHHHHHHHHHHHHHHHHHCCCEEEE----CC-CCCHHHHH---HHHHHCCCCEEEEEHHHH
Q ss_conf             1465112111024-443564336668899987665415623520----78-98987799---999736996388425999
Q gi|254780438|r  156 DCIELYTGPYGAC-YNNPQQERIFLNKLAITAQLAQKMDLQINA----GH-DLTIQNIP---NLINAIPYISEISVGHAF  226 (261)
Q Consensus       156 d~VElhTG~Ya~a-~~~~~~~~~el~~i~~aa~~A~~lgL~VnA----GH-gLn~~Nl~---~~i~~Ip~I~EvsIGHai  226 (261)
                      |+.=+.-..+... |.+-.... .++.=.++.+.++++|++|.+    || |=+.+.+.   .+++.+. ++.+-||-|+
T Consensus       141 dry~~nlETs~~~~y~~i~p~~-t~~~Rl~~l~~~k~~G~~v~sG~iiGlpGET~edr~~~l~~LreL~-~~~v~i~~fi  218 (323)
T PRK07094        141 DRYLLRHETADRELYEKLHPGM-SFENRIQCLKDLKELGYEVGSGFMVGLPGQTLEDLADDILFLKELD-LDMIGIGPFI  218 (323)
T ss_pred             CEEECCCCCCCHHHHCCCCCCC-CHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHHCC-CCEECCCCCC
T ss_conf             7441245656989867758999-9899999999999839810430277989999999999999998379-9886772551


No 35 
>COG5012 Predicted cobalamin binding protein [General function prediction only]
Probab=92.02  E-value=0.33  Score=29.81  Aligned_cols=68  Identities=19%  Similarity=0.251  Sum_probs=50.8

Q ss_pred             CCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCE
Q ss_conf             48568999998507212897101655533357822133378899999862026963899725444414799997406614
Q gi|254780438|r   78 YPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADC  157 (261)
Q Consensus        78 ~p~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~  157 (261)
                      -|.++|++.|.+.||+.|.+-           .|- .......+.+++.|++.|+|-++-+=-...-.+-++++++|+|+
T Consensus       142 vP~e~fve~a~e~k~d~v~~S-----------alM-Tttm~~~~~viE~L~eeGiRd~v~v~vGGApvtq~~a~~iGAD~  209 (227)
T COG5012         142 VPVEEFVEKAKELKPDLVSMS-----------ALM-TTTMIGMKDVIELLKEEGIRDKVIVMVGGAPVTQDWADKIGADA  209 (227)
T ss_pred             CCHHHHHHHHHHCCCCEEECH-----------HHH-HHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHCCCC
T ss_conf             987999999997287566406-----------877-88799799999999976885474885268624689999718775


No 36 
>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism]
Probab=91.48  E-value=1.4  Score=25.42  Aligned_cols=107  Identities=21%  Similarity=0.191  Sum_probs=70.5

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEE--ECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             55333578221333788999998620269638997--2544441479999740661465112111024443564336668
Q gi|254780438|r  103 HQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLF--ADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN  180 (261)
Q Consensus       103 ~elTTegGldv~~~~~~L~~~i~~l~~~girvSLF--IDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~  180 (261)
                      .-+|+||-+|.    ..+.+.+..-...++----=  .=|||. .+++...++|+.||=-+-|+ +.+..       -+.
T Consensus        93 G~lt~dg~iD~----~~le~Li~aA~gL~vTFHrAFD~~~d~~-~ale~li~~Gv~RILTsGg~-~sa~e-------g~~  159 (241)
T COG3142          93 GALTADGNIDM----PRLEKLIEAAGGLGVTFHRAFDECPDPL-EALEQLIELGVERILTSGGK-ASALE-------GLD  159 (241)
T ss_pred             EEECCCCCCCH----HHHHHHHHHCCCCCEEEEHHHHHCCCHH-HHHHHHHHCCCCEEECCCCC-CCHHH-------HHH
T ss_conf             54668986388----9999999870687624316656337999-99999997697378647886-75556-------079


Q ss_pred             HHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHH
Q ss_conf             89998766541562352078989877999997369963884259
Q gi|254780438|r  181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGH  224 (261)
Q Consensus       181 ~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGH  224 (261)
                      .+++..++|+ -.+.+-+|-|.+.+|+..|.. .-.+.|++-.-
T Consensus       160 ~l~~li~~a~-gri~Im~GaGV~~~N~~~l~~-~tg~~e~H~s~  201 (241)
T COG3142         160 LLKRLIEQAK-GRIIIMAGAGVRAENIAELVL-LTGVTEVHGSA  201 (241)
T ss_pred             HHHHHHHHHC-CCEEEEECCCCCHHHHHHHHH-HCCCHHHHHCC
T ss_conf             9999999836-987998679889899999998-50803200024


No 37 
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE). This enzyme catalyses the interconversion of D-ribulose 5-phosphate (Ru5P) into D-xylulose 5-phosphate, as part of the Calvin cycle (reductive pentose phosphate pathway) in chloroplasts and in the oxidative pentose phosphate pathway. In the Calvin cycle Ru5P is phosphorylated by phosphoribulose kinase to ribulose-1,5-bisphosphate, which in turn is used by RubisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase) to incorporate CO2 as the central step in carbohydrate synthesis.
Probab=91.23  E-value=1.6  Score=25.15  Aligned_cols=146  Identities=16%  Similarity=0.186  Sum_probs=94.4

Q ss_pred             CCCCCCHHHHHHHHCCCCCCC--------CHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             533221443223220788689--------989999999974998999824788334888999998874000136741588
Q gi|254780438|r    4 SVSVNLNAVAVLRNRRNLPWP--------NLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNI   75 (261)
Q Consensus         4 ~LsVNidhiAtLRnaRg~~~P--------~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNi   75 (261)
                      +++...+-|.-||+--  +.|        +|..+.....++|||-||+|.---      .|+..+-+.+++.  +.+.-|
T Consensus        41 n~t~g~~~v~~i~~~t--~~~~DvHLMv~~P~~~i~~~~~~g~d~I~~H~E~~------~~~~~~i~~ik~~--g~~~Gl  110 (211)
T cd00429          41 NLTFGPPVVKALRKHT--DLPLDVHLMVENPERYIEAFAKAGADIITFHAEAT------DHLHRTIQLIKEL--GMKAGV  110 (211)
T ss_pred             CCCCCHHHHHHHHHHC--CCCEEEEEEECCHHHHHHHHHHHCCCEEEECCCCC------CCHHHHHHHHHHC--CCCCEE
T ss_conf             6675989999998757--99705899871887769999970998899864322------0899999999973--987235


Q ss_pred             EECCCH---HHHHHHHHHCCCEEEEEECCCCCCCCCCCCCH-HHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHH
Q ss_conf             834856---89999985072128971016555333578221-33378899999862026963899725444414799997
Q gi|254780438|r   76 EGYPNE---TFLNLCERYKPEQITLVPDDPHQLTSDHGWDF-LQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAK  151 (261)
Q Consensus        76 Eg~p~~---e~i~ia~~ikP~qvtLVPe~r~elTTegGldv-~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~  151 (261)
                      -.+|..   .+..+...  -+.|.+.--.|+-    +|=.+ ..-.++++..-+.+.+.+-.+.+-+|-..++..+...+
T Consensus       111 al~p~T~~~~l~~~l~~--~D~vliMtV~PGf----~GQ~f~~~~~~ki~~l~~~~~~~~~~~~I~vDGGI~~~~i~~l~  184 (211)
T cd00429         111 ALNPGTPVEVLEPYLDE--VDLVLVMSVNPGF----GGQKFIPEVLEKIRKLRELIPENNLNLLIEVDGGINLETIPLLA  184 (211)
T ss_pred             EECCCCCHHHHHHHHHH--HCEEEEEEECCCC----CCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHH
T ss_conf             75489998999999975--1522798746887----88754567999999999999864998599996785989999999


Q ss_pred             HCCCCEEEECCCCC
Q ss_conf             40661465112111
Q gi|254780438|r  152 LTGADCIELYTGPY  165 (261)
Q Consensus       152 ~~Gad~VElhTG~Y  165 (261)
                      +.|||.+=.=++-|
T Consensus       185 ~~Gad~~V~GS~iF  198 (211)
T cd00429         185 EAGADVLVAGSALF  198 (211)
T ss_pred             HCCCCEEEECHHHH
T ss_conf             85999999793775


No 38 
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional
Probab=91.23  E-value=1.6  Score=25.15  Aligned_cols=121  Identities=13%  Similarity=0.150  Sum_probs=57.8

Q ss_pred             HHHHHHHHHHHHCCCCCEE--EEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             3788999998620269638--99725444414799997406614651121110244435643366688999876654156
Q gi|254780438|r  116 NQALLTKTVARLHNLGSRI--SLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMD  193 (261)
Q Consensus       116 ~~~~L~~~i~~l~~~girv--SLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lg  193 (261)
                      ....++..++..++.|..+  .|+=.++.+  ..+...++|++.+-+|+|.=+..... .....+++++++.+    ..|
T Consensus        91 ~~~Ti~~~~~~A~~~g~~v~vdl~~~~~~e--~a~~~~~lgv~~~i~H~~~D~~~~g~-~~~~~~~~~ik~l~----~~~  163 (216)
T PRK13306         91 HIPTIKAALKVAKEFNGEIQIELYGNWTWE--QAQQWRDAGIQQVIYHRSRDAELAGV-AWGEKDLNKVKKLS----DMG  163 (216)
T ss_pred             CHHHHHHHHHHHHHHCCEEEEEEECCCCHH--HHHHHHHCCCCEEEEECCHHHHHCCC-CCCHHHHHHHHHHH----CCC
T ss_conf             979999999999980983699973787788--89999976998788760322442467-88877899999976----369


Q ss_pred             CEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2352078989877999997369963884259999999994099999999999974
Q gi|254780438|r  194 LQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQ  248 (261)
Q Consensus       194 L~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~~  248 (261)
                      .+|-.-=|.+.+++..+. .++ .+=+-+|-+|..-   ---.++.+++++.|++
T Consensus       164 ~~vaVaGGI~~~~~~~~~-~~~-~~ivIVGraIt~a---~dP~~aA~~i~~~I~~  213 (216)
T PRK13306        164 FKVSVTGGIVPEDLKLFK-GIP-IKTFIAGRAIRGA---KDPAEAARAFKDEIAK  213 (216)
T ss_pred             CEEEECCCCCHHHHHHHH-CCC-CCEEEECCCCCCC---CCHHHHHHHHHHHHHH
T ss_conf             829985998989999986-279-9899988523589---9999999999999998


No 39 
>PRK04452 acetyl-CoA decarbonylase/synthase complex subunit delta; Provisional
Probab=91.14  E-value=1.6  Score=25.10  Aligned_cols=159  Identities=16%  Similarity=0.082  Sum_probs=96.9

Q ss_pred             HHHHHCCCCCCCCHHHHHHHHHH-CCCCEEEEECCCCCCCCCHHHHHHHHHHHCC--CCCCCEEEEEECCCHH----HH-
Q ss_conf             22322078868998999999997-4998999824788334888999998874000--1367415888348568----99-
Q gi|254780438|r   13 AVLRNRRNLPWPNLVHIGKIALQ-SGASGLTVHPRPDQRHIRYTDLPEIRRLIDE--QFPKAELNIEGYPNET----FL-   84 (261)
Q Consensus        13 AtLRnaRg~~~P~~~~~a~~~~~-~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~--~~~~~elNiEg~p~~e----~i-   84 (261)
                      +.+++.=+.-.-||.+.|+.|++ +|||.|++|+---..-..++...+..++++.  .--++||=|.|.-+++    .+ 
T Consensus        64 ~~~~~~~~dv~~dp~~wAKk~v~~~gaD~I~l~l~s~dP~~~d~s~~e~a~~vk~V~~av~vPLIi~G~~n~ekD~evl~  143 (322)
T PRK04452         64 EAVKEPFGDVMNDPAAWAKKCVEKYGADMITLHLISTDPNGKDKSPEEAAKTVEEVLQAVDVPLIIGGSGNPEKDAEVLE  143 (322)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHH
T ss_conf             99999864552299999999998718878999941588776768999999999999975699989976788543899999


Q ss_pred             HHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEE--EEEECCCCCCHHHH-HHHHCCCC--EEE
Q ss_conf             99985072128971016555333578221333788999998620269638--99725444414799-99740661--465
Q gi|254780438|r   85 NLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRI--SLFADGNGNEHSLQ-AAKLTGAD--CIE  159 (261)
Q Consensus        85 ~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girv--SLFIDpd~~q~~i~-~a~~~Gad--~VE  159 (261)
                      ..+....-..|.|-+-.               .+..+.+.......|..|  |-.+|.|.. |++. ...++|..  .|=
T Consensus       144 ~~ae~~~g~~~Ll~~a~---------------~~nyk~i~~aAl~y~h~V~a~sp~DiNla-KqLNi~l~e~Gv~~e~IV  207 (322)
T PRK04452        144 KAAEAAEGERCLLGSAE---------------LDNYKKIAAAALAYGHAVIAWSPLDINLA-KQLNILLMKLGLPRERIV  207 (322)
T ss_pred             HHHHHHCCCCCEEEECH---------------HHHHHHHHHHHHHCCCCEEEECCCCHHHH-HHHHHHHHHCCCCHHHEE
T ss_conf             99997478671772432---------------44099999999973992899777677889-999999998499867677


Q ss_pred             ECCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             11211102444356433666889998766
Q gi|254780438|r  160 LYTGPYGACYNNPQQERIFLNKLAITAQL  188 (261)
Q Consensus       160 lhTG~Ya~a~~~~~~~~~el~~i~~aa~~  188 (261)
                      +.-|.++--|.-.--.. -+++++.+|-.
T Consensus       208 mDP~t~alGYGlEys~s-~meRiR~aAL~  235 (322)
T PRK04452        208 MDPTTGALGYGLEYSYS-VMERIRLAALK  235 (322)
T ss_pred             ECCCCCCCCCCHHHHHH-HHHHHHHHHHC
T ss_conf             87775445764677899-99999998855


No 40 
>TIGR02631 xylA_Arthro xylose isomerase; InterPro: IPR013453    This is an enzyme which as well as interconverting D-xylose and D-xylulose, is also active as a D-glucose isomerase. It is tetrameric and dependent on a divalent cation, either Mg2+, Co2+ or Mn2+, as characterised in Arthrobacter . Enzymes in this entry differ substantially from the D-xylose isomerases of IPR013452 from INTERPRO.; GO: 0009045 xylose isomerase activity.
Probab=90.64  E-value=1.3  Score=25.72  Aligned_cols=159  Identities=19%  Similarity=0.275  Sum_probs=95.6

Q ss_pred             CCCHHHHHHHHHHCCCCEEEEE-----CCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEE
Q ss_conf             8998999999997499899982-----47883348889999988740001367415888348568999998507212897
Q gi|254780438|r   23 WPNLVHIGKIALQSGASGLTVH-----PRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITL   97 (261)
Q Consensus        23 ~P~~~~~a~~~~~~GadgITvH-----~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtL   97 (261)
                      .=||+++.+..-+.||.|||.|     |+.-..--+++=|...++-+.    .+=|-+=|..+.=|-.=           
T Consensus        31 ~LDPv~~V~kLAElGAyGv~fHD~DLiPfg~~~~~R~~~v~~F~~ALd----~TGl~VPMvTtNLF~~P-----------   95 (390)
T TIGR02631        31 ALDPVEAVHKLAELGAYGVTFHDDDLIPFGASEAERDKIVKRFKKALD----ETGLKVPMVTTNLFSHP-----------   95 (390)
T ss_pred             CCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH----HCCCCCCCHHHHHCCCC-----------
T ss_conf             466489999988630024542136668898887789999999999888----45965441011002577-----------


Q ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHH-H-HHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             10165553335782213337889999-9-862026963899725444414799997406614651121110244435643
Q gi|254780438|r   98 VPDDPHQLTSDHGWDFLQNQALLTKT-V-ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE  175 (261)
Q Consensus        98 VPe~r~elTTegGldv~~~~~~L~~~-i-~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~  175 (261)
                             +=-|||+--.  ...++.+ + +.|+                 .|+++.|+||..-=+.-|.=..-++..+..
T Consensus        96 -------vFKDGgFTsn--Dr~vR~yAlrK~l~-----------------~~DL~aElGA~~~V~WgGREGaE~~~~kd~  149 (390)
T TIGR02631        96 -------VFKDGGFTSN--DRSVRRYALRKVLR-----------------NIDLAAELGAETYVVWGGREGAEYDGAKDV  149 (390)
T ss_pred             -------CCCCCCCCCC--CHHHHHHHHHHHHH-----------------HHHHHHHCCCEEEEECCCCCCCCCHHHHHH
T ss_conf             -------4337775688--77899999999987-----------------520233115403765388454311015789


Q ss_pred             HHHHHHHHHH----HHHHHHCCCE------------------EEECCCCCHHHHHHHHHHCCCCEEEE--EHHHH
Q ss_conf             3666889998----7665415623------------------52078989877999997369963884--25999
Q gi|254780438|r  176 RIFLNKLAIT----AQLAQKMDLQ------------------INAGHDLTIQNIPNLINAIPYISEIS--VGHAF  226 (261)
Q Consensus       176 ~~el~~i~~a----a~~A~~lgL~------------------VnAGHgLn~~Nl~~~i~~Ip~I~Evs--IGHai  226 (261)
                      ...+.+++++    +.|+.+.|-+                  --+||.|-+-.  . +. -|++-=+|  +||--
T Consensus       150 ~~alDr~rEa~~~~a~Y~~d~GY~~rfA~EPKPNEPRGDI~lpTvG~~lAFi~--~-Le-rpe~~G~NpE~gHE~  220 (390)
T TIGR02631       150 RAALDRMREALDLLAEYVEDQGYGLRFALEPKPNEPRGDILLPTVGHALAFIE--E-LE-RPELFGLNPETGHEQ  220 (390)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCEECCCCCCCCCCCCCHHHHHHHHHHHH--H-CC-CCCEECCCCCCCHHH
T ss_conf             99999998999999877752377752321578657875301434657899987--5-05-887411475410244


No 41 
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain. Members of this family catalyze the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also in some archaea. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. It is likely that different family members have different substrate specificities, which may overlap. 1VHN, a putative flavin oxidoreductase, has high sequence similarity to DUS.  The enzymatic mechanism of 1VHN is not known at the present.
Probab=90.58  E-value=1.3  Score=25.70  Aligned_cols=197  Identities=12%  Similarity=0.130  Sum_probs=104.3

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCC--HHHHHHHHHHHCCCCCCCEE--EEEECCCHHHHHHHHHHCCCEEEEE-----
Q ss_conf             99999997499899982478833488--89999988740001367415--8883485689999985072128971-----
Q gi|254780438|r   28 HIGKIALQSGASGLTVHPRPDQRHIR--YTDLPEIRRLIDEQFPKAEL--NIEGYPNETFLNLCERYKPEQITLV-----   98 (261)
Q Consensus        28 ~~a~~~~~~GadgITvH~R~DrRHI~--~~Dv~~l~~~~~~~~~~~el--NiEg~p~~e~i~ia~~ikP~qvtLV-----   98 (261)
                      .|=.+|.+.|+| ++.-+=---+.+.  ......+.....   ...++  -|=|+--+.|.+-+..+.+..+..|     
T Consensus        14 ~fR~l~~~~g~~-~~~TEmv~a~~~~~~~~~~~~~~~~~~---~e~p~~~Ql~g~~p~~~~~aa~~~~~~g~d~IDlN~G   89 (231)
T cd02801          14 PFRLLCRRYGAD-LVYTEMISAKALLRGNRKRLRLLTRNP---EERPLIVQLGGSDPETLAEAAKIVEELGADGIDLNMG   89 (231)
T ss_pred             HHHHHHHHHCCC-EEEECCEEEHHHHCCCHHHHHHHCCCC---CCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             999999998939-899798998776538887898724486---6780799875898999999999887539999998389


Q ss_pred             -ECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CCEEEEEE----CCC-CCCHHHHHHHHCCCCEEEECCCCCHHHHHH
Q ss_conf             -01655533357822133378899999862026-96389972----544-441479999740661465112111024443
Q gi|254780438|r   99 -PDDPHQLTSDHGWDFLQNQALLTKTVARLHNL-GSRISLFA----DGN-GNEHSLQAAKLTGADCIELYTGPYGACYNN  171 (261)
Q Consensus        99 -Pe~r~elTTegGldv~~~~~~L~~~i~~l~~~-girvSLFI----Dpd-~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~  171 (261)
                       |-++ -.-...|--+.++.+.+.++++.+++. ++.||.=+    |.+ ....-++...+.|++.+=+|-=.-..-|..
T Consensus        90 CP~~~-v~~~g~Ga~Ll~~p~~v~~iv~~~~~~~~ipVsvKiRlg~~~~~~~~~~~~~l~~~G~~~ltvH~Rt~~q~~~~  168 (231)
T cd02801          90 CPSPK-VTKGGAGAALLKDPELVAEIVRAVREAVPIPVTVKIRLGWDDEEETLELAKALEDAGASALTVHGRTREQRYSG  168 (231)
T ss_pred             CCHHH-HCCCCCCHHHHHCHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCHHHCCCC
T ss_conf             99699-70898307876297899999999997569947999970778634799999999976998999835614414677


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHH-HHHHHHH
Q ss_conf             5643366688999876654156235207898987799999736996388425999999-9994099
Q gi|254780438|r  172 PQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAAT-ALECGVK  236 (261)
Q Consensus       172 ~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIse-Al~~GL~  236 (261)
                      +-.    ++.+++..+ +.+.-+-.|-| =.+++....+++ .-..+-|-||-..+.+ .+|..++
T Consensus       169 ~a~----~e~i~~~~~-~~~ipvi~NGd-I~s~~d~~~~~~-~tg~dgvMigRgal~nP~iF~~i~  227 (231)
T cd02801         169 PAD----WDYIAEIKE-AVSIPVIANGD-IFSLEDALRCLE-QTGVDGVMIGRGALGNPWLFREIK  227 (231)
T ss_pred             CCC----HHHHHHHHH-CCCCEEEEECC-CCCHHHHHHHHH-HHCCCEEEECHHHHHCCHHHHHHH
T ss_conf             622----699999986-59977998389-099999999998-509999998788876988999999


No 42 
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain.  DCR in E. coli  is an iron-sulfur flavoenzyme which contains FMN, FAD, and a 4Fe-4S cluster. It is also a monomer, unlike that of its eukaryotic counterparts which form homotetramers and lack the flavin and iron-sulfur cofactors. Metabolism of unsaturated fatty acids requires auxiliary enzymes in addition to those used in b-oxidation. After a given number of cycles through the b-oxidation pathway, those unsaturated fatty acyl-CoAs with double bonds at even-numbered carbon positions contain 2-trans, 4-cis double bonds that can not be modified by enoyl-CoA hydratase. DCR utilizes NADPH to remove the C4-C5 double bond. DCR can catalyze the reduction of both natural fatty acids with cis double bonds, as well as substrates containing trans double bonds. The reaction is initiated by hybrid transfer from NADPH to FAD, which in turn transfers electrons, one at a time, to FMN via the 4Fe-4S cluster. The fully reduced FMN provi
Probab=90.44  E-value=1.8  Score=24.67  Aligned_cols=18  Identities=22%  Similarity=0.289  Sum_probs=10.9

Q ss_pred             HHHHHHCCCCEEEECCCC
Q ss_conf             999974066146511211
Q gi|254780438|r  147 LQAAKLTGADCIELYTGP  164 (261)
Q Consensus       147 i~~a~~~Gad~VElhTG~  164 (261)
                      -+.|++.|+|.||||-+.
T Consensus       143 A~rA~~AGfDgVEIH~ah  160 (353)
T cd02930         143 AALAREAGYDGVEIMGSE  160 (353)
T ss_pred             HHHHHHCCCCEEEECCCC
T ss_conf             999998299989962567


No 43 
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain. YqjM is involved in the oxidative stress response of Bacillus subtilis.  Like the other OYE members, each monomer of YqjM contains FMN as a non-covalently bound cofactor and uses NADPH as a reducing agent.   The YqjM enzyme exists as a homotetramer that is assembled as a dimer of catalytically dependent dimers, while other OYE members exist only as monomers or dimers. Moreover, the protein displays a shared active site architecture where an arginine finger at the COOH terminus of one monomer extends into the active site of the adjacent monomer and is directly involved in substrate recognition. Another remarkable difference in the binding of the ligand in YqjM is represented by the contribution of the NH2-terminal tyrosine instead of a COOH-terminal tyrosine in OYE and its homologs.
Probab=89.82  E-value=2.1  Score=24.33  Aligned_cols=18  Identities=28%  Similarity=0.287  Sum_probs=12.8

Q ss_pred             HHHHHHCCCCEEEECCCC
Q ss_conf             999974066146511211
Q gi|254780438|r  147 LQAAKLTGADCIELYTGP  164 (261)
Q Consensus       147 i~~a~~~Gad~VElhTG~  164 (261)
                      -+.|++.|+|.||||-+.
T Consensus       160 A~rA~~AGfDGVEIH~ah  177 (336)
T cd02932         160 ARRAVEAGFDVIEIHAAH  177 (336)
T ss_pred             HHHHHHCCCCEEEECCCC
T ss_conf             999998399999863137


No 44 
>TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase. This enzyme interconverts tartronate semi-aldehyde (TSA, aka 2-hydroxy 3-oxopropionate) and hydroxypyruvate. The E. coli enzyme has been characterized and found to be specific for TSA, contain no cofactors, and have a rather high Km for hydroxypyruvate of 12.5 mM. The gene is ofter found in association with glyoxalate carboligase (which produces TSA), but has been shown to have no effect on growth on glyoxalate when knocked out. This is consistent with the fact that the gene for tartronate semialdehyde reductase (glxR) is also associated and may have primary responsibility for the catabolism of TSA.
Probab=89.75  E-value=1.7  Score=24.84  Aligned_cols=184  Identities=13%  Similarity=0.132  Sum_probs=93.7

Q ss_pred             CCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHH
Q ss_conf             53322144322322078868998999999997499899982478833488899999887400013674158883485689
Q gi|254780438|r    4 SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETF   83 (261)
Q Consensus         4 ~LsVNidhiAtLRnaRg~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~   83 (261)
                      |+|+|++-+=|       ++ .+.++.+.+-++|-+||=+....|.      |...|+..+..+      +|.....   
T Consensus         2 ~~s~n~~~~f~-------~~-p~~e~i~~aa~aGfdgVEl~~p~~~------~~~~l~~~l~~~------gL~v~~~---   58 (254)
T TIGR03234         2 RFAANLSMLFT-------EL-PFLERFAAAAQAGFTGVEYLFPYDW------DAEALKARLAAA------GLEQVLF---   58 (254)
T ss_pred             CEEEEHHHHCC-------CC-CHHHHHHHHHHHCCCEEEECCCCCC------CHHHHHHHHHHC------CCCEEEE---
T ss_conf             45675347216-------89-9999999999819999987788889------999999999986------9978995---


Q ss_pred             HHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHH-HHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECC
Q ss_conf             9999850721289710165553335782213337-889999986202696389972544441479999740661465112
Q gi|254780438|r   84 LNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQ-ALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYT  162 (261)
Q Consensus        84 i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~-~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhT  162 (261)
                                  .         ++-++|...... ..+....+.+++.           . +.+++.|+++|+.+|-+..
T Consensus        59 ------------~---------~~~~~~~~~~~~~~~~~~~~~~~~~~-----------~-~~ai~~a~~lg~~~i~~~~  105 (254)
T TIGR03234        59 ------------N---------LPAGDWAAGERGIACLPGREEEFREG-----------V-ALAIAYARALGCPQVNCLA  105 (254)
T ss_pred             ------------C---------CCCCCCCCCCCCCCCCCHHHHHHHHH-----------H-HHHHHHHHHHCCCEEEECC
T ss_conf             ------------3---------77786545655443694589998873-----------8-9999999996898688675


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEE---------CCCCCHHH-HHHHHHHCCC--C-EEEEEHHHHHHH
Q ss_conf             111024443564336668899987665415623520---------78989877-9999973699--6-388425999999
Q gi|254780438|r  163 GPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINA---------GHDLTIQN-IPNLINAIPY--I-SEISVGHAFAAT  229 (261)
Q Consensus       163 G~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnA---------GHgLn~~N-l~~~i~~Ip~--I-~EvsIGHaiIse  229 (261)
                      |..-.........+...+.++.++.+|.+.|+.+.-         |+=+|... ...++..+..  + --+-++|..+.+
T Consensus       106 G~~~~~~~~e~~~~~~~e~l~~~a~~a~~~Gv~l~iEpln~~e~~g~~i~t~~~a~~lv~~v~~p~v~l~~D~~H~~~~~  185 (254)
T TIGR03234       106 GKRPAGVSPEEARATLVENLRYAADALDRIGLTLLIEPINSFDMPGFFLTTTEQALAVIDDVGRENLKLQYDLYHMQRMG  185 (254)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHCCCCCHHCCHHHHHHHHHHHCCCCEEEEEECHHHHHCC
T ss_conf             68888999899999999999999999996598898863562116986107999999999980877656888705657448


Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             99940999999999999
Q gi|254780438|r  230 ALECGVKEAVFCFRRAC  246 (261)
Q Consensus       230 Al~~GL~~aI~~~~~ii  246 (261)
                      .   -+.++++++..-|
T Consensus       186 ~---d~~~~i~~~~~~I  199 (254)
T TIGR03234       186 G---DLARTLAAYAPHI  199 (254)
T ss_pred             C---CHHHHHHHCCCCC
T ss_conf             8---9999999703715


No 45 
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain.  Enoate reductase catalyzes the NADH-dependent reduction of carbon-carbon double bonds of several molecules, including nonactivated 2-enoates, alpha,beta-unsaturated aldehydes, cyclic ketones, and methylketones. ERs are similar to 2,4-dienoyl-CoA reductase from E. coli and to the old yellow enzyme from Saccharomyces cerevisiae.
Probab=89.11  E-value=2.3  Score=23.98  Aligned_cols=17  Identities=29%  Similarity=0.227  Sum_probs=8.4

Q ss_pred             HHHHHHCCCCEEEECCC
Q ss_conf             99997406614651121
Q gi|254780438|r  147 LQAAKLTGADCIELYTG  163 (261)
Q Consensus       147 i~~a~~~Gad~VElhTG  163 (261)
                      -+.|++.|+|.||||-+
T Consensus       156 A~rA~~AGfDgVEIH~a  172 (382)
T cd02931         156 AVIAKEAGFDGVEIHAV  172 (382)
T ss_pred             HHHHHHCCCCEEEECCC
T ss_conf             99999849998996245


No 46 
>COG3246 Uncharacterized conserved protein [Function unknown]
Probab=89.07  E-value=1.2  Score=25.90  Aligned_cols=52  Identities=23%  Similarity=0.219  Sum_probs=38.6

Q ss_pred             HHHHHHHHHHCCCCEEEEECC-CCCCCCCHHHHH-HHHHHHCCCCCCCEEEEEE
Q ss_conf             899999999749989998247-883348889999-9887400013674158883
Q gi|254780438|r   26 LVHIGKIALQSGASGLTVHPR-PDQRHIRYTDLP-EIRRLIDEQFPKAELNIEG   77 (261)
Q Consensus        26 ~~~~a~~~~~~GadgITvH~R-~DrRHI~~~Dv~-~l~~~~~~~~~~~elNiEg   77 (261)
                      +.+.|..|.++||-=+-+|+| +|-||-+|-|++ ..-..+.+..+++.+|+-.
T Consensus        31 IA~~a~~aa~AGAai~HlHvRp~dG~pt~d~~~yr~~l~rIr~~~~D~vin~tt   84 (298)
T COG3246          31 IASDAIAAAKAGAAILHLHVRPEDGRPTLDPEAYREVLERIRAAVGDAVINLTT   84 (298)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             999999999648416898745899986669999999999997148986999504


No 47 
>pfam02679 ComA (2R)-phospho-3-sulfolactate synthase (ComA). In methanobacteria (2R)-phospho-3-sulfolactate synthase (ComA) catalyses the first step of the biosynthesis of coenzyme M from phosphoenolpyruvate (P-enolpyruvate). This novel enzyme catalyses the stereospecific Michael addition of sulfite to P-enolpyruvate, forming L-2-phospho-3-sulfolactate (PSL). It is suggested that the ComA-catalysed reaction is analogous to those reactions catalysed by beta-elimination enzymes that proceed through an enolate intermediate.
Probab=89.00  E-value=1.2  Score=25.95  Aligned_cols=77  Identities=16%  Similarity=0.149  Sum_probs=53.6

Q ss_pred             HHHHHHHHHHHHHCCCCCEEEE-------EECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             3378899999862026963899-------725444414799997406614651121110244435643366688999876
Q gi|254780438|r  115 QNQALLTKTVARLHNLGSRISL-------FADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQ  187 (261)
Q Consensus       115 ~~~~~L~~~i~~l~~~girvSL-------FIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~  187 (261)
                      ...+.|+..|+.++++||.|++       |+-++--...++.++++|.++||+-.|...-.    ..      ...+..+
T Consensus        52 ~p~~~l~eKI~l~~~~~V~v~~GGtlfE~a~~~~~~d~y~~~~~~lGf~~iEiSdg~i~i~----~~------~~~~~I~  121 (245)
T pfam02679        52 MPEDILKEKIDLAHEHGVYVYTGGTLFEIAILQGKFDEYLRECKELGFDAIEISDGSIELP----EE------ERLRLIR  121 (245)
T ss_pred             CCHHHHHHHHHHHHHCCCEEECCCHHHHHHHHCCCHHHHHHHHHHCCCCEEEECCCCCCCC----HH------HHHHHHH
T ss_conf             7889999999999985994847969999999738399999999986998899568844689----89------9999999


Q ss_pred             HHHHCCCEEEECCC
Q ss_conf             65415623520789
Q gi|254780438|r  188 LAQKMDLQINAGHD  201 (261)
Q Consensus       188 ~A~~lgL~VnAGHg  201 (261)
                      .|.+.|+.|-.=.|
T Consensus       122 ~~~~~G~~v~~EvG  135 (245)
T pfam02679       122 KAKKAGFKVLSEVG  135 (245)
T ss_pred             HHHHCCCEEEEEEC
T ss_conf             99978997966415


No 48 
>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH. The sequences represented by this model are members of the radical SAM superfamily of enzymes (pfam04055). These enzymes utilize an iron-sulfur redox cluster and S-adenosylmethionine to carry out diverse radical mediated reactions. The members of this clade are frequently found in the same locus as squalene-hopene cyclase (SHC, TIGR01507) and other genes associated with the biosynthesis of hopanoid natural products. The linkage between SHC and this radical SAM enzyme is strong; one is nearly always observed in the same genome where the other is found. A hopanoid biosynthesis locus was described in Zymomonas mobilis consisting of the genes HpnA-E and SHC (HpnF). Continuing past SHC are found a phosphorylase enzyme (ZMO0873, i.e. HpnG, TIGR03468) and this radical SAM enzyme (ZMO0874) which we name here HpnH. Granted, in Z. mobilis, HpnH is in a convergent orientation with respect to HpnA-G, but one gene beyond HpnH
Probab=88.24  E-value=2.6  Score=23.60  Aligned_cols=48  Identities=19%  Similarity=0.258  Sum_probs=22.5

Q ss_pred             HHHHHHHHHHHHCCCCCEEE----EEECCCCCC--HHHHHHHHCCCCEEEECCC
Q ss_conf             37889999986202696389----972544441--4799997406614651121
Q gi|254780438|r  116 NQALLTKTVARLHNLGSRIS----LFADGNGNE--HSLQAAKLTGADCIELYTG  163 (261)
Q Consensus       116 ~~~~L~~~i~~l~~~girvS----LFIDpd~~q--~~i~~a~~~Gad~VElhTG  163 (261)
                      -++.--..|+.+++.|+||+    +|=+.|+++  ..++.+.++|+|.+-+--|
T Consensus       147 ~Fd~av~aIr~ak~~G~~V~iN~Tvf~~~n~~~i~~~~d~~~~lgVdgi~isp~  200 (318)
T TIGR03470       147 VFDRAVEAIREAKARGFRVTTNTTLFNDTDPEEVAEFFDYLTDLGVDGMTISPG  200 (318)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             799999999999986994679989706899999999999998769973897665


No 49 
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain. DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively.
Probab=88.02  E-value=2.7  Score=23.51  Aligned_cols=87  Identities=21%  Similarity=0.273  Sum_probs=51.1

Q ss_pred             EEEEEECCCHHHHHHHHHHCC---CEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CCEEEEEECCCCCC--H
Q ss_conf             158883485689999985072---12897101655533357822133378899999862026-96389972544441--4
Q gi|254780438|r   72 ELNIEGYPNETFLNLCERYKP---EQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNL-GSRISLFADGNGNE--H  145 (261)
Q Consensus        72 elNiEg~p~~e~i~ia~~ikP---~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~-girvSLFIDpd~~q--~  145 (261)
                      =.||-+..-+++.+++..+.+   +.++|===-|+  |..+|..+..+.+.+.++++.+++. .+.+.+=+-||.+.  .
T Consensus        93 i~si~~~~~~d~~~~~~~~~~~gad~ielNiScPN--t~~~g~~~~~~~~~~~~i~~~vk~~~~~Pi~vKlsP~~~~i~~  170 (296)
T cd04740          93 IASIAGSTVEEFVEVAEKLADAGADAIELNISCPN--VKGGGMAFGTDPEAVAEIVKAVKKATDVPVIVKLTPNVTDIVE  170 (296)
T ss_pred             EEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCC--CCCCHHHHCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHH
T ss_conf             99816898789999999988648988999788998--6763677574999999999999860489669971898000999


Q ss_pred             HHHHHHHCCCCEEEE
Q ss_conf             799997406614651
Q gi|254780438|r  146 SLQAAKLTGADCIEL  160 (261)
Q Consensus       146 ~i~~a~~~Gad~VEl  160 (261)
                      ..+.+.+.|+|.|=+
T Consensus       171 ia~~~~~~g~dgiv~  185 (296)
T cd04740         171 IARAAEEAGADGLTL  185 (296)
T ss_pred             HHHHHHHCCCCEEEE
T ss_conf             999999769988999


No 50 
>PRK10415 tRNA-dihydrouridine synthase B; Provisional
Probab=87.75  E-value=1.7  Score=24.83  Aligned_cols=191  Identities=14%  Similarity=0.177  Sum_probs=96.9

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCC-CCCHHHHHHHHHHHCCCCCC-CEEEEEECCCHHHHHHHH---HHCCCEEEE---EE
Q ss_conf             99999997499899982478833-48889999988740001367-415888348568999998---507212897---10
Q gi|254780438|r   28 HIGKIALQSGASGLTVHPRPDQR-HIRYTDLPEIRRLIDEQFPK-AELNIEGYPNETFLNLCE---RYKPEQITL---VP   99 (261)
Q Consensus        28 ~~a~~~~~~GadgITvH~R~DrR-HI~~~Dv~~l~~~~~~~~~~-~elNiEg~p~~e~i~ia~---~ikP~qvtL---VP   99 (261)
                      -|=.+|.+.|| ++|+-.==.-+ .+...|-..+.. .....+. .-+-|=|+--+.|.+-+.   +..++.+-|   -|
T Consensus        24 ~FR~l~~~~Ga-~l~~TEmv~a~~~~~~~~~~~~~~-~~~~~~~~~~vQl~G~dp~~~a~Aa~~~~~~g~~~IDiN~GCP  101 (321)
T PRK10415         24 PFRTLCYEMGA-GLTVSEMMSSNPQVWESDKSRLRM-VHVDEPGIRTVQIAGSDPKEMADAARINVESGAQIIDINMGCP  101 (321)
T ss_pred             HHHHHHHHHCC-CEEEECCEEECHHHHCCHHHHHHH-CCCCCCCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             99999999883-999987587127773384889863-0467889805997269999999999988764999894318999


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CCEEEEEE----CCCCCC--HHHHHHHHCCCCEEEECCCCCHHHHHHH
Q ss_conf             1655533357822133378899999862026-96389972----544441--4799997406614651121110244435
Q gi|254780438|r  100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNL-GSRISLFA----DGNGNE--HSLQAAKLTGADCIELYTGPYGACYNNP  172 (261)
Q Consensus       100 e~r~elTTegGldv~~~~~~L~~~i~~l~~~-girvSLFI----Dpd~~q--~~i~~a~~~Gad~VElhTG~Ya~a~~~~  172 (261)
                      -+.- .-...|=-+.++.+.+..+++.+++. ++.||.=+    |++...  ...+.+.+.|++.|-+|-=.-...|...
T Consensus       102 ~~kV-~k~g~GsaLl~~p~~~~~iv~a~~~a~~iPVTvKiRlG~~~~~~~~~~~~~~~e~aG~~~itvHgRT~~q~y~g~  180 (321)
T PRK10415        102 AKKV-NRKLAGSALLQYPDLVKSILTEVVNAVDVPVTLKIRTGWAPEHRNCEEIAQLAEDCGIQALTIHGRTRACLFNGE  180 (321)
T ss_pred             HHHH-CCCCCEEEHHCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEHHHHHHHHCCC
T ss_conf             8997-079836506339899999999997344874699984688852243999999998569889999722134431699


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHH
Q ss_conf             64336668899987665415623520789898779999973699638842599999
Q gi|254780438|r  173 QQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAA  228 (261)
Q Consensus       173 ~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIs  228 (261)
                      .... .+.++++    +.+.-+-.| |-=.+++-....+. ....+-|-||-+.+.
T Consensus       181 adw~-~i~~vk~----~~~iPvi~N-GDI~~~~da~~~l~-~tg~dgvMigRgal~  229 (321)
T PRK10415        181 AEYD-SIRAVKQ----KVSIPVIAN-GDITDPLKARAVLD-YTGADALMIGRAAQG  229 (321)
T ss_pred             CCHH-HHHHHHH----CCCCCEEEC-CCCCCHHHHHHHHH-HHCCCEEEECHHHHC
T ss_conf             8779-9999985----479978965-89199999999998-629999997566536


No 51 
>PRK11858 aksA trans-homoaconitate synthase; Reviewed
Probab=87.42  E-value=2.9  Score=23.27  Aligned_cols=171  Identities=13%  Similarity=0.129  Sum_probs=103.5

Q ss_pred             CHHHHHHHHHHCCCCEEEE-ECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEE--CCCHHHHHHHHHHCCCEEEE-EEC
Q ss_conf             9899999999749989998-2478833488899999887400013674158883--48568999998507212897-101
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTV-HPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEG--YPNETFLNLCERYKPEQITL-VPD  100 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITv-H~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg--~p~~e~i~ia~~ikP~qvtL-VPe  100 (261)
                      +-++.+....++|.+-|-+ ||.-     -+.|...++.+....   ....+-+  -+..+-++.+.+...+.+.+ +|-
T Consensus        27 ~K~~ia~~L~~~GV~~IEvG~P~~-----~~~e~~~~~~i~~~~---l~~~i~~~~R~~~~di~~a~~~g~~~v~i~~~~   98 (378)
T PRK11858         27 EKLAIARMLDEIGVDQIEAGFPAV-----SEDEKEAIKAIAKLG---LNASILAWNRAVKSDIDASIDCGVDAVHIFIAT   98 (378)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCC-----CCCHHHHHHHHHHCC---CCCEEEEECCCCHHHHHHHHHCCCCEEEEEECC
T ss_conf             999999999981989999947777-----834899999998567---984588740357877999985796989999606


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEE------CCCCCCHHHHHHHHCCCCEEEECCCCCHHHH--HHH
Q ss_conf             65553335782213337889999986202696389972------5444414799997406614651121110244--435
Q gi|254780438|r  101 DPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFA------DGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNP  172 (261)
Q Consensus       101 ~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFI------Dpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~--~~~  172 (261)
                      .+-.+..--|++.....+.+.+.++..++.|..|++..      ||+.-...++.+.+.|+|+|=|     |+..  ..|
T Consensus        99 Sd~h~~~~l~~t~~e~l~~~~~~v~~Ak~~Gl~v~f~~eD~~r~~~~~l~~~~~~a~~~Gad~I~l-----~DT~G~~~P  173 (378)
T PRK11858         99 SDIHLKYKLKKTREEVLERLVEAVEYAKDHGLYVSFSAEDASRTDLDFLIEAAKAAEEAGADRVRF-----CDTVGILDP  173 (378)
T ss_pred             CHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEE-----CCCCCCCCH
T ss_conf             799999996899899999999999999976986999440125689999999999999749989996-----365566699


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCEEEECCCCC--HHH-HHHHHH
Q ss_conf             6433666889998766541562352078989--877-999997
Q gi|254780438|r  173 QQERIFLNKLAITAQLAQKMDLQINAGHDLT--IQN-IPNLIN  212 (261)
Q Consensus       173 ~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn--~~N-l~~~i~  212 (261)
                      .+....++.+++.    ...-+++|.=-|+-  .-| ++.+.+
T Consensus       174 ~~v~~~v~~l~~~----~~~~i~~H~HNd~GlAvANalaAv~A  212 (378)
T PRK11858        174 FTMYELVKELVEA----VDIPIEVHCHNDFGMATANAIAGIEA  212 (378)
T ss_pred             HHHHHHHHHHHHH----CCCCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             9999999999972----69855999707755599999999980


No 52 
>pfam00682 HMGL-like HMGL-like. This family contains a diverse set of enzymes. These include various aldolases and a region of pyruvate carboxylase.
Probab=87.14  E-value=0.76  Score=27.32  Aligned_cols=106  Identities=10%  Similarity=0.142  Sum_probs=68.6

Q ss_pred             CHHHHHHHHCCCCEEEECCCCCHHHHHH---HHHHHHHHHHHHHHHHHHHHCCCEEEECC----CCCHHHHHHHHHHCCC
Q ss_conf             1479999740661465112111024443---56433666889998766541562352078----9898779999973699
Q gi|254780438|r  144 EHSLQAAKLTGADCIELYTGPYGACYNN---PQQERIFLNKLAITAQLAQKMDLQINAGH----DLTIQNIPNLINAIPY  216 (261)
Q Consensus       144 q~~i~~a~~~Gad~VElhTG~Ya~a~~~---~~~~~~el~~i~~aa~~A~~lgL~VnAGH----gLn~~Nl~~~i~~Ip~  216 (261)
                      .+.++.+++.|++.|.+.... ++.+..   +...+..++.++++.++|++.|+.|.-|=    --+.+.+..++.   .
T Consensus        70 ~~~~e~~~~~g~~~i~i~~~~-se~~~~~n~~~s~~~~l~~~~~~i~~a~~~g~~v~f~~~~~~~~~~~~~~~~~~---~  145 (237)
T pfam00682        70 DAAVEAAKGAGADRVHVFIAT-SDLHRKYKLNKDREEVADRAVAAVEAARSAGIDVELGCEDAGRTDLAFLIEVVE---V  145 (237)
T ss_pred             HHHHHHHHHCCCCEEEEEEEC-CHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHH---H
T ss_conf             999999996799999996105-787899885789999999999999999986990588405123247889999999---9


Q ss_pred             CEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6388425999999999409999999999997410565
Q gi|254780438|r  217 ISEISVGHAFAATALECGVKEAVFCFRRACGQHLDNT  253 (261)
Q Consensus       217 I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~~~~~~~  253 (261)
                      +.|.-+-..-++|++=.+....|+++.+.+++.....
T Consensus       146 ~~~~G~~~i~l~DT~G~~~P~~v~~lv~~l~~~~~~~  182 (237)
T pfam00682       146 AQEAGATRINIADTVGVLTPNEAADLISALKDRVPPV  182 (237)
T ss_pred             HHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCC
T ss_conf             9861985797368645579899999999999708987


No 53 
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase family protein; InterPro: IPR005720   Dihydroorotate dehydrogenase (1.3.3.1 from EC) (DHOdehase) catalyzes the fourth step in the de novo biosynthesis of pyrimidine, the conversion of dihydroorotate into orotate. DHOdehase is a ubiquitous FAD flavoprotein. In bacteria (gene pyrD), DHOdease is located on the inner side of the cytosolic membrane. In some yeasts, such as in Saccharomyces cerevisiae (gene URA1, subfamily 2), it is a cytosolic protein while in other eukaryotes it is found in the mitochondria .    This describes dihydroorotate dehydrogenases subfamily 1 that includes a number of uncharacterised proteins and a domain of dihydropyrimidine dehydrogenase.; GO: 0004158 dihydroorotate oxidase activity, 0006207 'de novo' pyrimidine base biosynthetic process, 0005737 cytoplasm.
Probab=87.10  E-value=0.42  Score=29.12  Aligned_cols=85  Identities=20%  Similarity=0.231  Sum_probs=39.6

Q ss_pred             EEEEEECCCHHHHHHHHHHC---CCEEEE--EECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CCEEEEEECCCCCCH
Q ss_conf             15888348568999998507---212897--101655533357822133378899999862026-963899725444414
Q gi|254780438|r   72 ELNIEGYPNETFLNLCERYK---PEQITL--VPDDPHQLTSDHGWDFLQNQALLTKTVARLHNL-GSRISLFADGNGNEH  145 (261)
Q Consensus        72 elNiEg~p~~e~i~ia~~ik---P~qvtL--VPe~r~elTTegGldv~~~~~~L~~~i~~l~~~-girvSLFIDpd~~q~  145 (261)
                      =-|+=|.--+||.++|.++-   |.-.-+  ====|+ .-+-+|.++.+|-+....+++.+|+. .+.|+-=.-|+-+. 
T Consensus        97 I~svyG~~~EEfa~va~~~e~A~~y~~~~ELN~SCPh-vK~G~G~~iG~dP~l~~~vv~avK~~~d~Pv~aKLsPNV~D-  174 (308)
T TIGR01037        97 IASVYGESEEEFAEVAEKLEDADPYVDAYELNVSCPH-VKGGGGIEIGQDPELSADVVKAVKDKVDVPVFAKLSPNVTD-  174 (308)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHHEEEECCCCCCC-CCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCHHH-
T ss_conf             9983188822589999987211344000010477744-34234655477877999999998300078657864865668-


Q ss_pred             HHHHHH---HCCCCEE
Q ss_conf             799997---4066146
Q gi|254780438|r  146 SLQAAK---LTGADCI  158 (261)
Q Consensus       146 ~i~~a~---~~Gad~V  158 (261)
                      -++.|+   +-|+|.+
T Consensus       175 i~eiA~a~eeaGaDGl  190 (308)
T TIGR01037       175 ITEIAKAAEEAGADGL  190 (308)
T ss_pred             HHHHHHHHHHCCCCEE
T ss_conf             9999888753277616


No 54 
>pfam05690 ThiG Thiazole biosynthesis protein ThiG. This family consists of several bacterial thiazole biosynthesis protein G sequences. ThiG, together with ThiF and ThiH, is proposed to be involved in the synthesis of 4-methyl-5-(b-hydroxyethyl)thiazole (THZ) which is an intermediate in the thiazole production pathway.
Probab=87.01  E-value=2.6  Score=23.64  Aligned_cols=158  Identities=16%  Similarity=0.092  Sum_probs=78.8

Q ss_pred             CCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCC-HHHHHHHHHHHCCCCCCCEEEEEECCCH-HHH---HHH-------
Q ss_conf             8868998999999997499899982478833488-8999998874000136741588834856-899---999-------
Q gi|254780438|r   20 NLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIR-YTDLPEIRRLIDEQFPKAELNIEGYPNE-TFL---NLC-------   87 (261)
Q Consensus        20 g~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~-~~Dv~~l~~~~~~~~~~~elNiEg~p~~-e~i---~ia-------   87 (261)
                      -+.|||+-........+|++=+||-+|--.---. .+++.+   .+....-.+-=|--|.-+. |-+   .++       
T Consensus        15 Tgky~s~~~~~~ai~aSg~eivTVAlRR~~~~~~~~~~~l~---~i~~~~~~iLPNTAGc~tA~EAVr~A~laRE~~~t~   91 (246)
T pfam05690        15 TGKYPSPEVLKEAIRASGAEIVTVALRRVNAGQPGGENFLD---LLDWLGITLLPNTAGCRTAEEAVRTARLAREAFGTN   91 (246)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEEEEEEECCCCCCCCHHHH---HHHHCCCEECCCCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             38999999999999996897799898630588888425888---641338667776301188999999999999970997


Q ss_pred             ---HHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCC
Q ss_conf             ---85072128971016555333578221333788999998620269638997254444147999974066146511211
Q gi|254780438|r   88 ---ERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGP  164 (261)
Q Consensus        88 ---~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~  164 (261)
                         +++-||.-||-||.-+                +-+..+.|-+.|-.|--++.+||-.  -+...++|+.+|=----|
T Consensus        92 wIKLEVi~D~~~LlPD~~e----------------tl~Aae~Lv~eGF~VlpY~~~D~v~--akrLed~Gc~avMPlgsP  153 (246)
T pfam05690        92 WIKLEVIGDSKTLLPDPIE----------------TLKAAEILVKEGFTVLPYTTDDPVL--ARRLEEAGCAAVMPLGAP  153 (246)
T ss_pred             EEEEEEECCCCCCCCCHHH----------------HHHHHHHHHHCCCEEEEECCCCHHH--HHHHHHCCCEEEEECCCC
T ss_conf             4899982698877988789----------------9999999997899898861799899--999987598498622440


Q ss_pred             CHHHHHHHHHH--HHHHHHHHHHHHHHHHCCCEEEECCCCCHHH
Q ss_conf             10244435643--3666889998766541562352078989877
Q gi|254780438|r  165 YGACYNNPQQE--RIFLNKLAITAQLAQKMDLQINAGHDLTIQN  206 (261)
Q Consensus       165 Ya~a~~~~~~~--~~el~~i~~aa~~A~~lgL~VnAGHgLn~~N  206 (261)
                      .    ..++-.  ...|+.|   .+.+ +.-+-|-||=|---+-
T Consensus       154 I----GSg~Gl~n~~~l~~i---~e~~-~vPvIVDAGiG~pS~A  189 (246)
T pfam05690       154 I----GSGLGLRNPENLRII---IEEA-DVPVIVDAGIGTPSDA  189 (246)
T ss_pred             C----CCCCCCCCHHHHHHH---HHHC-CCCEEEECCCCCHHHH
T ss_conf             1----368886899999999---9967-9988984898967889


No 55 
>PRK08091 ribulose-phosphate 3-epimerase; Validated
Probab=86.00  E-value=3.5  Score=22.77  Aligned_cols=45  Identities=13%  Similarity=0.130  Sum_probs=21.8

Q ss_pred             HHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECC
Q ss_conf             889999986202696389972544441479999740661465112
Q gi|254780438|r  118 ALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYT  162 (261)
Q Consensus       118 ~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhT  162 (261)
                      ++++..-+.+.+.+...-+-||-..+..++..+.+.|||.+=.=+
T Consensus       171 ~KI~~l~~~~~~~~~~~~I~VDGGI~~~ti~~~~~aGad~~V~GS  215 (235)
T PRK08091        171 ERVAQLLCLLGDKREGKLIVIDGSMTQDQLPSLIAQGIDWVVSGS  215 (235)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCCEEEECH
T ss_conf             999999999996499915998489898889999983999999782


No 56 
>PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed
Probab=85.92  E-value=3.5  Score=22.74  Aligned_cols=138  Identities=12%  Similarity=0.031  Sum_probs=85.8

Q ss_pred             CHHHHHHHHHHCCCCEEEEEC-----CCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEE------CC----CH--------
Q ss_conf             989999999974998999824-----78833488899999887400013674158883------48----56--------
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTVHP-----RPDQRHIRYTDLPEIRRLIDEQFPKAELNIEG------YP----NE--------   81 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITvH~-----R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg------~p----~~--------   81 (261)
                      +..+.-.+|.++|=|+|-+-+     |..|=..+++....|++.+.+.  +++++==+      +|    ++        
T Consensus        17 sw~e~f~~Ak~~Gfd~IE~siDe~d~~~~~l~~~~~~~~~i~~~~~~~--gl~I~s~~~s~~~~~pl~s~d~~~r~~~le   94 (284)
T PRK13210         17 SWPERLVLAKECGFDFVEMSVDETDERLARLDWSKEERLELVKAIYET--GVRIPSMCLSAHRRFPFGSRDEATRERALE   94 (284)
T ss_pred             CHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHC--CCEEEEEECCCCCCCCCCCCCHHHHHHHHH
T ss_conf             999999999986998899960675422257899989999999999982--983566415566689999989899999999


Q ss_pred             ---HHHHHHHHHCCCEEEEEECC-CCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCC----CCHHHHHHHHC
Q ss_conf             ---89999985072128971016-55533357822133378899999862026963899725444----41479999740
Q gi|254780438|r   82 ---TFLNLCERYKPEQITLVPDD-PHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNG----NEHSLQAAKLT  153 (261)
Q Consensus        82 ---e~i~ia~~ikP~qvtLVPe~-r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~----~q~~i~~a~~~  153 (261)
                         ..+++|.++.-..+.|+|-. ..+..++--|+.  -.+.|++.+....+.|+..++=...++    .++.++...++
T Consensus        95 ~l~kaI~lA~~LGi~~I~l~g~dv~~~~~~~~~~~r--f~e~l~~~~~~Ae~~gV~L~iE~~~~~f~~t~~~~~~~i~~v  172 (284)
T PRK13210         95 IMKKAIRLAQDLGIRTIQLAGYDVYYEEKDEETRQR--FIEGLAWAVEQAAAAQVMLAVEIMDTPFMNSISKWKKWDEEI  172 (284)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHH--HHHHHHHHHHHHHHHCCEEEEEECCCCCCCCHHHHHHHHHHC
T ss_conf             999999999980997899688766668698899999--999999999999983998999956765547799999999964


Q ss_pred             CCCEEEEC--CCCCH
Q ss_conf             66146511--21110
Q gi|254780438|r  154 GADCIELY--TGPYG  166 (261)
Q Consensus       154 Gad~VElh--TG~Ya  166 (261)
                      +.+++-+|  +|..+
T Consensus       173 ~sp~l~v~~DiGn~~  187 (284)
T PRK13210        173 DSPWFTVYPDVGNLS  187 (284)
T ss_pred             CCCCEEEEECCCCHH
T ss_conf             998369995455165


No 57 
>PRK09997 hydroxypyruvate isomerase; Provisional
Probab=85.92  E-value=3.5  Score=22.74  Aligned_cols=51  Identities=20%  Similarity=0.239  Sum_probs=38.2

Q ss_pred             CCCCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             84533221443223220788689989999999974998999824788334888999998874000
Q gi|254780438|r    2 STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDE   66 (261)
Q Consensus         2 ~t~LsVNidhiAtLRnaRg~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~   66 (261)
                      |.|+|.|+.-.=|       .+ .+++.-..|-++|=+++-++-.-|      .|+.+|++.+..
T Consensus         1 M~rfaaNl~~lf~-------e~-p~~eR~~aAa~~GF~aVE~~~Py~------~~~~~l~~~l~~   51 (258)
T PRK09997          1 MLRFSANLSMLFG-------EY-DFLARFEKAAQCGFRGVEFMFPYD------YDIEELKQVLAS   51 (258)
T ss_pred             CCCEEEECCCCCC-------CC-CHHHHHHHHHHCCCCEEEECCCCC------CCHHHHHHHHHH
T ss_conf             9714231110105-------79-999999999981999999648665------899999999997


No 58 
>PRK13523 NADPH dehydrogenase NamA; Provisional
Probab=85.84  E-value=3.5  Score=22.72  Aligned_cols=18  Identities=33%  Similarity=0.346  Sum_probs=12.4

Q ss_pred             HHHHHHCCCCEEEECCCC
Q ss_conf             999974066146511211
Q gi|254780438|r  147 LQAAKLTGADCIELYTGP  164 (261)
Q Consensus       147 i~~a~~~Gad~VElhTG~  164 (261)
                      -..|++.|+|.||||-+.
T Consensus       148 A~rA~~AGfDgVEIH~ah  165 (337)
T PRK13523        148 AKRAKEAGFDVIEIHGAH  165 (337)
T ss_pred             HHHHHHCCCCEEEEECCC
T ss_conf             999998499989981354


No 59 
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4.  Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.
Probab=85.79  E-value=3.5  Score=22.70  Aligned_cols=16  Identities=25%  Similarity=0.266  Sum_probs=8.0

Q ss_pred             HHHHHCCCCEEEECCC
Q ss_conf             9997406614651121
Q gi|254780438|r  148 QAAKLTGADCIELYTG  163 (261)
Q Consensus       148 ~~a~~~Gad~VElhTG  163 (261)
                      ..|++.|+|.||||.+
T Consensus       151 ~rA~~AGfDgVEiH~a  166 (353)
T cd04735         151 RRAIEAGFDGVEIHGA  166 (353)
T ss_pred             HHHHHCCCCEEEECCC
T ss_conf             9999839998997546


No 60 
>PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional
Probab=85.78  E-value=3.5  Score=22.70  Aligned_cols=166  Identities=17%  Similarity=0.127  Sum_probs=84.3

Q ss_pred             HHHHHHHHHCCCCEEEEEC-CCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH-HHHHHHHHHCCCEEEEEECCCCC
Q ss_conf             9999999974998999824-788334888999998874000136741588834856-89999985072128971016555
Q gi|254780438|r   27 VHIGKIALQSGASGLTVHP-RPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE-TFLNLCERYKPEQITLVPDDPHQ  104 (261)
Q Consensus        27 ~~~a~~~~~~GadgITvH~-R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~-e~i~ia~~ikP~qvtLVPe~r~e  104 (261)
                      .+-|..|.++|||-+=+-. -+-.|+|..+.+..|.+.+.....  ..-+=.+++. +..+++....|+.+-|-      
T Consensus        13 ~eda~~~~~~gad~iGfif~~~SpR~v~~~~a~~i~~~~~~~~~--~VgVfv~~~~~~i~~~~~~~~~d~vQlH------   84 (212)
T PRK01222         13 PEDALAAAEAGADAIGFVFYPKSPRYVTPEQAAELAAALPPFVK--VVGVFVNASDEEIAEIVEAVGLDLLQLH------   84 (212)
T ss_pred             HHHHHHHHHCCCCEEEEEECCCCCCEECHHHHHHHHHHCCCCCC--EEEEEECCCHHHHHHHHHHCCCCEEEEC------
T ss_conf             99999999579998988803899946279999999862789973--7999945817999999985699889985------


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHCCCCCEEE--EEECCCCCCHHHHHHH--HCCCCEEEECCCCCHHHHHH-HHHHHHHH
Q ss_conf             3335782213337889999986202696389--9725444414799997--40661465112111024443-56433666
Q gi|254780438|r  105 LTSDHGWDFLQNQALLTKTVARLHNLGSRIS--LFADGNGNEHSLQAAK--LTGADCIELYTGPYGACYNN-PQQERIFL  179 (261)
Q Consensus       105 lTTegGldv~~~~~~L~~~i~~l~~~girvS--LFIDpd~~q~~i~~a~--~~Gad~VElhTG~Ya~a~~~-~~~~~~el  179 (261)
                           | +.  ..+++..+-+.   .++++=  +=+....   .++...  .-.+|.+=|-|.+-  .+.. +....  +
T Consensus        85 -----G-~e--~~~~~~~l~~~---~~~~iikai~v~~~~---~l~~~~~~~~~~d~~L~Ds~~~--~~GGtG~~fd--w  146 (212)
T PRK01222         85 -----G-DE--TPEFCRQLKRR---YGLPVIKALRVRPAA---DLEAAAAYYPVADGLLLDAYVP--LPGGTGKTFD--W  146 (212)
T ss_pred             -----C-CC--CHHHHHHHHHH---CCCEEEEEEECCCHH---HHHHHHHHHCCCCEEEECCCCC--CCCCCCCCCC--H
T ss_conf             -----7-43--78999999975---397089998418778---8999998746687898638987--6787776438--7


Q ss_pred             HHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHH-CCCCEEEEEH
Q ss_conf             8899987665415623520789898779999973-6996388425
Q gi|254780438|r  180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINA-IPYISEISVG  223 (261)
Q Consensus       180 ~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~-Ip~I~EvsIG  223 (261)
                      +-+.   .+.  ....+=-.=|||-+|+..+++. =|.--.||=|
T Consensus       147 ~~l~---~~~--~~~~~~LAGGl~~~Nv~~ai~~~~p~gvDvsSG  186 (212)
T PRK01222        147 SLLA---GFP--AGLPWMLAGGLNPDNVAEAIRQVRPYGVDVSSG  186 (212)
T ss_pred             HHHH---HCC--CCCCEEEECCCCHHHHHHHHHHHCCCEEEECCC
T ss_conf             9986---143--578789966788789999999859999996381


No 61 
>PRK10550 tRNA-dihydrouridine synthase C; Provisional
Probab=85.62  E-value=1.1  Score=26.12  Aligned_cols=138  Identities=13%  Similarity=0.123  Sum_probs=68.2

Q ss_pred             HHHHHCCCEEEE---EECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC---CCEEEEEE-----CCCCCCHHHHHHHHCC
Q ss_conf             998507212897---101655533357822133378899999862026---96389972-----5444414799997406
Q gi|254780438|r   86 LCERYKPEQITL---VPDDPHQLTSDHGWDFLQNQALLTKTVARLHNL---GSRISLFA-----DGNGNEHSLQAAKLTG  154 (261)
Q Consensus        86 ia~~ikP~qvtL---VPe~r~elTTegGldv~~~~~~L~~~i~~l~~~---girvSLFI-----Dpd~~q~~i~~a~~~G  154 (261)
                      .+.+..++.+-|   -|-+. -.-..+|=-+.++.+.+..+++.+++.   ++.||.=+     |++....-.+...+.|
T Consensus        83 ~~~e~g~~~IDlN~GCP~~~-V~k~g~Gs~Ll~~p~~~~~iv~a~~~~v~~~iPVtvK~RlG~~~~~~~~e~~~~~~~~G  161 (312)
T PRK10550         83 RAVELGSYGVDLNCGCPSKT-VNGSGGGATLLKDPELIYQGAKAMREAVPAHLPVTVKVRLGWDSGDRKFEIADAVQQAG  161 (312)
T ss_pred             HHHHCCCCEEEEECCCCHHH-HCCCCCEEEECCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHCC
T ss_conf             99976999662547999789-66899268532897799999999997458789954775358998631999999999739


Q ss_pred             CCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHH
Q ss_conf             6146511211102444356433666889998766541562352078989877999997369963884259999999
Q gi|254780438|r  155 ADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATA  230 (261)
Q Consensus       155 ad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseA  230 (261)
                      ++.|-+|-=.-...|..+.-   -++.+.+..+ +.+.-+-.| |-=.+++.....+ ...+.+-|-||-..++.-
T Consensus       162 ~~~ltvH~RT~~q~y~~~~~---dw~~i~~~~~-~~~iPvi~N-GdI~s~~d~~~~~-~~tg~dgvMiGRgal~nP  231 (312)
T PRK10550        162 ATELVVHGRTKEQGYRAEHI---DWQAIGEIRQ-RLTIPVIAN-GEIWDWQSAQQCM-AISGCDAVMIGRGALNIP  231 (312)
T ss_pred             CCEEEEECCCHHHCCCCCCC---CHHHHHHHHH-HCCCCEEEE-CCCCCHHHHHHHH-HHHCCCEEEECHHHHHCC
T ss_conf             98799905526535899834---8999999997-489989970-7959999999998-714899999658553097


No 62 
>PRK11572 copper homeostasis protein CutC; Provisional
Probab=85.10  E-value=3.8  Score=22.48  Aligned_cols=198  Identities=14%  Similarity=0.124  Sum_probs=111.1

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH--------H---HH---HHHHHHCC
Q ss_conf             9999999974998999824788334888999998874000136741588834856--------8---99---99985072
Q gi|254780438|r   27 VHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE--------T---FL---NLCERYKP   92 (261)
Q Consensus        27 ~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~--------e---~i---~ia~~ikP   92 (261)
                      ++-|..|+++|||-|-+--.-+.--.+|+- -.++.... . .++|.+.=.-|..        |   |.   ..+.+..-
T Consensus        11 ~e~a~~A~~~GAdRIELCs~L~~GGlTPS~-g~i~~~~~-~-~~iPV~vMIRPR~GdF~Ys~~E~~~M~~dI~~~~~~Ga   87 (248)
T PRK11572         11 MECALTAQQNGADRIELCAAPKEGGLTPSL-GVLKSVRE-R-VTIPVHPIIRPRGGDFCYSDGEFAAMLEDIRTVRELGF   87 (248)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCCCCH-HHHHHHHH-H-CCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             999999998399989974787668979999-99999998-6-69973899942699886798999999999999998699


Q ss_pred             CEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEE--EEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHH
Q ss_conf             128971016555333578221333788999998620269638--997254444147999974066146511211102444
Q gi|254780438|r   93 EQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRI--SLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYN  170 (261)
Q Consensus        93 ~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girv--SLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~  170 (261)
                      +-+-+     +-||+||.+|...    ++..++..+...+--  .+=.=+||.+ +++...++|++|| |--|--..+..
T Consensus        88 ~GvV~-----G~L~~dg~iD~~~----~~~Li~~a~~l~vTFHRAfD~~~dp~~-ale~Li~lG~~rI-LTSG~~~~A~~  156 (248)
T PRK11572         88 PGLVT-----GVLDVDGHVDMPR----MEKIMAAAGPLAVTFHRAFDMCANPLN-ALKNLAELGVARI-LTSGQQSDAEQ  156 (248)
T ss_pred             CEEEE-----EEECCCCCCCHHH----HHHHHHHHCCCEEEEECHHHCCCCHHH-HHHHHHHCCCCEE-ECCCCCCCHHH
T ss_conf             96799-----6688999849999----999999748980798620221499999-9999997599989-88999787778


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHH--HHHH------HHHHHHH-------
Q ss_conf             356433666889998766541562352078989877999997369963884259--9999------9999409-------
Q gi|254780438|r  171 NPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGH--AFAA------TALECGV-------  235 (261)
Q Consensus       171 ~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGH--aiIs------eAl~~GL-------  235 (261)
                      .-    ..|++++   +.+  -|..+-||-|+|.+|+..|++  -.++|++-.-  +.=|      +.++.|.       
T Consensus       157 G~----~~L~~L~---~~a--~~~iIm~GgGV~~~Ni~~~~~--tG~~eiH~Sak~~~~s~m~~r~~~v~mg~~~~~~e~  225 (248)
T PRK11572        157 GL----SLIMELI---AQG--DAPIIMAGAGVRAENLQKFLD--AGVREVHSSAGAWQPSPMRYRNQGVSMSSDAEADEY  225 (248)
T ss_pred             HH----HHHHHHH---HHC--CCCEEEECCCCCHHHHHHHHH--CCCCEEEECCCCCCCCCCEECCCCCCCCCCCCCCCC
T ss_conf             89----9999999---844--996898789989999999997--597789735786447876566899857889899865


Q ss_pred             ------HHHHHHHHHHHHHH
Q ss_conf             ------99999999999741
Q gi|254780438|r  236 ------KEAVFCFRRACGQH  249 (261)
Q Consensus       236 ------~~aI~~~~~ii~~~  249 (261)
                            ++.|+.++.++.+.
T Consensus       226 ~~~~td~~~v~~~~~~l~~~  245 (248)
T PRK11572        226 SRYCVDGAAVAEMKGIIVRH  245 (248)
T ss_pred             CEECCCHHHHHHHHHHHHHH
T ss_conf             15602999999999999985


No 63 
>cd00019 AP2Ec AP endonuclease family 2; These endonucleases play a role in DNA repair. Cleave phosphodiester bonds at apurinic or apyrimidinic sites; the alignment also contains hexulose-6-phosphate isomerases, enzymes that catalyze the epimerization of D-arabino-6-hexulose 3-phosphate to D-fructose 6-phosphate, via cleaving the phosphoesterbond with the sugar.
Probab=85.06  E-value=3.8  Score=22.47  Aligned_cols=176  Identities=17%  Similarity=0.212  Sum_probs=97.3

Q ss_pred             CHHHHHHHHHHCCCCEEEEECCCCC----CCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEEC
Q ss_conf             9899999999749989998247883----348889999988740001367415888348568999998507212897101
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTVHPRPDQ----RHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPD  100 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITvH~R~Dr----RHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe  100 (261)
                      .+..+...+.+.|++.+-+-++.-|    +-+.++++..++..+.+      +++                   .++|.-
T Consensus        11 g~~~~~~~a~~iG~~~~qif~~~p~~w~~~~~~~~~~~~~~~~~~~------~~~-------------------~~~~~H   65 (279)
T cd00019          11 GLENALKRAKEIGFDTVAMFLGNPRSWLSRPLKKERAEKFKAIAEE------GPS-------------------ICLSVH   65 (279)
T ss_pred             HHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHH------CCC-------------------CCEEEE
T ss_conf             3999999999809989999778988768899998999999999997------699-------------------737853


Q ss_pred             CCCCCCCCCCCCHHH-HHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             655533357822133-3788999998620269638997254444147999974066146511211102444356433666
Q gi|254780438|r  101 DPHQLTSDHGWDFLQ-NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFL  179 (261)
Q Consensus       101 ~r~elTTegGldv~~-~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el  179 (261)
                      .+      -=+|+.+ +.......++.+.+                .++.|.++|++.|=+|+|.|-.. ....-.+...
T Consensus        66 ap------Y~iNlas~~~~~r~~s~~~l~~----------------~l~~a~~lG~~~vv~HpG~~~~~-~~~~~~~~~~  122 (279)
T cd00019          66 AP------YLINLASPDKEKREKSIERLKD----------------EIERCEELGIRLLVFHPGSYLGQ-SKEEGLKRVI  122 (279)
T ss_pred             CC------EEECCCCCCHHHHHHHHHHHHH----------------HHHHHHHCCCCEEEECCCCCCCC-CHHHHHHHHH
T ss_conf             56------0016899988999999999999----------------99999981998899678646788-8899999999


Q ss_pred             HHHHHHHHHHHH----CCCEEEECCC----CCHHHHHHHHHHCCCC----EEEEEHHHHHHHH---HHHHHHHHHHHHHH
Q ss_conf             889998766541----5623520789----8987799999736996----3884259999999---99409999999999
Q gi|254780438|r  180 NKLAITAQLAQK----MDLQINAGHD----LTIQNIPNLINAIPYI----SEISVGHAFAATA---LECGVKEAVFCFRR  244 (261)
Q Consensus       180 ~~i~~aa~~A~~----lgL~VnAGHg----Ln~~Nl~~~i~~Ip~I----~EvsIGHaiIseA---l~~GL~~aI~~~~~  244 (261)
                      +-+.++.+.|..    +.|+--||.|    =+++-+..++..+..-    --+-.||+..+--   -..|+++++.++.+
T Consensus       123 ~~l~~i~~~a~~~~v~l~lEn~ag~g~~~g~~~eel~~i~~~~~~~~~~gvclDt~H~~aag~di~~~~~~~~~~~~~~~  202 (279)
T cd00019         123 EALNELIDKAETKGVVIALETMAGQGNEIGSSFEELKEIIDLIKEKPRVGVCIDTCHIFAAGYDISTVEGFEKVLEEFDK  202 (279)
T ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCCCHHCCHHHHHHHHHHCCCCCCEEEEECHHHHHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             99999998714578579983489877622117999999998456877648984337765414787868889999999998


Q ss_pred             HHHH
Q ss_conf             9974
Q gi|254780438|r  245 ACGQ  248 (261)
Q Consensus       245 ii~~  248 (261)
                      .+..
T Consensus       203 ~iG~  206 (279)
T cd00019         203 VIGL  206 (279)
T ss_pred             HHCH
T ss_conf             7183


No 64 
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain.  TMADH is an iron-sulfur flavoprotein that catalyzes the oxidative demethylation of trimethylamine to form dimethylamine and formaldehyde. The protein forms a symetrical dimer with each subunit containing one 4Fe-4S cluster and one FMN cofactor.  It contains a unique flavin, in the form of a 6-S-cysteinyl FMN  which is bent by ~25 degrees along the N5-N10 axis of the flavin isoalloxazine ring. This modification of the conformation of the flavin is thought to facilitate catalysis.The closely related histamine dehydrogenase catalyzes oxidative deamination of histamine.
Probab=84.99  E-value=3.9  Score=22.45  Aligned_cols=183  Identities=14%  Similarity=0.149  Sum_probs=77.9

Q ss_pred             CCCCCCHHHHHHHHH--HCCCCEE-----EEECCCCCCC-----C-CHHHHHHHHHHHCCC-CCCCEEEEEECCCHHHHH
Q ss_conf             886899899999999--7499899-----9824788334-----8-889999988740001-367415888348568999
Q gi|254780438|r   20 NLPWPNLVHIGKIAL--QSGASGL-----TVHPRPDQRH-----I-RYTDLPEIRRLIDEQ-FPKAELNIEGYPNETFLN   85 (261)
Q Consensus        20 g~~~P~~~~~a~~~~--~~GadgI-----TvH~R~DrRH-----I-~~~Dv~~l~~~~~~~-~~~~elNiEg~p~~e~i~   85 (261)
                      |...|.... .....  +.|+--|     .|++.-+.-+     | .++++..+++++..- -....+=+...-. +.  
T Consensus        33 ~~~~~~~~~-~~~~~rA~GG~GlIite~~~V~~~~~~~~~~~~~l~~d~~i~~~k~l~d~vH~~G~~i~~QL~H~-G~--  108 (370)
T cd02929          33 GYRKPSAQA-AMRGIKAEGGWGVVNTEQCSIHPSSDDTPRISARLWDDGDIRNLAAMTDAVHKHGALAGIELWHG-GA--  108 (370)
T ss_pred             CCCCCHHHH-HHHHHHHCCCCEEEEECCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCC-CC--
T ss_conf             899957999-99999846681499965048610304588988773798999999999999996699678853356-67--


Q ss_pred             HHHHHCCCEEEEEECCCCCCCCCCCCCHH-----HHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEE
Q ss_conf             99850721289710165553335782213-----3378899999862026963899725444414799997406614651
Q gi|254780438|r   86 LCERYKPEQITLVPDDPHQLTSDHGWDFL-----QNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIEL  160 (261)
Q Consensus        86 ia~~ikP~qvtLVPe~r~elTTegGldv~-----~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VEl  160 (261)
                         ...+...-..|-.|..+.++++..-.     =..+.+..+++.+-+                +-..|++.|+|.|||
T Consensus       109 ---~~~~~~~~~~~~~pS~~~~~~~~~~~~~~r~mt~~eI~~ii~~f~~----------------AA~rA~~AGfDgVEI  169 (370)
T cd02929         109 ---HAPNRESRETPLGPSQLPSEFPTGGPVQAREMDKDDIKRVRRWYVD----------------AALRARDAGFDIVYV  169 (370)
T ss_pred             ---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH----------------HHHHHHHCCCCEEEE
T ss_conf             ---7764346899878643555667799987866899999999999999----------------999999859898997


Q ss_pred             CCCCC--HHHHHHH-------------HHHHHHHHHHHHHHHHHH----HCCCEEEE------CCCCCHHHHHHH---HH
Q ss_conf             12111--0244435-------------643366688999876654----15623520------789898779999---97
Q gi|254780438|r  161 YTGPY--GACYNNP-------------QQERIFLNKLAITAQLAQ----KMDLQINA------GHDLTIQNIPNL---IN  212 (261)
Q Consensus       161 hTG~Y--a~a~~~~-------------~~~~~el~~i~~aa~~A~----~lgL~VnA------GHgLn~~Nl~~~---i~  212 (261)
                      |-+.-  -+.|-.+             ++....+..+.++.+.+.    -+++++++      |=+.+.+....+   +.
T Consensus       170 HaahGYLl~qFlSp~~N~RtDeYGGS~enR~Rf~~Eii~aVr~~vg~df~i~~R~s~~~~~~~~g~~~~~~~~~~~~~~~  249 (370)
T cd02929         170 YAAHGYLPLQFLLPRYNKRTDEYGGSLENRARFWRETLEDTKDAVGDDCAVATRFSVDELIGPGGIESEGEGVEFVEMLD  249 (370)
T ss_pred             CCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             71135599973477457877746898899989999999999997199875999989412568899988899999999973


Q ss_pred             HCCCCEEEEEHHH
Q ss_conf             3699638842599
Q gi|254780438|r  213 AIPYISEISVGHA  225 (261)
Q Consensus       213 ~Ip~I~EvsIGHa  225 (261)
                      ....+.+||+|+.
T Consensus       250 ~~~d~~~vs~g~~  262 (370)
T cd02929         250 ELPDLWDVNVGDW  262 (370)
T ss_pred             CCCCEEEEEECCC
T ss_conf             6579799885555


No 65 
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional
Probab=84.78  E-value=3.9  Score=22.39  Aligned_cols=12  Identities=25%  Similarity=0.362  Sum_probs=7.0

Q ss_pred             CCCHHHHHHHHH
Q ss_conf             989877999997
Q gi|254780438|r  201 DLTIQNIPNLIN  212 (261)
Q Consensus       201 gLn~~Nl~~~i~  212 (261)
                      |||-+|+...++
T Consensus       172 GLnpdNV~eAi~  183 (611)
T PRK13803        172 GLSPTNVDRAIQ  183 (611)
T ss_pred             CCCHHHHHHHHH
T ss_conf             897687999997


No 66 
>pfam01208 URO-D Uroporphyrinogen decarboxylase (URO-D).
Probab=84.58  E-value=4  Score=22.33  Aligned_cols=42  Identities=33%  Similarity=0.434  Sum_probs=21.1

Q ss_pred             HHHHHHHHHCCCCC-EEEEEECCCCCCHHHHHHHHCCCCEEEEC
Q ss_conf             89999986202696-38997254444147999974066146511
Q gi|254780438|r  119 LLTKTVARLHNLGS-RISLFADGNGNEHSLQAAKLTGADCIELY  161 (261)
Q Consensus       119 ~L~~~i~~l~~~gi-rvSLFIDpd~~q~~i~~a~~~Gad~VElh  161 (261)
                      .++++++.+++.+. .+.+|+--+.+ ..++..+++|+|++-+.
T Consensus       218 ~~~~i~~~ik~~~~~~~ilh~cG~~~-~~~~~l~~~~~~~~s~d  260 (337)
T pfam01208       218 YLKRIVDEVKARGPGPVILHICGNGT-PILEDMAETGADVISLD  260 (337)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCHH-HHHHHHHHCCCCEEECC
T ss_conf             99999999998689974998579668-99999986498888447


No 67 
>PRK08195 4-hydroxy-2-ketovalerate aldolase; Validated
Probab=84.58  E-value=4  Score=22.33  Aligned_cols=157  Identities=14%  Similarity=0.178  Sum_probs=80.8

Q ss_pred             CCHHHHHHHHHHCCCCEEEE-E-----------CCCCCCCCCHHHHHHHHHHHCCCCCCCEEE---EEECCCHHHHHHHH
Q ss_conf             99899999999749989998-2-----------478833488899999887400013674158---88348568999998
Q gi|254780438|r   24 PNLVHIGKIALQSGASGLTV-H-----------PRPDQRHIRYTDLPEIRRLIDEQFPKAELN---IEGYPNETFLNLCE   88 (261)
Q Consensus        24 P~~~~~a~~~~~~GadgITv-H-----------~R~DrRHI~~~Dv~~l~~~~~~~~~~~elN---iEg~p~~e~i~ia~   88 (261)
                      -+....+....++|.+-|-| |           ..+  .+-..+.+..+++.++    +..+.   +-|..+.+-++.+.
T Consensus        25 e~k~~ia~~Ld~aGVd~IEVghg~gl~~ss~~~g~~--~~~d~e~i~~~~~~~~----~aki~~l~~pg~~~~~dl~~A~   98 (337)
T PRK08195         25 EQVRAIARALDAAGVPVIEVTHGDGLGGSSFNYGFG--AHTDEEYIEAAADVVK----QAKLATLLLPGIGTIEDLKMAY   98 (337)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCC--CCCHHHHHHHHHHHHH----CCEEEEEECCCCCCHHHHHHHH
T ss_conf             999999999998098999944788877753346787--7983999999999743----2837899635655588899999


Q ss_pred             HHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEE------CCCCCCHHHHHHHHCCCCEEEECC
Q ss_conf             50721289710165553335782213337889999986202696389972------544441479999740661465112
Q gi|254780438|r   89 RYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFA------DGNGNEHSLQAAKLTGADCIELYT  162 (261)
Q Consensus        89 ~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFI------Dpd~~q~~i~~a~~~Gad~VElhT  162 (261)
                      +...+.+-+.-.            + ...+.....++..++.|.+|+.|+      +|+.-....+.+.+.|+|+|=|--
T Consensus        99 ~~gv~~vria~~------------~-tead~~~~~i~~ar~~G~~v~~~lm~s~~~~~e~l~~~a~~~~~~Gad~I~l~D  165 (337)
T PRK08195         99 DAGVRVVRVATH------------C-TEADVSEQHIGLARELGMDTVGFLMMSHMASPEKLAEQAKLMESYGAQCVYVVD  165 (337)
T ss_pred             HCCCCEEEEEEE------------C-CHHHHHHHHHHHHHHCCCEEEEEEHHCCCCCHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             579897999863------------1-488779999999997799399975110248999999999999865999999789


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCH
Q ss_conf             111024443564336668899987665415623520789898
Q gi|254780438|r  163 GPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTI  204 (261)
Q Consensus       163 G~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~  204 (261)
                       ++..  -.|.+....+..+++..  -.+.-+++|+=++|.+
T Consensus       166 -T~G~--~~P~~v~~~v~~l~~~l--~~~i~igfH~HNnlGl  202 (337)
T PRK08195        166 -SAGA--LLPDDVRARVRALRAAL--KPDTQVGFHGHHNLGL  202 (337)
T ss_pred             -CCCC--CCHHHHHHHHHHHHHHC--CCCCEEEEEECCCCCH
T ss_conf             -8766--79999999999999864--9985499985388675


No 68 
>PRK00915 2-isopropylmalate synthase; Validated
Probab=84.03  E-value=4.2  Score=22.17  Aligned_cols=169  Identities=12%  Similarity=0.134  Sum_probs=102.3

Q ss_pred             CHHHHHHHHHHCCCCEEEE-ECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHH----HHHCCCEEE-EE
Q ss_conf             9899999999749989998-24788334888999998874000136741588834856899999----850721289-71
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTV-HPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLC----ERYKPEQIT-LV   98 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITv-H~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia----~~ikP~qvt-LV   98 (261)
                      +-++.|+...+.|.|-|-+ +|.--     +.|...++.+.... .+.++--=+-...+=++.+    ...+...|+ ++
T Consensus        27 ~K~~Ia~~L~~~GV~~IE~G~P~~s-----~~d~e~~~~i~~~~-~~~~i~~~~ra~~~did~a~eal~~~~~~~v~i~~  100 (511)
T PRK00915         27 EKLQIAKQLERLGVDVIEAGFPASS-----PGDFEAVKRIARTV-KNSTVCGLARAVKKDIDAAAEALKPAEKPRIHTFI  100 (511)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCC-----HHHHHHHHHHHHCC-CCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             9999999999769898998267789-----78999999998605-99899997267555299999997358988899996


Q ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEE------CCCCCCHHHHHHHHCCCCEEEECCCCCHHHH--H
Q ss_conf             0165553335782213337889999986202696389972------5444414799997406614651121110244--4
Q gi|254780438|r   99 PDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFA------DGNGNEHSLQAAKLTGADCIELYTGPYGACY--N  170 (261)
Q Consensus        99 Pe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFI------Dpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~--~  170 (261)
                      |-.+-.++.--|++.....+...+.++..++.|.+|..-.      ||+.-...++++.+.|||+|=|     |+-.  .
T Consensus       101 ~~S~~h~~~~l~~s~ee~l~~~~~~v~~ak~~g~~V~f~~ED~srtd~~~l~~~~~aa~~aGa~~i~l-----~DTvG~~  175 (511)
T PRK00915        101 ATSPIHMEYKLKMSREEVLEMAVEAVKYARSYTDDVEFSAEDATRTDLDFLCRVVEAAIDAGATTINI-----PDTVGYT  175 (511)
T ss_pred             CCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEE-----CCCCCCC
T ss_conf             57889999997899999999999999999980985999324057779899999999987649999864-----5666776


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCH
Q ss_conf             3564336668899987665415623520789898
Q gi|254780438|r  171 NPQQERIFLNKLAITAQLAQKMDLQINAGHDLTI  204 (261)
Q Consensus       171 ~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~  204 (261)
                      .|.+....++.+++.........|++|+=-|+-+
T Consensus       176 ~P~~~~~~i~~l~~~~p~~~~v~i~vH~HND~Gl  209 (511)
T PRK00915        176 TPEEFGELIKTLRERVPNIDKAIISVHCHNDLGM  209 (511)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCH
T ss_conf             9389999999999864886562489984188689


No 69 
>PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional
Probab=83.96  E-value=4.3  Score=22.15  Aligned_cols=186  Identities=13%  Similarity=0.132  Sum_probs=97.0

Q ss_pred             HHHHHHHHHCCCCEEE-EECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHH-HHHHHHCCCEEEEEECCCCC
Q ss_conf             9999999974998999-824788334888999998874000136741588834856899-99985072128971016555
Q gi|254780438|r   27 VHIGKIALQSGASGLT-VHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFL-NLCERYKPEQITLVPDDPHQ  104 (261)
Q Consensus        27 ~~~a~~~~~~GadgIT-vH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i-~ia~~ikP~qvtLVPe~r~e  104 (261)
                      .+-|..|.++|||-|= +.-.+-.|+|..+....|.+.+....  ...-+=.+++.+.+ +++....++.+-|==+..  
T Consensus        11 ~eda~~a~~~gaD~iGfif~~~SpR~i~~~~a~~i~~~~~~~~--~~VgVfvn~~~~~i~~~~~~~~ld~vQlHG~e~--   86 (207)
T PRK13958         11 IKDVTAASQLPIDAIGFIHYEKSKRHQTITQIKKLASAVPNHI--DKVCVMVNPDLTTIEHVLSNTSINTIQLHGTES--   86 (207)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHCCCCC--CEEEEEECCCHHHHHHHHHHCCCCEEEECCCCC--
T ss_conf             9999999968999999955789998659999999998655468--869999469799999999857997798648999--


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHCC--CCCEEEEEECCCCCCHHHHHHHH--CCCCEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             3335782213337889999986202--69638997254444147999974--0661465112111024443564336668
Q gi|254780438|r  105 LTSDHGWDFLQNQALLTKTVARLHN--LGSRISLFADGNGNEHSLQAAKL--TGADCIELYTGPYGACYNNPQQERIFLN  180 (261)
Q Consensus       105 lTTegGldv~~~~~~L~~~i~~l~~--~girvSLFIDpd~~q~~i~~a~~--~Gad~VElhTG~Ya~a~~~~~~~~~el~  180 (261)
                                  .++    ++.++.  .++++---+.++.+  .++....  -.+|.+=|-|.  +..+....+. --++
T Consensus        87 ------------~~~----~~~~~~~~~~~~iika~~~~~~--~~~~~~~~~~~~d~~LlDs~--~~~~GGtG~~-fdW~  145 (207)
T PRK13958         87 ------------IDF----IQEIKKKYSSIKITKALAADEN--IIQNINKYKGFVDLFIIDTP--SVSYGGTGQT-YDWT  145 (207)
T ss_pred             ------------HHH----HHHHHHHCCCCEEEEEEECCHH--HHHHHHHHHHHHCEEEECCC--CCCCCCCCCC-CCHH
T ss_conf             ------------999----9999755589679999616676--89999986753247876577--6668998786-6878


Q ss_pred             HHHHHHHHHHHCCCEEEECCCCCHHHHHHHHH-H-CCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89998766541562352078989877999997-3-6996388425999999999409999999999997410
Q gi|254780438|r  181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLIN-A-IPYISEISVGHAFAATALECGVKEAVFCFRRACGQHL  250 (261)
Q Consensus       181 ~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~-~-Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~~~~  250 (261)
                      -+...    ....+-+ || |||-+|+..++. + -|.--.||=|=    |+  .|. +-..++++.++.-+
T Consensus       146 ~l~~~----~~~~~~L-AG-GL~p~NV~~a~~~~~~p~gVDvsSGV----E~--~G~-KD~~Ki~~fi~~vk  204 (207)
T PRK13958        146 ILKHI----KDIPYLI-AG-GINSENIQTVNQLKLSHQGYDLASGI----EV--NGR-KDIEKMTAIVNIVK  204 (207)
T ss_pred             HHHHC----CCCCEEE-EE-CCCHHHHHHHHHCCCCCCEEECCCCC----CC--CCC-CCHHHHHHHHHHHH
T ss_conf             88625----5898699-94-69889999999635799989821656----78--898-79999999999985


No 70 
>PRK02048 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Provisional
Probab=83.61  E-value=4.4  Score=22.05  Aligned_cols=19  Identities=21%  Similarity=0.403  Sum_probs=12.3

Q ss_pred             HHHHHHHHCCCCEEEEECCC
Q ss_conf             99999997499899982478
Q gi|254780438|r   28 HIGKIALQSGASGLTVHPRP   47 (261)
Q Consensus        28 ~~a~~~~~~GadgITvH~R~   47 (261)
                      .+|..|.++ ++.|-+-|--
T Consensus        96 ~~A~~a~~~-~~kvRINPGN  114 (613)
T PRK02048         96 KVADVAAQY-AEKVRINPGN  114 (613)
T ss_pred             HHHHHHHHH-CCCEEECCCC
T ss_conf             999999985-3868788997


No 71 
>TIGR01464 hemE uroporphyrinogen decarboxylase; InterPro: IPR006361   This entry represents uroporphyrinogen decarboxylase (HemE), which catalyzes the fifth step in the heme biosynthetic pathway, converting uroporphyrinogen III to coproporphyrinogen III by decarboxylating the four acetate side chains of the substrate . This step takes the pathway toward protoporphyrin IX, a common precursor of both heme and chlorophyll, rather than toward precorrin 2 and its products.   This activity is essential in all organisms, and subnormal activity of URO-D leads to the most common form of porphyria in humans, porphyria cutanea tarda (PCT).; GO: 0004853 uroporphyrinogen decarboxylase activity, 0006779 porphyrin biosynthetic process.
Probab=82.45  E-value=4.9  Score=21.75  Aligned_cols=95  Identities=24%  Similarity=0.352  Sum_probs=62.6

Q ss_pred             HHHHHHHHHHCCC-------CCEEEEEECCCCCCHHHHHHHHCC-CCEEEE-------------CCC-CCHH--------
Q ss_conf             8899999862026-------963899725444414799997406-614651-------------121-1102--------
Q gi|254780438|r  118 ALLTKTVARLHNL-------GSRISLFADGNGNEHSLQAAKLTG-ADCIEL-------------YTG-PYGA--------  167 (261)
Q Consensus       118 ~~L~~~i~~l~~~-------girvSLFIDpd~~q~~i~~a~~~G-ad~VEl-------------hTG-~Ya~--------  167 (261)
                      ..++.+++.+++.       .+.|.+|.--. . ..++...+.| +|.|=+             ..+ |.+-        
T Consensus       219 py~~~I~~~vk~~~~e~~~~~~P~I~F~~G~-g-~~l~~~~~~g~~DvvglDW~v~~~~a~~~~~~~kP~~~QGNLDP~~  296 (351)
T TIGR01464       219 PYLAKIIEEVKKRLPEFVLENVPVILFAKGA-G-HLLEELAETGPADVVGLDWSVDLKEARKRVGDGKPVAIQGNLDPAV  296 (351)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCEEEECCCH-H-HHHHHHHHCCCCCEEEECCCCCHHHHHHHHCCCCCEEEECCCCHHH
T ss_conf             8999999999876212578988668852877-8-9999997069920886058889899999717999878856433222


Q ss_pred             HHHHHHHHHHHHHHHHHHHH-HHH-HCCCEEEECCCC----CHHHHHHHHHHC
Q ss_conf             44435643366688999876-654-156235207898----987799999736
Q gi|254780438|r  168 CYNNPQQERIFLNKLAITAQ-LAQ-KMDLQINAGHDL----TIQNIPNLINAI  214 (261)
Q Consensus       168 a~~~~~~~~~el~~i~~aa~-~A~-~lgL~VnAGHgL----n~~Nl~~~i~~I  214 (261)
                      .+...+......+++.+... .|. .-|--.|-|||+    +-+|+..|+..+
T Consensus       297 L~~~~~~l~~~~~~~l~~~~~~Agg~~~yIFNLGHGilP~~p~E~v~~lve~V  349 (351)
T TIGR01464       297 LYAPEEALEEKVERILEAFGQEAGGKSGYIFNLGHGILPETPPENVKALVEYV  349 (351)
T ss_pred             HCCCHHHHHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCCCHHHHHHHHHHH
T ss_conf             21898999999999999731257899885876577788998979999999985


No 72 
>PRK00694 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Validated
Probab=82.12  E-value=5  Score=21.67  Aligned_cols=25  Identities=12%  Similarity=0.163  Sum_probs=16.3

Q ss_pred             CHHHHHHHHHHCCCCEEEEECCC--CCCC
Q ss_conf             98999999997499899982478--8334
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTVHPRP--DQRH   51 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITvH~R~--DrRH   51 (261)
                      ++ .+|..+.++ +|.|-+-|--  |+|.
T Consensus        98 ~~-~~a~~a~~~-~~kiRINPGN~~~~~~  124 (606)
T PRK00694         98 FP-QAAMHVADF-VDKVRINPGNYVDKRN  124 (606)
T ss_pred             CH-HHHHHHHHH-CCCEEECCCCCCCCCC
T ss_conf             88-999999975-2838888997666644


No 73 
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism. ThiG catalyzes the formation of thiazole from 1-deoxy-D-xylulose 5-phosphate (DXP) and dehydroglycine, with the help of the sulfur carrier protein ThiS that carries the sulfur needed for thiazole assembly on its carboxy terminus (ThiS-COSH).
Probab=81.97  E-value=5.1  Score=21.64  Aligned_cols=158  Identities=16%  Similarity=0.115  Sum_probs=80.4

Q ss_pred             CCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCC-HHHHHHHHHHHCCCCCCCEEEEEECCCH-HHH---HHH-------
Q ss_conf             8868998999999997499899982478833488-8999998874000136741588834856-899---999-------
Q gi|254780438|r   20 NLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIR-YTDLPEIRRLIDEQFPKAELNIEGYPNE-TFL---NLC-------   87 (261)
Q Consensus        20 g~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~-~~Dv~~l~~~~~~~~~~~elNiEg~p~~-e~i---~ia-------   87 (261)
                      -+.|||+-....-...+|++=+||-+|-=.---. .+.+.+.   +....-.+-=|--|.-+. |-+   .++       
T Consensus        16 Tgky~s~~~~~~ai~aSgaeivTVAlRR~~~~~~~~~~~l~~---i~~~~~~~LPNTAGc~ta~EAvr~A~laRE~~~t~   92 (248)
T cd04728          16 TGKYPSPAIMKEAIEASGAEIVTVALRRVNIGDPGGESFLDL---LDKSGYTLLPNTAGCRTAEEAVRTARLAREALGTD   92 (248)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEEEEEECCCCCCCCHHHHHH---HHHCCCEECCCCCCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             489999999999999968976999986305788885268987---52338668765401167999999999999984898


Q ss_pred             ---HHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCC
Q ss_conf             ---85072128971016555333578221333788999998620269638997254444147999974066146511211
Q gi|254780438|r   88 ---ERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGP  164 (261)
Q Consensus        88 ---~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~  164 (261)
                         +++-||.-||-||..+                +-+..+.|-+.|-.|--++.+||..  -+...++|+.+|=----|
T Consensus        93 ~IKLEVi~D~~~LlPD~~e----------------Tl~Aae~Lv~~GF~VlpY~~~D~v~--akrLe~~Gc~avMPlgsP  154 (248)
T cd04728          93 WIKLEVIGDDKTLLPDPIE----------------TLKAAEILVKEGFTVLPYCTDDPVL--AKRLEDAGCAAVMPLGSP  154 (248)
T ss_pred             EEEEEEECCCCCCCCCHHH----------------HHHHHHHHHHCCCEEEEECCCCHHH--HHHHHHCCCEEEEECCCC
T ss_conf             6999981797677988689----------------9999999998899897867889999--999997495345204564


Q ss_pred             CHHHHHHHHH--HHHHHHHHHHHHHHHHHCCCEEEECCCCCHHH
Q ss_conf             1024443564--33666889998766541562352078989877
Q gi|254780438|r  165 YGACYNNPQQ--ERIFLNKLAITAQLAQKMDLQINAGHDLTIQN  206 (261)
Q Consensus       165 Ya~a~~~~~~--~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~N  206 (261)
                      .    ..++-  ....|+.|   .+.+ +.-+-|-||=|.--+-
T Consensus       155 I----GSg~Gl~n~~~l~~i---~e~~-~vPvIVDAGiG~pS~A  190 (248)
T cd04728         155 I----GSGQGLLNPYNLRII---IERA-DVPVIVDAGIGTPSDA  190 (248)
T ss_pred             C----CCCCCCCCHHHHHHH---HHHC-CCCEEEECCCCCHHHH
T ss_conf             3----479887999999999---9847-9988984799975678


No 74 
>cd02067 B12-binding B12 binding domain (B12-BD). This domain binds different cobalamid derivates, like B12 (adenosylcobamide) or methylcobalamin or methyl-Co(III) 5-hydroxybenzimidazolylcobamide, it is found in several enzymes, such as glutamate mutase, methionine synthase and methylmalonyl-CoA mutase. Cobalamin undergoes a conformational change on binding the protein; the dimethylbenzimidazole group, which is coordinated to the cobalt in the free cofactor, moves away from the corrin and is replaced by a histidine contributed by the protein. The sequence Asp-X-His-X-X-Gly, which contains this histidine ligand, is conserved in many cobalamin-binding proteins.
Probab=81.85  E-value=5.1  Score=21.61  Aligned_cols=74  Identities=18%  Similarity=0.323  Sum_probs=52.4

Q ss_pred             EEEE-ECCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCHHHHHH
Q ss_conf             5888-34856899999850721289710165553335782213337889999986202696-389972544441479999
Q gi|254780438|r   73 LNIE-GYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGS-RISLFADGNGNEHSLQAA  150 (261)
Q Consensus        73 lNiE-g~p~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~gi-rvSLFIDpd~~q~~i~~a  150 (261)
                      +++- .-|.++|++.+.+.+|+.++|==     +       ...+...++.+++.|++.|. ++-+|+--.+-...-+.+
T Consensus        31 ~~lG~~vp~e~~v~~a~~~~~d~I~lS~-----~-------~~~~~~~~~~~i~~l~~~g~~~i~v~vGG~~~~~~~~~~   98 (119)
T cd02067          31 IDLGVDVPPEEIVEAAKEEDADAIGLSG-----L-------LTTHMTLMKEVIEELKEAGLDDIPVLVGGAIVTRDFKFL   98 (119)
T ss_pred             EECCCCCCHHHHHHHHHHCCCCEEEEEC-----C-------CCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHH
T ss_conf             9899999999999999970999999962-----2-------024268999999999976999985999899897439999


Q ss_pred             HHCCCCEE
Q ss_conf             74066146
Q gi|254780438|r  151 KLTGADCI  158 (261)
Q Consensus       151 ~~~Gad~V  158 (261)
                      +++|+|.+
T Consensus        99 ~~~Gad~~  106 (119)
T cd02067          99 KEIGVDAY  106 (119)
T ss_pred             HHCCCCEE
T ss_conf             98699799


No 75 
>pfam00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family.
Probab=81.39  E-value=5.3  Score=21.50  Aligned_cols=85  Identities=8%  Similarity=-0.010  Sum_probs=41.7

Q ss_pred             HHHHHHCCCCEEEECCCCCHHHHHHHH--HHHHHHHHHHHHHHHHH-HCCCEEEECCCC-CHHHHHHHHHHCCCCEEEEE
Q ss_conf             999974066146511211102444356--43366688999876654-156235207898-98779999973699638842
Q gi|254780438|r  147 LQAAKLTGADCIELYTGPYGACYNNPQ--QERIFLNKLAITAQLAQ-KMDLQINAGHDL-TIQNIPNLINAIPYISEISV  222 (261)
Q Consensus       147 i~~a~~~Gad~VElhTG~Ya~a~~~~~--~~~~el~~i~~aa~~A~-~lgL~VnAGHgL-n~~Nl~~~i~~Ip~I~EvsI  222 (261)
                      .....+.|+|.+++-.|.|........  ............+...+ ..++-|-+--++ +.+....+++. ...+=|++
T Consensus       237 ~~~~~~~g~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~pvi~~G~i~~~~~ae~~l~~-g~~D~V~~  315 (336)
T pfam00724       237 AYAAGELGVRVLDGTRLAYIHAIEPRVTGPFPVETGQQVENNEFIKKVWKGPVITVGRINDPEFAAEIVEE-GRADLVAM  315 (336)
T ss_pred             HHHHHHHCCCEEECCCCCEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHC-CCCEEHHH
T ss_conf             99999838775642766223202443357877563124789999998769859996999989999999987-99443686


Q ss_pred             HHHHHHHHHH
Q ss_conf             5999999999
Q gi|254780438|r  223 GHAFAATALE  232 (261)
Q Consensus       223 GHaiIseAl~  232 (261)
                      |-++|+|-=+
T Consensus       316 gR~~iadPd~  325 (336)
T pfam00724       316 GRPFLADPDL  325 (336)
T ss_pred             HHHHHHCHHH
T ss_conf             6999979139


No 76 
>TIGR00381 cdhD CO dehydrogenase/acetyl-CoA synthase, delta subunit; InterPro: IPR004486 This is the small subunit of a heterodimer which catalyzes the reaction CO + H2O + Acceptor = CO2 + Reduced acceptor and is involved in the synthesis of acetyl-CoA from CO2 and H2.; GO: 0006730 one-carbon compound metabolic process.
Probab=80.92  E-value=1.4  Score=25.58  Aligned_cols=55  Identities=16%  Similarity=0.226  Sum_probs=39.2

Q ss_pred             CCCHHHHHHHHHH-CCCCEEEEECCCCCCCCCHH-------HHHHHHHHHCCCCCCCEEEEEECCCHH
Q ss_conf             8998999999997-49989998247883348889-------999988740001367415888348568
Q gi|254780438|r   23 WPNLVHIGKIALQ-SGASGLTVHPRPDQRHIRYT-------DLPEIRRLIDEQFPKAELNIEGYPNET   82 (261)
Q Consensus        23 ~P~~~~~a~~~~~-~GadgITvH~R~DrRHI~~~-------Dv~~l~~~~~~~~~~~elNiEg~p~~e   82 (261)
                      .-||.+=|+.|++ +|||-||+|+=---=-|.|+       +++++-+-+     ++||=|=|+-+++
T Consensus       142 medP~eWArKcVK~fGAdmvTiHlIsTdPk~~Dksp~EAaK~~EdvLQAV-----dvP~viGGSGnpe  204 (401)
T TIGR00381       142 MEDPAEWARKCVKEFGADMVTIHLISTDPKVKDKSPKEAAKVLEDVLQAV-----DVPLVIGGSGNPE  204 (401)
T ss_pred             HCCHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHC-----CCCEEECCCCCCC
T ss_conf             02833588888876276638864433788546887224788999876340-----6775774788886


No 77 
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5.  Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.
Probab=80.84  E-value=5.5  Score=21.37  Aligned_cols=19  Identities=32%  Similarity=0.188  Sum_probs=13.8

Q ss_pred             HHHHHHCCCCEEEECCCCC
Q ss_conf             9999740661465112111
Q gi|254780438|r  147 LQAAKLTGADCIELYTGPY  165 (261)
Q Consensus       147 i~~a~~~Gad~VElhTG~Y  165 (261)
                      -..|++.|+|.||||-+.-
T Consensus       150 A~rA~~AGfDGVEIH~ahG  168 (361)
T cd04747         150 AADARRLGFDGIELHGAHG  168 (361)
T ss_pred             HHHHHHCCCCEEEECCCCC
T ss_conf             9999983999899510446


No 78 
>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase. This domain binds methylcobalamin, which it uses as an intermediate methyl carrier from methyltetrahydrofolate (CH3H4folate) to homocysteine (Hcy).
Probab=80.70  E-value=5.6  Score=21.34  Aligned_cols=64  Identities=19%  Similarity=0.304  Sum_probs=48.1

Q ss_pred             CCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCC
Q ss_conf             856899999850721289710165553335782213337889999986202696389972544441479999740661
Q gi|254780438|r   79 PNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGAD  156 (261)
Q Consensus        79 p~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad  156 (261)
                      |.+.|++-+.+.+|+-+||=           +| ........+.+++.|++.|++|-++|---|--  =+++.+.+++
T Consensus       127 ~~e~~v~~~~~~~~divglS-----------al-lTtTm~~mk~vi~~l~~~g~~vkv~vGGa~vt--~~fa~~~~~~  190 (213)
T cd02069         127 PIEKILEAAKEHKADIIGLS-----------GL-LVPSLDEMVEVAEEMNRRGIKIPLLIGGAATS--RKHTAVKIAP  190 (213)
T ss_pred             CHHHHHHHHHHCCCCEEEEE-----------CC-CCCCHHHHHHHHHHHHHCCCCEEEEECCCCCC--HHHHHHHHHH
T ss_conf             89999999997499999983-----------23-03049999999999997499817997163278--8899876410


No 79 
>TIGR02146 LysS_fung_arch homocitrate synthase; InterPro: IPR011872    This entry includes the yeast LYS21 gene which carries out the first step of the alpha-aminoadipate (AAA) lysine biosynthesis pathway. A related pathway is found in Thermus thermophilus . This enzyme is closely related to 2-isopropylmalate synthase (LeuA) and citramalate synthase (CimA), both of which are present in the euryarchaeota. Some archaea have a separate homocitrate synthase (AksA) which also synthesizes longer homocitrate analogs .; GO: 0046912 transferase activity transferring acyl groups acyl groups converted into alkyl on transfer, 0019752 carboxylic acid metabolic process.
Probab=80.42  E-value=2.7  Score=23.56  Aligned_cols=168  Identities=19%  Similarity=0.262  Sum_probs=89.9

Q ss_pred             HHHHCCCCCCCCH-------HHHHHHHHHCCCCEE-EEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHH---
Q ss_conf             2322078868998-------999999997499899-98247883348889999988740001367415888348568---
Q gi|254780438|r   14 VLRNRRNLPWPNL-------VHIGKIALQSGASGL-TVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNET---   82 (261)
Q Consensus        14 tLRnaRg~~~P~~-------~~~a~~~~~~GadgI-TvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e---   82 (261)
                      |||+  |+.+|..       ++.|+-.-+.|++-| .=||-      --+|++.=.+.+.      .|.=||....+   
T Consensus         5 TLRE--GEQt~~v~Fs~e~r~eIAkALdd~GV~~IE~g~P~------vS~d~~~~ik~i~------~L~~~G~l~a~iv~   70 (355)
T TIGR02146         5 TLRE--GEQTPGVVFSTEQRVEIAKALDDIGVDYIEVGHPA------VSPDIRKDIKLIA------SLGKEGLLKAKIVT   70 (355)
T ss_pred             CCCC--CCCCCCCCCCHHHHHHHHHHHHHHCCEEEECCCCC------CCHHHHHHHHHHH------HCCCCCCCCHHHHH
T ss_conf             2674--32478860177789999876323181057248875------5477899999998------33888760035567


Q ss_pred             -------HHHHHHHHCCCEEEEEECC-CCCCCCCCCCCHHHHHHHHHHHHHHHCCCC--CEEEEEECCCCC-------CH
Q ss_conf             -------9999985072128971016-555333578221333788999998620269--638997254444-------14
Q gi|254780438|r   83 -------FLNLCERYKPEQITLVPDD-PHQLTSDHGWDFLQNQALLTKTVARLHNLG--SRISLFADGNGN-------EH  145 (261)
Q Consensus        83 -------~i~ia~~ikP~qvtLVPe~-r~elTTegGldv~~~~~~L~~~i~~l~~~g--irvSLFIDpd~~-------q~  145 (261)
                             =++.|.+.-|++|-++==- .--+-..|+.+...-.+...++|+-.|+.|  +.|=.--+ |..       ..
T Consensus        71 Hsra~~~D~~~a~~~~Vd~i~~~~G~S~~~l~~~h~~~~~~al~~i~e~I~y~K~~Gphv~VRFtaE-D~~R~d~~~L~~  149 (355)
T TIGR02146        71 HSRAVLDDIEVAVETEVDRIDVFFGVSKLLLKYKHRKDLEEALEIIAEVIEYAKSHGPHVKVRFTAE-DTFRSDLDDLLK  149 (355)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEECHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCC-CCCHHHHHHHHH
T ss_conf             7899999987764227865787430058885102577889999999999999972488247886478-885121899999


Q ss_pred             HHHHHHHCCCCEEEECCCCCHHHH--HHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCC
Q ss_conf             799997406614651121110244--4356433666889998766541562352078989
Q gi|254780438|r  146 SLQAAKLTGADCIELYTGPYGACY--NNPQQERIFLNKLAITAQLAQKMDLQINAGHDLT  203 (261)
Q Consensus       146 ~i~~a~~~Gad~VElhTG~Ya~a~--~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn  203 (261)
                      .++.++++|+|||=+     |+..  ..|.+...-+++++...  .-..+++||+==||-
T Consensus       150 v~k~a~~~~vDRVsi-----ADTvG~~~P~~~y~L~~~v~~~V--Gpg~~~~~H~HND~G  202 (355)
T TIGR02146       150 VYKTAKEAGVDRVSI-----ADTVGVATPRRVYELVRKVKRVV--GPGVDIEIHAHNDLG  202 (355)
T ss_pred             HHHHHHHCCCCEEEE-----ECCCCCCCCHHHHHHHHHHHHHC--CCCCCEEEEEECCHH
T ss_conf             999997618885675-----13436788068999999998640--887643563017577


No 80 
>pfam01522 Polysacc_deac_1 Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyses glucosidic bonds in xylan.
Probab=80.35  E-value=5.7  Score=21.28  Aligned_cols=39  Identities=23%  Similarity=0.315  Sum_probs=30.5

Q ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCC
Q ss_conf             10165553335782213337889999986202696389972544
Q gi|254780438|r   98 VPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGN  141 (261)
Q Consensus        98 VPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd  141 (261)
                      +|++.=-||=|.||.     +....++..|++.+++.++|+-+.
T Consensus         3 ~~~k~v~lTfDDG~~-----~~~~~~l~~L~~~~i~aTfFv~~~   41 (123)
T pfam01522         3 TPKKSVALTFDDGPP-----DNTPRILDVLKKYGVPATFFVIGG   41 (123)
T ss_pred             CCCCEEEEEECCCCH-----HHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             999789998747973-----519999999998299869972476


No 81 
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional
Probab=79.48  E-value=6.1  Score=21.08  Aligned_cols=159  Identities=18%  Similarity=0.152  Sum_probs=74.1

Q ss_pred             CCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH-HHH---HHH--------
Q ss_conf             88689989999999974998999824788334888999998874000136741588834856-899---999--------
Q gi|254780438|r   20 NLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE-TFL---NLC--------   87 (261)
Q Consensus        20 g~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~-e~i---~ia--------   87 (261)
                      -+.|||+-....-...+|+.-+||-+|-=  .+.+.+-..+-..+....-.+-=|--|.-+. |-+   .++        
T Consensus        91 Tgky~s~~~~~~ai~aSgaeivTVAlRR~--~~~~~~~~~~l~~i~~~~~~~LPNTAGc~ta~eAvr~a~lARe~~~t~~  168 (327)
T PRK11840         91 TGKYKDFEETAAAVEASGAEIVTVAVRRV--NVSDPGAPMLTDYIDPKKYTYLPNTAGCFTAEDAVRTLRLAREAGGWDL  168 (327)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEEEEEEE--CCCCCCCCHHHHHCCCCCCEECCCCCCCCCHHHHHHHHHHHHHHCCCCE
T ss_conf             58999999999999985897699999742--3788896057764180277799856577889999999999998559985


Q ss_pred             --HHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCC
Q ss_conf             --850721289710165553335782213337889999986202696389972544441479999740661465112111
Q gi|254780438|r   88 --ERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY  165 (261)
Q Consensus        88 --~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Y  165 (261)
                        +++-||.-||-||..+                +-+..+.|-+.|-.|--++.+||..  -+...++|+.+|=    |+
T Consensus       169 iKLEVi~D~~tL~Pd~~e----------------tl~Aae~Lv~eGF~VlpY~~dDpv~--akrLed~Gc~avM----Pl  226 (327)
T PRK11840        169 VKLEVLGDQKTLYPDMVE----------------TLKAAEVLVKEGFQVMVYCSDDPIA--AKRLEDAGAVAVM----PL  226 (327)
T ss_pred             EEEEEECCCCCCCCCHHH----------------HHHHHHHHHHCCCEEEEEECCCHHH--HHHHHHCCCEEEE----EC
T ss_conf             899980797667998589----------------9999999997898898871698689--9999875983886----22


Q ss_pred             HHHHHHHHH--HHHHHHHHHHHHHHHHHCCCEEEECCCCCHHH
Q ss_conf             024443564--33666889998766541562352078989877
Q gi|254780438|r  166 GACYNNPQQ--ERIFLNKLAITAQLAQKMDLQINAGHDLTIQN  206 (261)
Q Consensus       166 a~a~~~~~~--~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~N  206 (261)
                      +.-...+.-  ....++.|.+   .+ +.-+-|-||=|---+-
T Consensus       227 gsPIGSg~Gi~n~~~i~~i~e---~~-~vpvivDAGiG~pS~A  265 (327)
T PRK11840        227 GAPIGSGLGIQNPYTIRLIVE---GA-KVPVLVDAGVGTASDA  265 (327)
T ss_pred             CCCCCCCCCCCCHHHHHHHHH---HC-CCCEEEECCCCCHHHH
T ss_conf             452347888689999999997---36-9978995798987899


No 82 
>cd02911 arch_FMN Archeal FMN-binding domain. This family of archaeal proteins are part of the NAD(P)H-dependent flavin oxidoreductase (oxidored) FMN-binding family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN. The specific function of this group is unknown.
Probab=79.29  E-value=6.2  Score=21.04  Aligned_cols=141  Identities=18%  Similarity=0.174  Sum_probs=82.8

Q ss_pred             CEEEEEECCCHHHHHHHHHHC--CCEE-----EEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEE----C
Q ss_conf             415888348568999998507--2128-----9710165553335782213337889999986202696389972----5
Q gi|254780438|r   71 AELNIEGYPNETFLNLCERYK--PEQI-----TLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFA----D  139 (261)
Q Consensus        71 ~elNiEg~p~~e~i~ia~~ik--P~qv-----tLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFI----D  139 (261)
                      +-++|=|+--+.|.+-+..+.  ++.+     |=||.-   .-...|=-+.++.+.+..+++.++..++.||+=|    |
T Consensus        75 v~vQi~g~~~e~~~~Aa~~~~~~~d~IDiN~GCP~~kV---~~~g~GsaLl~dp~~~~~iv~avk~~~~PVtvKiR~G~d  151 (233)
T cd02911          75 VGVNVRSSSLEPLLNAAALVAKNAAILEINAHCRQPEM---VEAGAGEALLKDPERLSEFIKALKETGVPVSVKIRAGVD  151 (233)
T ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCHHH---CCCCCHHHHCCCHHHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             18993069999999999997436999999799992898---379753777389899999999998538984279856999


Q ss_pred             CCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEE
Q ss_conf             44441479999740661465112111024443564336668899987665415623520789898779999973699638
Q gi|254780438|r  140 GNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISE  219 (261)
Q Consensus       140 pd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~E  219 (261)
                      ++.. ...+.+.+.|++.|-.|+-.|..    .    ..++.|++.   +.++-+--| |-=.+.+-....++  -..+-
T Consensus       152 ~~~~-~~a~~~e~aG~~~l~v~~~~~~~----~----ad~~~I~~~---~~~i~VigN-GDI~s~eda~~~~~--~G~Dg  216 (233)
T cd02911         152 VDDE-ELARLIEKAGADIIHVDAMDPGN----H----ADLKKIRDI---STELFIIGN-NSVTTIESAKEMFS--YGADM  216 (233)
T ss_pred             CCHH-HHHHHHHHHCCCEEEEECCCCCC----H----HHHHHHHHH---CCCCEEEEE-CCCCCHHHHHHHHH--HCCCE
T ss_conf             8889-99999998396079943207785----0----899999986---379879980-89699999999998--59999


Q ss_pred             EEEHHHHHHH
Q ss_conf             8425999999
Q gi|254780438|r  220 ISVGHAFAAT  229 (261)
Q Consensus       220 vsIGHaiIse  229 (261)
                      |.||-+-...
T Consensus       217 VMIgRgAL~n  226 (233)
T cd02911         217 VSVARASLPE  226 (233)
T ss_pred             EEECHHHCCC
T ss_conf             9973875568


No 83 
>PRK00208 thiG thiazole synthase; Reviewed
Probab=79.00  E-value=6.3  Score=20.98  Aligned_cols=158  Identities=16%  Similarity=0.121  Sum_probs=77.5

Q ss_pred             CCCCCCHHHHHHHHHHCCCCEEEEECCCCCC-CCCHHHHHHHHHHHCCCCCCCEEEEEECCCH-HHH---HHHH------
Q ss_conf             8868998999999997499899982478833-4888999998874000136741588834856-899---9998------
Q gi|254780438|r   20 NLPWPNLVHIGKIALQSGASGLTVHPRPDQR-HIRYTDLPEIRRLIDEQFPKAELNIEGYPNE-TFL---NLCE------   88 (261)
Q Consensus        20 g~~~P~~~~~a~~~~~~GadgITvH~R~DrR-HI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~-e~i---~ia~------   88 (261)
                      -+.|||+-....-...+|++=+||-+|--.- .-..+++.+   .+....-.+-=|--|.-+. |-+   .++.      
T Consensus        17 Tgky~s~~~~~~ai~aSg~eivTVAlRR~~~~~~~~~~~l~---~i~~~~~~lLPNTAGc~ta~EAVr~A~laRE~~~tn   93 (256)
T PRK00208         17 TGKYPSPEVMQEAIEASGAEIVTVALRRVNLGDPGGDNLLD---LLDPLGVTLLPNTAGCRTAEEAVRTARLAREALGTD   93 (256)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEEEEEEECCCCCCCHHHHH---HHCCCCCEECCCCCCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             48999999999999996897799998642477898505888---743158567666403267999999999999984898


Q ss_pred             ----HHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCC
Q ss_conf             ----5072128971016555333578221333788999998620269638997254444147999974066146511211
Q gi|254780438|r   89 ----RYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGP  164 (261)
Q Consensus        89 ----~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~  164 (261)
                          ++-||.-||-||..+                +-+.-+.|-+.|-.|--++.+||-.  -+...++|+.+|=----|
T Consensus        94 wIKLEVi~D~~~LlPD~~e----------------tl~Aae~Lv~eGF~VlpY~~~D~v~--akrLe~~Gc~avMPlgsP  155 (256)
T PRK00208         94 WIKLEVIGDDKTLLPDPIE----------------TLKAAEILVKEGFVVLPYCTDDPVL--AKRLEEAGCAAVMPLGAP  155 (256)
T ss_pred             EEEEEEECCCCCCCCCHHH----------------HHHHHHHHHHCCCEEEEECCCCHHH--HHHHHHCCCEEEEECCCC
T ss_conf             6999981797677988689----------------9999999998899897867889899--999997495345204564


Q ss_pred             CHHHHHHHHH--HHHHHHHHHHHHHHHHHCCCEEEECCCCCHHH
Q ss_conf             1024443564--33666889998766541562352078989877
Q gi|254780438|r  165 YGACYNNPQQ--ERIFLNKLAITAQLAQKMDLQINAGHDLTIQN  206 (261)
Q Consensus       165 Ya~a~~~~~~--~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~N  206 (261)
                      .    ..++-  ....|+.|   .+.+ +.-+-|-||=|.--+-
T Consensus       156 I----GSg~Gl~n~~~l~~i---~e~~-~vPvIVDAGiG~pS~A  191 (256)
T PRK00208        156 I----GSGLGLLNPYNLRII---IEQA-DVPVIVDAGIGTPSDA  191 (256)
T ss_pred             C----CCCCCCCCHHHHHHH---HHHC-CCCEEEECCCCCHHHH
T ss_conf             3----479887999999999---9867-9988985788976678


No 84 
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure. Specific for this family is the conserved phosphate binding site at the edges of strands 7 and 8. The phosphate comes either from the substrate, as in the case of inosine monophosphate dehydrogenase (IMPDH), or from ribulose-5-phosphate 3-epimerase (RPE) or from cofactors, like FMN.
Probab=78.69  E-value=6.4  Score=20.92  Aligned_cols=177  Identities=14%  Similarity=0.115  Sum_probs=103.8

Q ss_pred             CCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHH----HHHHHHHHCCCCCCCEEEEEECCC----HHHHHHHHHHCCCEE
Q ss_conf             998999999997499899982478833488899----999887400013674158883485----689999985072128
Q gi|254780438|r   24 PNLVHIGKIALQSGASGLTVHPRPDQRHIRYTD----LPEIRRLIDEQFPKAELNIEGYPN----ETFLNLCERYKPEQI   95 (261)
Q Consensus        24 P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~D----v~~l~~~~~~~~~~~elNiEg~p~----~e~i~ia~~ikP~qv   95 (261)
                      ..+++.++.+.++|+++|.+..+..-.-....+    +.+.++....   ..=+|+-.+|.    +.+.+.+.+..=+.|
T Consensus        12 ~~~~E~a~~~~~aGa~~i~~~~~~~~~~~~~~~~~~~i~~~~~~t~~---P~~v~~~~~~~~~~~~~~~~~~~~~g~d~v   88 (200)
T cd04722          12 GDPVELAKAAAEAGADAIIVGTRSSDPEEAETDDKEVLKEVAAETDL---PLGVQLAINDAAAAVDIAAAAARAAGADGV   88 (200)
T ss_pred             CCHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHCCC---CEEEEEECCCCCCCCHHHHHHHHHCCCCEE
T ss_conf             78999999998688736886488798246169999999999970799---879984205666677599999998399989


Q ss_pred             EEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC--CCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHH
Q ss_conf             97101655533357822133378899999862026--9638997254444147999974066146511211102444356
Q gi|254780438|r   96 TLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNL--GSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ  173 (261)
Q Consensus        96 tLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~--girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~  173 (261)
                      .+.-..+.+            .....+.++.+++.  ++.+..-..|.... ....+.+.|+|.|=+....+........
T Consensus        89 ~i~~~~~~~------------~~~~~~~~~~~~~~~~~~~vi~~~~~~~~~-~~~~a~~~g~~~v~~~~~~~~~~~~~~~  155 (200)
T cd04722          89 EIHGAVGYL------------AREDLELIRELREAVPDVKVVVKLSPTGEL-AAAAAEEAGVDEVGLGNGGGGGGGRDAV  155 (200)
T ss_pred             EECCCCCCC------------CCCHHHHHHHHHHHCCCCEEEEECCCCCHH-HHHHHHHCCCCEEEECCCCCCCCCCCCC
T ss_conf             978999654------------300689999999844896499968999999-9999998099799970874678887666


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEECCCCCH-HHHHHHHHHCCCCEEEEEH
Q ss_conf             4336668899987665415623520789898-7799999736996388425
Q gi|254780438|r  174 QERIFLNKLAITAQLAQKMDLQINAGHDLTI-QNIPNLINAIPYISEISVG  223 (261)
Q Consensus       174 ~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~-~Nl~~~i~~Ip~I~EvsIG  223 (261)
                      ..     -+...........+-|=||=|++. +++...++ . .-+-|.+|
T Consensus       156 ~~-----~~~~~~~~~~~~~ipvi~~gGi~~~~~~~~~~~-~-gAdgv~vG  199 (200)
T cd04722         156 PI-----ADLLLILAKRGSKVPVIAGGGINDPEDAAEALA-L-GADGVIVG  199 (200)
T ss_pred             CH-----HHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHH-C-CCCEEEEC
T ss_conf             11-----689999999857999899758799999999998-5-99889818


No 85 
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]
Probab=77.90  E-value=2.9  Score=23.28  Aligned_cols=115  Identities=13%  Similarity=0.171  Sum_probs=66.1

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCC--CEEEEEE----C-CC-CCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHH
Q ss_conf             8221333788999998620269--6389972----5-44-4414799997406614651121110244435643366688
Q gi|254780438|r  110 GWDFLQNQALLTKTVARLHNLG--SRISLFA----D-GN-GNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK  181 (261)
Q Consensus       110 Gldv~~~~~~L~~~i~~l~~~g--irvSLFI----D-pd-~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~  181 (261)
                      |=-+.++.+.+.++|+.+++..  +.||+=|    | ++ ....-.+.+.+.|++.+=+|-=.-+.-|..+.    .++.
T Consensus       113 Ga~Ll~~p~lv~~iv~a~~~av~~iPVTVKiRlG~d~~~~~~~~ia~~~~~~G~~~ltVHgRtr~~~y~~~a----~~~~  188 (323)
T COG0042         113 GAALLKNPELLAEIVKAMVEAVGDIPVTVKIRLGWDDDDILALEIARILEDAGADALTVHGRTRAQGYLGPA----DWDY  188 (323)
T ss_pred             CHHHCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHCCHHHHHHHHHHCCCCEEEEECCCHHHCCCCCC----CHHH
T ss_conf             477717989999999999985388874999857878002009999999996798789995566764689864----8799


Q ss_pred             HHHHHHHHHHCCCEEEECCC-CCHHHHHHHHHHCCCCEEEEEHHHHHHHHH
Q ss_conf             99987665415623520789-898779999973699638842599999999
Q gi|254780438|r  182 LAITAQLAQKMDLQINAGHD-LTIQNIPNLINAIPYISEISVGHAFAATAL  231 (261)
Q Consensus       182 i~~aa~~A~~lgL~VnAGHg-Ln~~Nl~~~i~~Ip~I~EvsIGHaiIseAl  231 (261)
                      +++..+...+  +-|=+-=| .+.+.....++ .-+.+-|-||-+....--
T Consensus       189 I~~vk~~~~~--ipvi~NGdI~s~~~a~~~l~-~tg~DgVMigRga~~nP~  236 (323)
T COG0042         189 IKELKEAVPS--IPVIANGDIKSLEDAKEMLE-YTGADGVMIGRGALGNPW  236 (323)
T ss_pred             HHHHHHHCCC--CEEEECCCCCCHHHHHHHHH-HHCCCEEEECHHHHCCCH
T ss_conf             9999986799--75985799499999999998-418987997435316955


No 86 
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family; InterPro: IPR004652   This family represents one branch of COG0042 from COG (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family) and includes NifR3 itself, from Rhodobacter capsulatus. Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes , and also in some archaea. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. ; GO: 0016491 oxidoreductase activity, 0050660 FAD binding, 0008033 tRNA processing.
Probab=77.73  E-value=1.6  Score=25.10  Aligned_cols=24  Identities=38%  Similarity=0.500  Sum_probs=12.7

Q ss_pred             CCCHHHHHHHHHHCCCCEEEEECC
Q ss_conf             899899999999749989998247
Q gi|254780438|r   23 WPNLVHIGKIALQSGASGLTVHPR   46 (261)
Q Consensus        23 ~P~~~~~a~~~~~~GadgITvH~R   46 (261)
                      +=|..++|++++++||.-+|||.|
T Consensus       158 h~n~~~~a~~a~~~Ga~Av~lHGR  181 (336)
T TIGR00737       158 HINAVEAARIAEDAGAQAVTLHGR  181 (336)
T ss_pred             CCCHHHHHHHHHHCCCCEEEHHHH
T ss_conf             488899999998724000211100


No 87 
>cd03465 URO-D_like The URO-D _like protein superfamily includes bacterial and eukaryotic uroporphyrinogen decarboxylases (URO-D), coenzyme M methyltransferases and other putative bacterial methyltransferases. Uroporphyrinogen decarboxylase (URO-D) decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, an important branching point of the tetrapyrrole biosynthetic pathway. The methyltransferases represented here are important for ability of methanogenic organisms to use other compounds than carbon dioxide for reduction to methane.
Probab=77.53  E-value=6.9  Score=20.70  Aligned_cols=95  Identities=20%  Similarity=0.280  Sum_probs=56.8

Q ss_pred             HHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCC-CCHHHHHH------------HH-------HHHH
Q ss_conf             8899999862026963899725444414799997406614651121-11024443------------56-------4336
Q gi|254780438|r  118 ALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTG-PYGACYNN------------PQ-------QERI  177 (261)
Q Consensus       118 ~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG-~Ya~a~~~------------~~-------~~~~  177 (261)
                      ..++++++.+++.+..+.+|+.-+.. ..++..+++|+|.+-+..+ +.+.+...            +.       .+++
T Consensus       208 p~~k~i~~~~~~~~~~~ilh~~g~~~-~~l~~~~~~~~~~~~~d~~~~l~~~~~~~~~~~~i~Gnldp~~~l~~gt~e~i  286 (330)
T cd03465         208 PYLKKVFDAIKALGGPVIHHNCGDTA-PILELMADLGADVFSIDVTVDLAEAKKKVGDKACLMGNLDPIDVLLNGSPEEI  286 (330)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCHH-HHHHHHHHCCCCEEEECCCCCHHHHHHHHCCCCEEEECCCHHHHHCCCCHHHH
T ss_conf             99999999977549983674078628-79999986588889858889999999980999258817987898757999999


Q ss_pred             HHHHHHHHHHHHHH--CCCEEEECCCC----CHHHHHHHHHHC
Q ss_conf             66889998766541--56235207898----987799999736
Q gi|254780438|r  178 FLNKLAITAQLAQK--MDLQINAGHDL----TIQNIPNLINAI  214 (261)
Q Consensus       178 el~~i~~aa~~A~~--lgL~VnAGHgL----n~~Nl~~~i~~I  214 (261)
                       .+..+++.+.+..  .|.-+|.|||+    ..+|+..++..+
T Consensus       287 -~~~v~~~l~~~~~~~~g~I~~~G~gi~~~tp~env~a~v~av  328 (330)
T cd03465         287 -KEEVKELLEKLLKGGGGYILSSGCEIPPDTPIENIKAMIDAV  328 (330)
T ss_pred             -HHHHHHHHHHHCCCCCCEEECCCCCCCCCCCHHHHHHHHHHH
T ss_conf             -999999999853799998981899879999999999999996


No 88 
>smart00052 EAL Putative diguanylate phosphodiesterase. Putative diguanylate phosphodiesterase, present in a variety of bacteria.
Probab=76.21  E-value=7.5  Score=20.46  Aligned_cols=173  Identities=20%  Similarity=0.193  Sum_probs=93.2

Q ss_pred             HHHH--HCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHC------CCCCCCEEEEEECCC----
Q ss_conf             2232--2078868998999999997499899982478833488899999887400------013674158883485----
Q gi|254780438|r   13 AVLR--NRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLID------EQFPKAELNIEGYPN----   80 (261)
Q Consensus        13 AtLR--naRg~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~------~~~~~~elNiEg~p~----   80 (261)
                      |++|  +..|+..| |-++-..++..|..             ..-|-+.+...+.      ...+...+.+-..+.    
T Consensus        33 al~R~~~~~~~~l~-p~~f~~~a~~~~~~-------------~~ld~~vl~~~~~~~~~~~~~~~~~~l~iNls~~~l~~   98 (241)
T smart00052       33 ALIRWQHPEGGIIS-PDEFIPLAEETGLI-------------VPLGRWVLEQACQQLAEWQAQGPPLRISINLSARQLIS   98 (241)
T ss_pred             EEEEEECCCCCEEC-HHHHHHHHHHCCCH-------------HHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHCC
T ss_conf             99978879998888-99999999985971-------------89999999999999999897389826999936899459


Q ss_pred             HHHHH----HHHH--HCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCC
Q ss_conf             68999----9985--07212897101655533357822133378899999862026963899725444414799997406
Q gi|254780438|r   81 ETFLN----LCER--YKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTG  154 (261)
Q Consensus        81 ~e~i~----ia~~--ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~G  154 (261)
                      ++|..    +..+  +.|.+++|      |+| |+.  ...+...+...++.+++.|++++|= |-.....+++....+.
T Consensus        99 ~~f~~~l~~~l~~~~~~~~~lv~------Ei~-E~~--~~~~~~~~~~~i~~l~~~G~~iaiD-dfG~~~~~~~~l~~l~  168 (241)
T smart00052       99 PDLVPRVLELLEETGLPPQRLEL------EIT-ESV--LLDDDESAVATLQRLRELGVRIALD-DFGTGYSSLSYLKRLP  168 (241)
T ss_pred             CHHHHHHHHHHHHHCCCHHHEEE------EEC-HHH--HHCCHHHHHHHHHHHHHCCCCEEEC-CCCCCCCHHHHHHHCC
T ss_conf             35999999999980969889266------723-577--6408999999999999709978753-7899810189998657


Q ss_pred             CCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHC
Q ss_conf             614651121110244435643366688999876654156235207898987799999736
Q gi|254780438|r  155 ADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAI  214 (261)
Q Consensus       155 ad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~I  214 (261)
                      +|.|-|.- .|-.........   ...++....+|+++|+.|-|-.==|.+-+.. +..+
T Consensus       169 ~d~iKld~-~li~~~~~~~~~---~~~~~~l~~~a~~~g~~viaegVE~~~~~~~-l~~~  223 (241)
T smart00052      169 VDLLKIDK-SFVRDLQTDPED---EAIVQSIIELAQKLGLQVVAEGVETPEQLDL-LRSL  223 (241)
T ss_pred             CHHHCCCH-HHHHHCCCCHHH---HHHHHHHHHHHHHCCCEEEEEECCCHHHHHH-HHHC
T ss_conf             20422479-999613268455---8999999999998599899971881999999-9974


No 89 
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional
Probab=76.16  E-value=5.2  Score=21.54  Aligned_cols=132  Identities=20%  Similarity=0.175  Sum_probs=67.2

Q ss_pred             CCHHHHHHHHHHCCCCEEEE-ECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEE------E--ECCCHHHHHHHHHHCCCE
Q ss_conf             99899999999749989998-24788334888999998874000136741588------8--348568999998507212
Q gi|254780438|r   24 PNLVHIGKIALQSGASGLTV-HPRPDQRHIRYTDLPEIRRLIDEQFPKAELNI------E--GYPNETFLNLCERYKPEQ   94 (261)
Q Consensus        24 P~~~~~a~~~~~~GadgITv-H~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNi------E--g~p~~e~i~ia~~ikP~q   94 (261)
                      ..-++.|+...+.|.+-|-+ +|=-     -..|...++.+......+.++-.      +  ..+.+.-++-+.+.+-..
T Consensus        27 ~eKl~ia~~L~~lGv~~IEvGfPaa-----s~~D~e~~~~i~~~~l~~a~i~a~~~~~r~~~~~~~D~~i~al~~a~~~~  101 (530)
T PRK12344         27 EDKLRIARKLDELGVDYIEGGWPGS-----NPKDTEFFKRAKELKLKHAKLAAFGSTRRAGVSAENDPNLAALLAAGTPV  101 (530)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCC-----CHHHHHHHHHHHHCCCCCCEEEEEEHHCCCCCCCCCCHHHHHHHHCCCCE
T ss_conf             9999999999985999999346667-----86389999999863576547985310113467855235089998389998


Q ss_pred             EEEE-ECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEE---------CCCCCCHHHHHHHHCCCCEEEE
Q ss_conf             8971-0165553335782213337889999986202696389972---------5444414799997406614651
Q gi|254780438|r   95 ITLV-PDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFA---------DGNGNEHSLQAAKLTGADCIEL  160 (261)
Q Consensus        95 vtLV-Pe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFI---------Dpd~~q~~i~~a~~~Gad~VEl  160 (261)
                      ++++ |-.+-+++---|.+-....+...+.++..++.|.+|+.-.         ||+.-...++++.+.|+++|-|
T Consensus       102 v~i~~~tS~~h~~~~l~~t~~e~l~~i~~~v~~a~~~g~~V~~~~E~f~Da~R~d~efl~ev~~aa~~aGa~~i~l  177 (530)
T PRK12344        102 VTIFGKSWDLHVTEALGTTLEENLAMIRDSVAYLKAHGREVIYDAEHFFDGYKANPEYALATLKAAAEAGADWVVL  177 (530)
T ss_pred             EEEEECCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9999554599998872599999999999999999971987994132136643379999999999998529960023


No 90 
>PRK06256 biotin synthase; Validated
Probab=76.02  E-value=7.6  Score=20.42  Aligned_cols=201  Identities=11%  Similarity=0.058  Sum_probs=105.4

Q ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHH-CCCCEEEEECCCCCCCCCHHH--HHHHHHHHCCCCCCCEEEEEECC---CHHH
Q ss_conf             44322322078868998999999997-499899982478833488899--99988740001367415888348---5689
Q gi|254780438|r   10 NAVAVLRNRRNLPWPNLVHIGKIALQ-SGASGLTVHPRPDQRHIRYTD--LPEIRRLIDEQFPKAELNIEGYP---NETF   83 (261)
Q Consensus        10 dhiAtLRnaRg~~~P~~~~~a~~~~~-~GadgITvH~R~DrRHI~~~D--v~~l~~~~~~~~~~~elNiEg~p---~~e~   83 (261)
                      +-+..|=++.+.+.+.+..+|...-+ .--+.|.+.     ..|.-+-  ...=+..|... ....-+++-++   .+++
T Consensus        22 eEal~Ll~~~d~dl~~L~~~A~~iR~~~~G~~v~l~-----~iin~kng~C~edC~yCaqs-~~~~~~~~~y~ll~~eeI   95 (325)
T PRK06256         22 EEALALLNLPDDDLLELLAAAYEVRKHYFGKEVKLN-----SIINLKSGLCPEDCGYCSQS-AGSSSPIYRYAWLDIEEI   95 (325)
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEEE-----EEEEECCCCCCCCCCCCCCC-CCCCCCCCCCCCCCHHHH
T ss_conf             999999809937699999999999998489979999-----88876189889999629890-767899741278999999


Q ss_pred             HHHHHHHCC---CEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCC-CCCEEEEEECCCCCCHHHHHHHHCCCCEEE
Q ss_conf             999985072---1289710165553335782213337889999986202-696389972544441479999740661465
Q gi|254780438|r   84 LNLCERYKP---EQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHN-LGSRISLFADGNGNEHSLQAAKLTGADCIE  159 (261)
Q Consensus        84 i~ia~~ikP---~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~-~girvSLFIDpd~~q~~i~~a~~~Gad~VE  159 (261)
                      ++-|...+-   +.+|||       |+.+|.+ ....+++...++.+|+ .++.+.+-+-. .++.++...|+.|+|++=
T Consensus        96 ~~~a~~a~~~G~~~~~lv-------tsg~~~~-~~~~e~v~~~i~~Ik~~~~l~i~~slG~-l~~e~~~~LkeAGvd~y~  166 (325)
T PRK06256         96 VEAAKEAIENGAGRFCIV-------ASGRGPS-GREVDQVIEAVKAIKEETDLEICACLGL-LTEEQAERLKEAGVDRYN  166 (325)
T ss_pred             HHHHHHHHHCCCCEEEEE-------EECCCCC-HHHHHHHHHHHHHHHHCCCEEEEEECCC-CCHHHHHHHHHCCCCEEC
T ss_conf             999999998699889998-------6045897-6789999999999862289368873488-999999999986998886


Q ss_pred             ECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEE----CCCCCHHHHHHHHHHCCC--CEEEEEHHHH
Q ss_conf             112111024443564336668899987665415623520----789898779999973699--6388425999
Q gi|254780438|r  160 LYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINA----GHDLTIQNIPNLINAIPY--ISEISVGHAF  226 (261)
Q Consensus       160 lhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnA----GHgLn~~Nl~~~i~~Ip~--I~EvsIGHai  226 (261)
                      .+-......|.+-.... .++.-.++.+.|++.|+.|..    |+|=+++-....+-.+.+  .+.|.|+.++
T Consensus       167 ~nlETs~~~f~~i~~th-t~~~Rl~ti~~a~~aGi~vcsG~i~GlGEt~edrve~l~~Lr~l~~~sipin~l~  238 (325)
T PRK06256        167 HNLETSRSYFPNVVTTH-TYEDRVDTCEMVKAAGIEPCSGGIIGMGETLEDRAEHAFFLKELDADSIPINFLN  238 (325)
T ss_pred             CCCCCCHHHCCCCCCCC-CHHHHHHHHHHHHHCCCCCCCCEEECCCCCHHHHHHHHHHHHCCCCCEEECCCCE
T ss_conf             66440687638868998-8999999999999859964664376689998999999999971999889546701


No 91 
>KOG3111 consensus
Probab=75.33  E-value=7.9  Score=20.30  Aligned_cols=159  Identities=20%  Similarity=0.209  Sum_probs=94.5

Q ss_pred             HHHHHHCCCCC--------CCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHH
Q ss_conf             32232207886--------8998999999997499899982478833488899999887400013674158883485689
Q gi|254780438|r   12 VAVLRNRRNLP--------WPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETF   83 (261)
Q Consensus        12 iAtLRnaRg~~--------~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~   83 (261)
                      |--||+.-+.+        --+|.+....-.++||++.|+|.-.-+-      +..+.+-+.+.  ...+-+-..|-...
T Consensus        54 V~slr~~~~~~~ffD~HmMV~~Peq~v~~~a~agas~~tfH~E~~q~------~~~lv~~ir~~--gmk~G~alkPgT~V  125 (224)
T KOG3111          54 VESLRKHTGADPFFDVHMMVENPEQWVDQMAKAGASLFTFHYEATQK------PAELVEKIREK--GMKVGLALKPGTPV  125 (224)
T ss_pred             HHHHHHCCCCCCCEEEEEEECCHHHHHHHHHHCCCCEEEEEEEECCC------HHHHHHHHHHC--CCEEEEEECCCCCH
T ss_conf             99998525888523678764698887679986477569998643257------89999999974--97566874899958


Q ss_pred             HHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCC
Q ss_conf             99998507212897101655533357822133378899999862026963899725444414799997406614651121
Q gi|254780438|r   84 LNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTG  163 (261)
Q Consensus        84 i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG  163 (261)
                      -.+..-..+--.-||      .|-|-|+-=.+-....-+.++.|++..-..-+=+|-...-++|..+.+-||++|=--|+
T Consensus       126 e~~~~~~~~~D~vLv------MtVePGFGGQkFme~mm~KV~~lR~kyp~l~ieVDGGv~p~ti~~~a~AGAN~iVaGsa  199 (224)
T KOG3111         126 EDLEPLAEHVDMVLV------MTVEPGFGGQKFMEDMMPKVEWLREKYPNLDIEVDGGVGPSTIDKAAEAGANMIVAGSA  199 (224)
T ss_pred             HHHHHHHHHCCEEEE------EEECCCCCHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHCCCCEEEECCE
T ss_conf             999976410257999------98548975045789998999999986898438854886821377998758887986333


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             11024443564336668899987665
Q gi|254780438|r  164 PYGACYNNPQQERIFLNKLAITAQLA  189 (261)
Q Consensus       164 ~Ya~a~~~~~~~~~el~~i~~aa~~A  189 (261)
                      -|-.+  ++.   ..++-++.....|
T Consensus       200 vf~a~--d~~---~vi~~lr~~v~~a  220 (224)
T KOG3111         200 VFGAA--DPS---DVISLLRNSVEKA  220 (224)
T ss_pred             EECCC--CHH---HHHHHHHHHHHHH
T ss_conf             45279--989---9999999998665


No 92 
>PRK13114 consensus
Probab=75.29  E-value=7.9  Score=20.30  Aligned_cols=212  Identities=17%  Similarity=0.193  Sum_probs=127.3

Q ss_pred             CCCCHHHH---HHHHHHCCCCEEEEE-----CCCCCCCCCH------------HHHHHHHHHHCCCCCCCEEEEEECCCH
Q ss_conf             68998999---999997499899982-----4788334888------------999998874000136741588834856
Q gi|254780438|r   22 PWPNLVHI---GKIALQSGASGLTVH-----PRPDQRHIRY------------TDLPEIRRLIDEQFPKAELNIEGYPNE   81 (261)
Q Consensus        22 ~~P~~~~~---a~~~~~~GadgITvH-----~R~DrRHI~~------------~Dv~~l~~~~~~~~~~~elNiEg~p~~   81 (261)
                      .+||+-..   .....++|||-|-+-     |--|---||.            +|+.++-+-+...++++|+=+=+|-++
T Consensus        22 G~P~~~~t~~~i~~l~~~GaDiiEiGiPFSDP~ADGpvIq~A~~rAL~~G~~l~~~f~~v~~~r~~~~~~PivlM~Y~N~  101 (266)
T PRK13114         22 GDPTPGDTAANLDALVAGGADVIELGMPFTDPMADGPAIQAANLRSLAAGTTTADIFRIAAEFRQRHPEVPLVLMGYANP  101 (266)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCEEEEEEHHH
T ss_conf             18998999999999997699999979998886776899999999999869979999999999874189988799863019


Q ss_pred             -------HHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCC
Q ss_conf             -------8999998507212897101655533357822133378899999862026963899725444414799997406
Q gi|254780438|r   82 -------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTG  154 (261)
Q Consensus        82 -------e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~G  154 (261)
                             .|.+-+.+.-=+-+ |+||-|-|              .-.++...+++.|+..-.|+-|..++.-++...+..
T Consensus       102 i~~~G~~~F~~~~~~aGvdG~-IipDLP~e--------------E~~~~~~~~~~~gi~~I~liaPtt~~~Ri~~i~~~a  166 (266)
T PRK13114        102 MVRRGPDWFAAECKKAGVDGV-ICVDIPPE--------------EDAELGPALRAAGIDPIRLATPTTDAARLPAVLEGA  166 (266)
T ss_pred             HHHHHHHHHHHHHHHCCCCEE-EECCCCHH--------------HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHC
T ss_conf             998649999999997499779-84589978--------------889999999974997267756999799999999738


Q ss_pred             CCEEEE--CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCH-HHHHHHHHHCCCCEEEEEHHHHHHHHH
Q ss_conf             614651--12111024443564336668899987665415623520789898-779999973699638842599999999
Q gi|254780438|r  155 ADCIEL--YTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTI-QNIPNLINAIPYISEISVGHAFAATAL  231 (261)
Q Consensus       155 ad~VEl--hTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~-~Nl~~~i~~Ip~I~EvsIGHaiIseAl  231 (261)
                      -..|=.  .+|.=...-.........+++++.      ...+-|-+|-|..- +-+.. +++  .-+=|-||-+||-.--
T Consensus       167 ~gFiY~vs~~GvTG~~~~~~~~~~~~i~~ik~------~t~~Pv~vGFGIs~~e~~~~-~~~--~ADGvIVGSaiVk~I~  237 (266)
T PRK13114        167 SGFLYYVSVAGITGMQQAAQASIEAAVARIKA------ATDLPVAVGFGVRTPEQAAA-IAR--VADGVVVGSAFVDLIG  237 (266)
T ss_pred             CCCEEEEECCCCCCCCCCCHHHHHHHHHHHHH------HCCCCEEEECCCCCHHHHHH-HHH--CCCEEEECHHHHHHHH
T ss_conf             99589984455667765665889999999997------07998699836698999999-980--0999998199999998


Q ss_pred             HHH--HHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             940--99999999999974105655403
Q gi|254780438|r  232 ECG--VKEAVFCFRRACGQHLDNTMRLT  257 (261)
Q Consensus       232 ~~G--L~~aI~~~~~ii~~~~~~~~~~~  257 (261)
                      ..|  ..+.|.+|-+-+++..+.+++.+
T Consensus       238 e~~~~~~~~v~~~~k~l~~~i~~~~~~~  265 (266)
T PRK13114        238 EHGADAAAPVEELTKTLADAIHSARKEA  265 (266)
T ss_pred             HCCCCHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             7371556899999999999999877512


No 93 
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP). Most PRAIs are monomeric, monofunctional and thermolabile, but in some thermophile organisms PRAI is dimeric for reasons of stability and in others it is fused to other components of the tryptophan biosynthesis pathway to form multifunctional enzymes.
Probab=74.80  E-value=8.1  Score=20.21  Aligned_cols=167  Identities=19%  Similarity=0.191  Sum_probs=90.6

Q ss_pred             HHHHHHHHCCCCEEEEECCC-CCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH-HHHHHHHHHCCCEEEEEECCCCCC
Q ss_conf             99999997499899982478-8334888999998874000136741588834856-899999850721289710165553
Q gi|254780438|r   28 HIGKIALQSGASGLTVHPRP-DQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE-TFLNLCERYKPEQITLVPDDPHQL  105 (261)
Q Consensus        28 ~~a~~~~~~GadgITvH~R~-DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~-e~i~ia~~ikP~qvtLVPe~r~el  105 (261)
                      +-+..|.++|||-+=+-.-| -.|+|..+....|.+.+...  -...-+=.+++. ++.+++...+|+.+-|        
T Consensus        10 ~d~~~~~~~g~d~iGfif~~~SpR~i~~~~a~~l~~~~~~~--~~~V~Vfvn~~~~~i~~~~~~~~~d~vQl--------   79 (203)
T cd00405          10 EDALAAAEAGADAIGFIFAPKSPRYVSPEQAREIVAALPPF--VKRVGVFVNEDLEEILEIAEELGLDVVQL--------   79 (203)
T ss_pred             HHHHHHHHCCCCEEEEECCCCCCCEECHHHHHHHHHHCCCC--CEEEEEEECCCHHHHHHHHHHCCCCEEEE--------
T ss_conf             99999985799989885569989711899999999736998--53999991683999999998769988998--------


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCC-CCEEEEEECCCCCCHHHHHHHH--CCCCEEEECCCCCHHHHHHHHHHH-HHHHH
Q ss_conf             3357822133378899999862026-9638997254444147999974--066146511211102444356433-66688
Q gi|254780438|r  106 TSDHGWDFLQNQALLTKTVARLHNL-GSRISLFADGNGNEHSLQAAKL--TGADCIELYTGPYGACYNNPQQER-IFLNK  181 (261)
Q Consensus       106 TTegGldv~~~~~~L~~~i~~l~~~-girvSLFIDpd~~q~~i~~a~~--~Gad~VElhTG~Ya~a~~~~~~~~-~el~~  181 (261)
                         ||=.   ..++    +..|+.. ++++---+-+..+ ..++.+..  -.+|.+=|-|.+-...-..+.... ..++.
T Consensus        80 ---HG~e---~~~~----~~~lk~~~~~~iikai~v~~~-~~~~~~~~~~~~~d~~L~Ds~~~~~~GGtG~~fdw~~l~~  148 (203)
T cd00405          80 ---HGDE---SPEY----CAQLRARLGLPVIKAIRVKDE-EDLEKAAAYAGEVDAILLDSKSGGGGGGTGKTFDWSLLRG  148 (203)
T ss_pred             ---CCCC---CHHH----HHHHHHHCCCEEEEEECCCCH-HHHHHHHHHCCCCCEEEEECCCCCCCCCCCCEECHHHHHH
T ss_conf             ---7899---9799----999875059649999614977-7799998743777589996888876887765338899862


Q ss_pred             HHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHC-CCCEEEEEH
Q ss_conf             999876654156235207898987799999736-996388425
Q gi|254780438|r  182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAI-PYISEISVG  223 (261)
Q Consensus       182 i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~I-p~I~EvsIG  223 (261)
                      +.        ....+=-.=|||-+|+...+... |.--.||=|
T Consensus       149 ~~--------~~~p~~LAGGl~~~NV~~ai~~~~p~gvDvsSg  183 (203)
T cd00405         149 LA--------SRKPVILAGGLTPDNVAEAIRLVRPYGVDVSSG  183 (203)
T ss_pred             CC--------CCCCEEEECCCCHHHHHHHHHHCCCCEEEECCC
T ss_conf             12--------479879977889889999998509989997670


No 94 
>cd00945 Aldolase_Class_I Class I aldolases. The class I aldolases use an active-site lysine which stablilzes a reaction intermediates via Schiff base formation, and have TIM beta/alpha barrel fold. The members of this family include 2-keto-3-deoxy-6-phosphogluconate (KDPG) and 2-keto-4-hydroxyglutarate (KHG) aldolases, transaldolase, dihydrodipicolinate synthase sub-family, Type I 3-dehydroquinate dehydratase, DeoC and DhnA proteins, and metal-independent fructose-1,6-bisphosphate aldolase. Although structurally similar, the class II aldolases use a different mechanism and are believed to have an independent evolutionary origin.
Probab=74.79  E-value=8.1  Score=20.21  Aligned_cols=129  Identities=16%  Similarity=0.214  Sum_probs=79.6

Q ss_pred             CCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEE-ECCC-----HHH---HHHHHHHCC
Q ss_conf             6899899999999749989998247883348889999988740001367415888-3485-----689---999985072
Q gi|254780438|r   22 PWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIE-GYPN-----ETF---LNLCERYKP   92 (261)
Q Consensus        22 ~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiE-g~p~-----~e~---i~ia~~ikP   92 (261)
                      ..-++......+.++|.+++.+.|         ..+...++.+...  ++.+-.- +.|+     +.-   .+.+.+.--
T Consensus        11 t~~~i~~~~~~a~~~~~~av~v~p---------~~v~~~~~~l~~~--~~~v~~vv~fp~g~~~~~~k~~e~~~ai~~GA   79 (201)
T cd00945          11 TLEDIAKLCDEAIEYGFAAVCVNP---------GYVRLAADALAGS--DVPVIVVVGFPTGLTTTEVKVAEVEEAIDLGA   79 (201)
T ss_pred             CHHHHHHHHHHHHHHCCCEEEECH---------HHHHHHHHHCCCC--CCCEEEEECCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             999999999999862982999889---------9999999980899--98389995889999977799999999999099


Q ss_pred             CEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCC------CCCHHHHHHHHCCCCEEEECCCCCH
Q ss_conf             1289710165553335782213337889999986202696389972544------4414799997406614651121110
Q gi|254780438|r   93 EQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGN------GNEHSLQAAKLTGADCIELYTGPYG  166 (261)
Q Consensus        93 ~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd------~~q~~i~~a~~~Gad~VElhTG~Ya  166 (261)
                      +-+-+|+.-....  +|-|+.  ..+.++.+++.. +.|+.+-+-+++.      .-....+.+.+.|+|.|-..||...
T Consensus        80 deid~v~~~~~~~--~~~~~~--~~~ei~~v~~~~-~~g~~~kvi~e~~~l~~~~~i~~a~~~~~~~GadfvKtstG~~~  154 (201)
T cd00945          80 DEIDVVINIGSLK--EGDWEE--VLEEIAAVVEAA-DGGLPLKVILETRGLKTADEIAKAARIAAEAGADFIKTSTGFGG  154 (201)
T ss_pred             CEEEEECCHHHHH--CCCHHH--HHHHHHHHHHHH-CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCC
T ss_conf             9899740567775--668899--999999999973-57983799961677899999999999999809987985588788


No 95 
>KOG2335 consensus
Probab=74.57  E-value=1.8  Score=24.69  Aligned_cols=21  Identities=24%  Similarity=0.161  Sum_probs=10.7

Q ss_pred             HHHHHH-CCCCEEEECCCCCHH
Q ss_conf             999974-066146511211102
Q gi|254780438|r  147 LQAAKL-TGADCIELYTGPYGA  167 (261)
Q Consensus       147 i~~a~~-~Gad~VElhTG~Ya~  167 (261)
                      ++.+.+ +|+|.|=.=-|-|.+
T Consensus       218 ~~~~~~~tG~dGVM~arglL~N  239 (358)
T KOG2335         218 VERCLKYTGADGVMSARGLLYN  239 (358)
T ss_pred             HHHHHHHHCCCEEEECCHHHCC
T ss_conf             9999997587468860000038


No 96 
>COG1809 (2R)-phospho-3-sulfolactate synthase (PSL synthase, CoM    biosynthesis) [Coenzyme transport and metabolism]
Probab=74.13  E-value=8.4  Score=20.10  Aligned_cols=82  Identities=16%  Similarity=0.235  Sum_probs=62.9

Q ss_pred             EECCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHH--HHHHHHHHHHHHHCCCCCEEE----EEECC---CCCCHH
Q ss_conf             834856899999850721289710165553335782213--337889999986202696389----97254---444147
Q gi|254780438|r   76 EGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFL--QNQALLTKTVARLHNLGSRIS----LFADG---NGNEHS  146 (261)
Q Consensus        76 Eg~p~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~--~~~~~L~~~i~~l~~~girvS----LFIDp---d~~q~~  146 (261)
                      ---..++|++=++++.-++|+.|-         -||-..  -..+.++..+..++++++.|+    ||.=.   +.-..-
T Consensus        25 dkg~~p~f~~D~~~vagdyVDfvK---------fgwGT~~Li~kd~V~ekid~y~e~~i~v~pGGtlfe~a~~~~kvdey   95 (258)
T COG1809          25 DKGLGPRFVEDVLKVAGDYVDFVK---------FGWGTSSLIDKDQVKEKIDMYKENDIYVFPGGTLFEIAYSQDKVDEY   95 (258)
T ss_pred             ECCCCHHHHHHHHHHHHHHEEEEE---------ECCCCCCCCCHHHHHHHHHHHHHCCCEECCCCEEEEEEHHCCCHHHH
T ss_conf             279985899999986451431145---------43654446628999999999997593565796488730302418999


Q ss_pred             HHHHHHCCCCEEEECCCCCH
Q ss_conf             99997406614651121110
Q gi|254780438|r  147 LQAAKLTGADCIELYTGPYG  166 (261)
Q Consensus       147 i~~a~~~Gad~VElhTG~Ya  166 (261)
                      +..|+++|.+.|||-+|..-
T Consensus        96 l~e~~~lGfe~iEIS~G~i~  115 (258)
T COG1809          96 LNEAKELGFEAIEISNGTIP  115 (258)
T ss_pred             HHHHHHCCCCEEEECCCEEE
T ss_conf             99998719507996288042


No 97 
>cd00860 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain. ThrRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only.
Probab=73.64  E-value=8.7  Score=20.02  Aligned_cols=55  Identities=16%  Similarity=0.270  Sum_probs=40.7

Q ss_pred             CCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEE
Q ss_conf             2128971016555333578221333788999998620269638997254444147999974066146
Q gi|254780438|r   92 PEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCI  158 (261)
Q Consensus        92 P~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~V  158 (261)
                      |.||.++|-.            ....++-.++.+.|+++|+||.+=...+.-.+.+..|...|+..+
T Consensus         1 P~QV~Iipi~------------~~~~~ya~~i~~~Lr~~girv~~D~~~~~lg~ki~~a~~~~ip~~   55 (91)
T cd00860           1 PVQVVVIPVT------------DEHLDYAKEVAKKLSDAGIRVEVDLRNEKLGKKIREAQLQKIPYI   55 (91)
T ss_pred             CEEEEEEEEC------------HHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHCCCEE
T ss_conf             9289999888------------879999999999999889989996588987599999998199989


No 98 
>COG2044 Predicted peroxiredoxins [General function prediction only]
Probab=72.50  E-value=9.1  Score=19.89  Aligned_cols=59  Identities=24%  Similarity=0.278  Sum_probs=43.0

Q ss_pred             HCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHH
Q ss_conf             2078868998999999997499899982478833488899999887400013674158883485689999985
Q gi|254780438|r   17 NRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCER   89 (261)
Q Consensus        17 naRg~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~   89 (261)
                      .-|..++|.+.++.+.|+++|+.--..-+--+-|+|+.+|+.+              ++|.....+|+.++.+
T Consensus        55 kik~~~~~~l~~~~~~a~e~GVk~yvCe~s~~~~~~~ed~l~e--------------gvkI~G~~tF~~l~~e  113 (120)
T COG2044          55 KIKHPNFPPLEELIKQAIEAGVKIYVCEQSLKLRGIKEDDLVE--------------GVKIVGAATFLLLASE  113 (120)
T ss_pred             HHCCCCCCCHHHHHHHHHHCCCEEEEECCHHHHCCCCHHHHHH--------------CCEECCHHHHHHHHHC
T ss_conf             3227899998999999998399899972046644765012220--------------4575269999999757


No 99 
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated
Probab=72.36  E-value=9.3  Score=19.82  Aligned_cols=176  Identities=15%  Similarity=0.194  Sum_probs=98.5

Q ss_pred             CCCCHHHHHHHH---HHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH---HHHHHHHHHCCCEE
Q ss_conf             689989999999---974998999824788334888999998874000136741588834856---89999985072128
Q gi|254780438|r   22 PWPNLVHIGKIA---LQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE---TFLNLCERYKPEQI   95 (261)
Q Consensus        22 ~~P~~~~~a~~~---~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~---e~i~ia~~ikP~qv   95 (261)
                      +..++-++..++   ...|+|=|-+--    --|..+-+..++.+ +..||+.+.=--+-.-+   --.+++.+---+.|
T Consensus        11 D~~~l~~A~~ia~e~v~~~~diiE~GT----PLIk~eG~~aV~~l-r~~fP~~~ivAD~KtmDaG~~Ea~~A~~AGADiv   85 (429)
T PRK07028         11 DLLELDRAIEIAKEAVAGGADWIEAGT----PLIKSEGMNAIRTL-RKNFPDLTIVADMKTMDTGAMEVEMAAKAGADVV   85 (429)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEECC----HHHHHHHHHHHHHH-HHHCCCCEEEEEEEECCCCHHHHHHHHHCCCCEE
T ss_conf             248889999999987415875999176----88886418999999-9878998698876404550889999987699889


Q ss_pred             EEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEE--EEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHH
Q ss_conf             9710165553335782213337889999986202696389--97254444147999974066146511211102444356
Q gi|254780438|r   96 TLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRIS--LFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ  173 (261)
Q Consensus        96 tLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvS--LFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~  173 (261)
                      |..-              ..+...++..++.-++.|+++-  |.-=|||.+ -.+-..++|+|.|++|||-=..+.... 
T Consensus        86 tVlG--------------~a~d~TI~~aV~aA~k~G~~v~vDlI~v~d~~~-ra~el~~lGvd~I~vH~G~D~Q~~g~~-  149 (429)
T PRK07028         86 CILG--------------VADDSTIADAVRAARKYGVLVMADLINVPDPVK-RAVELEELGVDIINVHVGIDQQMLGKD-  149 (429)
T ss_pred             EEEC--------------CCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHH-HHHHHHHCCCCEEEEEEEECHHHCCCC-
T ss_conf             9945--------------788369999999999709889998558998899-999999709988999762335531798-


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHH
Q ss_conf             433666889998766541562352078989877999997369963884259999
Q gi|254780438|r  174 QERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFA  227 (261)
Q Consensus       174 ~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiI  227 (261)
                          -++-++   +.+.+.+..|-+--|+|-+|.+..++.  +-+=+-.|-+|.
T Consensus       150 ----p~~~l~---~v~~~~~~~vAVAGGi~~~t~~~~v~~--GAdIvIVGgaI~  194 (429)
T PRK07028        150 ----PLELLK---KVSEEVSIPIAAAGGLDAETAVKAVEA--GADIVIVGGNIY  194 (429)
T ss_pred             ----HHHHHH---HHHHHCCCEEEEECCCCHHHHHHHHHC--CCCEEEECCCCC
T ss_conf             ----499999---999755971899668787769999975--998999894005


No 100
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed
Probab=72.35  E-value=4.1  Score=22.23  Aligned_cols=150  Identities=11%  Similarity=0.093  Sum_probs=67.3

Q ss_pred             EEEEEECCCHHHHHHHHHHC---CCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CCEEEEEECCCCCC--H
Q ss_conf             15888348568999998507---212897101655533357822133378899999862026-96389972544441--4
Q gi|254780438|r   72 ELNIEGYPNETFLNLCERYK---PEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNL-GSRISLFADGNGNE--H  145 (261)
Q Consensus        72 elNiEg~p~~e~i~ia~~ik---P~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~-girvSLFIDpd~~q--~  145 (261)
                      =.++-|.-.+++.+++..+.   .+.+.|==   .-.-++.|..-......+.++++..++. .+.|..=+-|+.+.  .
T Consensus       105 IaSi~g~s~ee~~~~a~~~e~~gadaiElNi---s~~~~~~~~~~~~~~~~~~~iv~~V~~~~~~Pv~vKLsPn~tdi~~  181 (333)
T PRK07565        105 IASLNGSSAGGWVDYARQIEEAGADALELNI---YYLPTDPDISGAEVEQRYLDILRAVKSAVSIPVAVKLSPYFSNLAN  181 (333)
T ss_pred             EEECCCCCHHHHHHHHHHHHHCCCCEEEEEC---CCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHH
T ss_conf             9874779989999999999764998899976---6779886544465078899999999864688568735998210999


Q ss_pred             HHHHHHHCCCCEEEE-----------CCCCCHHH--HHHHHHHHHHHHHHHHHHHHHHHCCCEEEE-CCCCCHHHHHHHH
Q ss_conf             799997406614651-----------12111024--443564336668899987665415623520-7898987799999
Q gi|254780438|r  146 SLQAAKLTGADCIEL-----------YTGPYGAC--YNNPQQERIFLNKLAITAQLAQKMDLQINA-GHDLTIQNIPNLI  211 (261)
Q Consensus       146 ~i~~a~~~Gad~VEl-----------hTG~Ya~a--~~~~~~~~~el~~i~~aa~~A~~lgL~VnA-GHgLn~~Nl~~~i  211 (261)
                      ..+++.+-|||.|=+           -|..+.-.  +..+......+   +..++.....++-+=+ |==-+.+-.-.++
T Consensus       182 iA~aa~~~Gadgv~~iNT~~~~~Id~e~~~~~~~~~lSgp~~~~~al---r~v~~v~~~~~ipIiG~GGI~sg~DaiE~i  258 (333)
T PRK07565        182 MAKRLDAAGADGLVLFNRFYQPDIDLETLEVVPGLVLSTPAELRLPL---RWIAILSGRVGADLAATTGVHDAEDVIKML  258 (333)
T ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCCCCCEEECCCCCCCCCCCCHHH---HHHHHHHCCCCCCEEEECCCCCHHHHHHHH
T ss_conf             99999974998899843666563315544373686667743120788---999999604698988888959899999999


Q ss_pred             HHCCCCEEEEEHHHHHHH
Q ss_conf             736996388425999999
Q gi|254780438|r  212 NAIPYISEISVGHAFAAT  229 (261)
Q Consensus       212 ~~Ip~I~EvsIGHaiIse  229 (261)
                      -  -+-.-|-||-+++-+
T Consensus       259 l--AGAsaVQv~Ta~~~~  274 (333)
T PRK07565        259 L--AGADVVMIASALLRH  274 (333)
T ss_pred             H--CCCCHHEEEHHHHHH
T ss_conf             8--098863362236653


No 101
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins.  DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences and cellular location. Members of class 1 are cytosolic enzymes and multimers while class 2 enzymes are membrane associated and monomeric. The class 1 enzymes can be further divided into subtypes 1A and 1B which are homodimers and heterotetrameric proteins, respectively.  This subgroup has the conserved FMN binding site, but lacks some catalytic residues and may therefore be inactive.
Probab=72.25  E-value=4.2  Score=22.22  Aligned_cols=151  Identities=11%  Similarity=0.080  Sum_probs=65.5

Q ss_pred             CEEEEEECCCHHHHHHHHHHCC---CEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CCEEEEEECCCCCC--
Q ss_conf             4158883485689999985072---12897101655533357822133378899999862026-96389972544441--
Q gi|254780438|r   71 AELNIEGYPNETFLNLCERYKP---EQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNL-GSRISLFADGNGNE--  144 (261)
Q Consensus        71 ~elNiEg~p~~e~i~ia~~ikP---~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~-girvSLFIDpd~~q--  144 (261)
                      +=.++-|.-.+++.+++..+..   +.+.|==--++   ++.+.........+.++++..++. .+.|..=+-|+.+.  
T Consensus       102 vI~Si~g~s~ee~~~~a~~~~~~gad~lElNls~~~---~~~~~~~~~~~~~~~~iv~~Vk~~~~~Pv~vKLsP~~~di~  178 (325)
T cd04739         102 VIASLNGVSAGGWVDYARQIEEAGADALELNIYALP---TDPDISGAEVEQRYLDILRAVKSAVTIPVAVKLSPFFSALA  178 (325)
T ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCC---CCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHH
T ss_conf             598716899899999999997649987999656678---88554421068899999999986078866995399830099


Q ss_pred             HHHHHHHHCCCCEEEE-CC----------CCCHHH--HHHHHHHHHHHHHHHHHHHHHHHCCCEEEE-CCCCCHHHHHHH
Q ss_conf             4799997406614651-12----------111024--443564336668899987665415623520-789898779999
Q gi|254780438|r  145 HSLQAAKLTGADCIEL-YT----------GPYGAC--YNNPQQERIFLNKLAITAQLAQKMDLQINA-GHDLTIQNIPNL  210 (261)
Q Consensus       145 ~~i~~a~~~Gad~VEl-hT----------G~Ya~a--~~~~~~~~~el~~i~~aa~~A~~lgL~VnA-GHgLn~~Nl~~~  210 (261)
                      ...+++.+-|||.|=+ .|          +..--.  +..+......   ++..+..+...++-+=+ |==-+.+-.-.+
T Consensus       179 ~ia~aa~~~GAdgi~liNT~~~~~id~~~~~~~~~~~lSg~~~~~~a---lr~v~~~~~~~~ipIiG~GGI~s~~Da~e~  255 (325)
T cd04739         179 HMAKQLDAAGADGLVLFNRFYQPDIDLETLEVVPNLLLSSPAEIRLP---LRWIAILSGRVKASLAASGGVHDAEDVVKY  255 (325)
T ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCCCCCEEECCCCCCCCCCCHHH---HHHHHHHHCCCCCCEEEECCCCCHHHHHHH
T ss_conf             99999997599889973576656421676415368774575300688---999999964689898888895989999999


Q ss_pred             HHHCCCCEEEEEHHHHHHH
Q ss_conf             9736996388425999999
Q gi|254780438|r  211 INAIPYISEISVGHAFAAT  229 (261)
Q Consensus       211 i~~Ip~I~EvsIGHaiIse  229 (261)
                      +-  -+-.-|-||-+++-+
T Consensus       256 il--AGAsaVQv~TA~~~~  272 (325)
T cd04739         256 LL--AGADVVMTTSALLRH  272 (325)
T ss_pred             HH--CCCCHHHEEHHHHHH
T ss_conf             98--098876143234641


No 102
>PRK13118 consensus
Probab=71.98  E-value=9.4  Score=19.76  Aligned_cols=208  Identities=17%  Similarity=0.183  Sum_probs=122.0

Q ss_pred             CCCCHHHHH---HHHHHCCCCEEEE-----ECCCCCCCCCH------------HHHHHHHHHHCCCCCCCEEEEEECCCH
Q ss_conf             689989999---9999749989998-----24788334888------------999998874000136741588834856
Q gi|254780438|r   22 PWPNLVHIG---KIALQSGASGLTV-----HPRPDQRHIRY------------TDLPEIRRLIDEQFPKAELNIEGYPNE   81 (261)
Q Consensus        22 ~~P~~~~~a---~~~~~~GadgITv-----H~R~DrRHI~~------------~Dv~~l~~~~~~~~~~~elNiEg~p~~   81 (261)
                      .|||+-...   ....++|||-|-+     -|--|---||.            +++.++-+-+.+...++|+=+=+|-++
T Consensus        26 G~P~~e~t~~~~~~l~~~GaDiiElGiPfSDP~ADGPvIq~A~~rAL~~G~~~~~~~~~v~~~r~~~~~~PivlM~Y~N~  105 (269)
T PRK13118         26 GDPSPEASVPLLHGLVAAGADVIELGMPFSDPMADGPAIQLASERALAAGQGLADVLQMVREFRQGDQTTPVVLMGYLNP  105 (269)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCH
T ss_conf             18998999999999997699999978988886665799999999999679868899999999864389999899740007


Q ss_pred             -------HHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCC
Q ss_conf             -------8999998507212897101655533357822133378899999862026963899725444414799997406
Q gi|254780438|r   82 -------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTG  154 (261)
Q Consensus        82 -------e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~G  154 (261)
                             +|++-+.+.-= .-.|+||-|-              +.-.++.+.+++.|+....|+-|.....-++...+..
T Consensus       106 i~~~G~e~F~~~~~~~Gv-dGvIipDLP~--------------ee~~~~~~~~~~~gl~~I~lvaPtt~~~Ri~~i~~~a  170 (269)
T PRK13118        106 IEIYGYERFVAQAKEAGV-DGLILVDLPP--------------EEADELRAPAQAHGLDFIRLTSPTTSDERLPRVLEHA  170 (269)
T ss_pred             HHHHHHHHHHHHHHHCCC-CEEECCCCCH--------------HHHHHHHHHHHHCCCCHHEEECCCCCHHHHHHHHHCC
T ss_conf             878639999999998599-7464589997--------------8999999999975984640369898789999998437


Q ss_pred             CCEEEE--CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCC-CHHHHHHHHHHCCCCEEEEEHHHHHHHHH
Q ss_conf             614651--121110244435643366688999876654156235207898-98779999973699638842599999999
Q gi|254780438|r  155 ADCIEL--YTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDL-TIQNIPNLINAIPYISEISVGHAFAATAL  231 (261)
Q Consensus       155 ad~VEl--hTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgL-n~~Nl~~~i~~Ip~I~EvsIGHaiIseAl  231 (261)
                      -..|=.  .+|.....-.........++++++      .-.+-|-.|-|. +-+-+.. +++  .-+=|-||-+||-.=-
T Consensus       171 ~gFiY~vs~~GvTG~~~~~~~~~~~~i~~ik~------~t~~Pv~vGFGIs~~e~~~~-v~~--~aDGvIVGSa~Vk~i~  241 (269)
T PRK13118        171 SGYLYYVSLAGVTGAAALDTEHVEEAVARLRR------HTDLPVVVGFGIRDAESAAA-IAR--LADGVVVGSALVDAIA  241 (269)
T ss_pred             CCCEEEEECCCCCCCCCCCHHHHHHHHHHHHH------HCCCCEEEEECCCCHHHHHH-HHC--CCCEEEECHHHHHHHH
T ss_conf             88389985456678776671989999999996------25898178716799999999-980--0999998589999998


Q ss_pred             HHH----HHHHHHHHHHHHHHHHHHH
Q ss_conf             940----9999999999997410565
Q gi|254780438|r  232 ECG----VKEAVFCFRRACGQHLDNT  253 (261)
Q Consensus       232 ~~G----L~~aI~~~~~ii~~~~~~~  253 (261)
                      ..+    +-+.+.+|.+-+++..+++
T Consensus       242 ~~~~~~~~~~~~~~~~k~lk~al~~~  267 (269)
T PRK13118        242 EAKDVDQAVERVLALLAELRQALDNA  267 (269)
T ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             56782679999999999999999855


No 103
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the cost of also yielding formaldehyde. These latter species tend usually have a formaldehyde-activating enzyme to attach formaldehyde to the C1 carrier tetrahydromethanopterin. In these species, the enzyme is viewed as a lyase rather than a synthase and is called D-arabino 3-hexulose 6-phosphate formaldehyde lyase. Note that there is some overlap in specificity with the Escherichia coli enzyme 3-keto-L-gulonate 6-phosphate decarboxylase.
Probab=71.90  E-value=9.5  Score=19.75  Aligned_cols=101  Identities=19%  Similarity=0.275  Sum_probs=53.4

Q ss_pred             HHHHHHHHHHHCCCCCEE--EEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             788999998620269638--997254444147999974066146511211102444356433666889998766541562
Q gi|254780438|r  117 QALLTKTVARLHNLGSRI--SLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDL  194 (261)
Q Consensus       117 ~~~L~~~i~~l~~~girv--SLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL  194 (261)
                      .+.++..++..++.|..+  .+.--+++. ...+.+.++|+|.|.+|+|.=+.+....  .   .+.+..........  
T Consensus        88 ~~ti~~a~~~a~~~~~~v~vdl~~~~~~~-~~a~~~~~~g~d~v~~h~g~d~~~~~~~--~---~~~~~~~~~~~~~~--  159 (206)
T TIGR03128        88 DATIKGAVKAAKKHGKEVQVDLINVKDKV-KRAKELKELGADYIGVHTGLDEQAKGQN--P---FEDLQTILKLVKEA--  159 (206)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCCCHH-HHHHHHHHCCCCEEEEECCCCHHHCCCC--C---HHHHHHHHHCCCCC--
T ss_conf             79999999999973997999974789889-9999999758988995025004432679--8---89999998625787--


Q ss_pred             EEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHH
Q ss_conf             352078989877999997369963884259999
Q gi|254780438|r  195 QINAGHDLTIQNIPNLINAIPYISEISVGHAFA  227 (261)
Q Consensus       195 ~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiI  227 (261)
                      ++-.+=|.+..+.+.+++ . +.+=+=+|-+|.
T Consensus       160 ~i~v~gGi~~~t~~~ai~-~-Gad~vVVGR~It  190 (206)
T TIGR03128       160 RVAVAGGINLDTIPDVIK-L-GPDIVIVGGAIT  190 (206)
T ss_pred             CEEECCCCCCCCHHHHHH-C-CCCEEEECCCCC
T ss_conf             363679868356999986-6-999999896124


No 104
>PRK09989 hypothetical protein; Provisional
Probab=71.33  E-value=9.7  Score=19.67  Aligned_cols=50  Identities=14%  Similarity=0.131  Sum_probs=35.5

Q ss_pred             CCCCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHC
Q ss_conf             8453322144322322078868998999999997499899982478833488899999887400
Q gi|254780438|r    2 STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLID   65 (261)
Q Consensus         2 ~t~LsVNidhiAtLRnaRg~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~   65 (261)
                      |.|+|.|+.-.=|       .+| +.+.-..|-++|-+++-++-.-|      .+..+|++.+.
T Consensus         1 M~rfaaNl~~lf~-------e~p-~~dR~~aAa~aGF~aVE~~~Pyd------~~~~~i~~~l~   50 (258)
T PRK09989          1 MPRFAANLSMMFT-------EVP-FIERFAAARKAGFDAVEFLFPYD------YSASQIQAQLS   50 (258)
T ss_pred             CCCEEEEHHHHHC-------CCC-HHHHHHHHHHCCCCEEEECCCCC------CCHHHHHHHHH
T ss_conf             9726654645324-------799-99999999980999999757666------99999999999


No 105
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional
Probab=71.17  E-value=9.8  Score=19.64  Aligned_cols=159  Identities=13%  Similarity=0.141  Sum_probs=96.9

Q ss_pred             HHHHHHHHCCCEEEEEECC-------CCCCCCCCCCCH-----HHHHHHHHHHHHHHCCCCCEEEEEEC--CCCCCHHHH
Q ss_conf             9999985072128971016-------555333578221-----33378899999862026963899725--444414799
Q gi|254780438|r   83 FLNLCERYKPEQITLVPDD-------PHQLTSDHGWDF-----LQNQALLTKTVARLHNLGSRISLFAD--GNGNEHSLQ  148 (261)
Q Consensus        83 ~i~ia~~ikP~qvtLVPe~-------r~elTTegGldv-----~~~~~~L~~~i~~l~~~girvSLFID--pd~~q~~i~  148 (261)
                      -+.-..+..|+..-+.--|       --|+-.+.|=|+     ......+...++.-++.|+.+-+=+=  +||... .+
T Consensus       216 aV~~iRe~fPd~~IvADlKTmDaG~lEa~mAa~AGADivtVlG~A~~sTI~~aikeA~k~G~~v~vDlInV~dpv~r-a~  294 (392)
T PRK13307        216 VISKIREVRPDAFIVADLKTLDTGNLEARMAADATADAVVISGLAPISTIEKAIHEAQKTGIYSILDMLNVEDPVKL-LE  294 (392)
T ss_pred             HHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHH-HH
T ss_conf             99999987899889985420354268888888759988999567987899999999997097999983478888999-99


Q ss_pred             HHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHH
Q ss_conf             99740661465112111024443564336668899987665415623520789898779999973699638842599999
Q gi|254780438|r  149 AAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAA  228 (261)
Q Consensus       149 ~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIs  228 (261)
                      . .++|+|.|++|||-=...- .  ..-..+.+++...     .+..|-..-|+|.+++..+++.  +.+=+-.|-+|..
T Consensus       295 e-Lklg~DiI~lH~giD~Q~~-~--~~~~~l~~i~~~~-----~~~~VAVAGGI~~et~~~~~~~--gadIvIVG~aIT~  363 (392)
T PRK13307        295 S-LKVKPDVVELHRGIDEEGT-E--HAWGNIPEIKKAA-----GKILVAVAGGVRVEKVEEALKA--GADILVVGRAITK  363 (392)
T ss_pred             H-HCCCCCEEEEEECCCHHHC-C--CCHHHHHHHHHHC-----CCEEEEEECCCCHHHHHHHHHC--CCCEEEECCHHCC
T ss_conf             8-4446988999854126403-6--8745699999742-----6805999778888889999846--9989998912137


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999409999999999997410565540
Q gi|254780438|r  229 TALECGVKEAVFCFRRACGQHLDNTMRL  256 (261)
Q Consensus       229 eAl~~GL~~aI~~~~~ii~~~~~~~~~~  256 (261)
                      -+   --+.+.+++++.+++.--+.+|.
T Consensus       364 S~---Dp~~AAreil~~~~~~e~d~~r~  388 (392)
T PRK13307        364 SK---DVRRAAEQFLNKLNKPEIDQFRI  388 (392)
T ss_pred             CC---CHHHHHHHHHHHCCCCCCCCEEE
T ss_conf             89---98999999998737777411364


No 106
>cd01948 EAL EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2).  The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.
Probab=70.13  E-value=10  Score=19.49  Aligned_cols=160  Identities=18%  Similarity=0.201  Sum_probs=88.0

Q ss_pred             CCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHC------CCCCCCEEEEEECCC----HHHHHHHH----H
Q ss_conf             998999999997499899982478833488899999887400------013674158883485----68999998----5
Q gi|254780438|r   24 PNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLID------EQFPKAELNIEGYPN----ETFLNLCE----R   89 (261)
Q Consensus        24 P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~------~~~~~~elNiEg~p~----~e~i~ia~----~   89 (261)
                      -.|-.+...+...|..             ..=|.+.++..+.      .......+.|-..|.    ++|.+...    +
T Consensus        44 ~~~~~f~~~a~~~~l~-------------~~ld~~~~~~a~~~~~~~~~~~~~~~l~iNi~~~~l~~~~~~~~l~~~l~~  110 (240)
T cd01948          44 ISPAEFIPLAEETGLI-------------VELGRWVLEEACRQLARWQAGGPDLRLSVNLSARQLRDPDFLDRLLELLAE  110 (240)
T ss_pred             ECHHHHHHHHHHCCCH-------------HHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             9999999999985976-------------899999999999999998861998389999562415406799999999998


Q ss_pred             --HCCCEEEE-EECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEE--EECCCCCCHHHHHHHHCCCCEEEECCCC
Q ss_conf             --07212897-101655533357822133378899999862026963899--7254444147999974066146511211
Q gi|254780438|r   90 --YKPEQITL-VPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISL--FADGNGNEHSLQAAKLTGADCIELYTGP  164 (261)
Q Consensus        90 --ikP~qvtL-VPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSL--FIDpd~~q~~i~~a~~~Gad~VElhTG~  164 (261)
                        +.|.+++| ++|.-          ...+...+...++.+++.|++++|  |=.. .+  +++....+.+|.|-|.-.-
T Consensus       111 ~~~~~~~i~~Ei~E~~----------~~~~~~~~~~~i~~l~~~G~~iaiDdfG~~-~~--~~~~l~~l~~d~iKld~~~  177 (240)
T cd01948         111 TGLPPRRLVLEITESA----------LIDDLEEALATLRRLRALGVRIALDDFGTG-YS--SLSYLKRLPVDYLKIDRSF  177 (240)
T ss_pred             HCCCHHHEEEEECCHH----------HHHCHHHHHHHHHHHHHCCCCEEEECCCCC-CC--CHHHHHHCCCHHHHCCHHH
T ss_conf             0969789687703367----------652699999999999864996886168998-76--6899986780154408999


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHC
Q ss_conf             10244435643366688999876654156235207898987799999736
Q gi|254780438|r  165 YGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAI  214 (261)
Q Consensus       165 Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~I  214 (261)
                      ..+. .+.....   .-++.....|+.+|+.|=|-.==|..-+.. +..+
T Consensus       178 v~~~-~~~~~~~---~~l~~l~~~a~~~~i~viaegVE~~~~~~~-l~~l  222 (240)
T cd01948         178 VRDI-ETDPEDR---AIVRAIIALAHSLGLKVVAEGVETEEQLEL-LREL  222 (240)
T ss_pred             HHHC-CCCHHHH---HHHHHHHHHHHHCCCEEEEEECCHHHHHHH-HHHC
T ss_conf             9736-4682238---999999999998499899981850999999-9985


No 107
>PRK09545 znuA high-affinity zinc transporter periplasmic component; Reviewed
Probab=70.07  E-value=9.9  Score=19.62  Aligned_cols=11  Identities=18%  Similarity=0.495  Sum_probs=6.6

Q ss_pred             CCHHHHHHHHH
Q ss_conf             88899999887
Q gi|254780438|r   52 IRYTDLPEIRR   62 (261)
Q Consensus        52 I~~~Dv~~l~~   62 (261)
                      -+++|+..|++
T Consensus        61 p~Psd~~~l~~   71 (308)
T PRK09545         61 LRPSDVKRLQS   71 (308)
T ss_pred             CCHHHHHHHHC
T ss_conf             89999999860


No 108
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase; InterPro: IPR012768    Members of this family are the trehalose biosynthetic enzyme malto-oligosyltrehalose trehalohydrolase, formally known as 4-alpha-D-{(1->4)-alpha-D-glucano}trehalose trehalohydrolase (3.2.1.141 from EC). It is the TreZ protein of the TreYZ pathway for trehalose biosynthesis, and alternative to the OtsAB system.; GO: 0004553 hydrolase activity hydrolyzing O-glycosyl compounds, 0005992 trehalose biosynthetic process.
Probab=69.70  E-value=5.8  Score=21.22  Aligned_cols=43  Identities=30%  Similarity=0.454  Sum_probs=32.1

Q ss_pred             HHHHHHCCCCEEEE-------------CCCCC--H--HHHHHHHHHHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             99997406614651-------------12111--0--244435643366688999876654156235
Q gi|254780438|r  147 LQAAKLTGADCIEL-------------YTGPY--G--ACYNNPQQERIFLNKLAITAQLAQKMDLQI  196 (261)
Q Consensus       147 i~~a~~~Gad~VEl-------------hTG~Y--a--~a~~~~~~~~~el~~i~~aa~~A~~lgL~V  196 (261)
                      |++.+++|++.|||             |=|-+  |  ++|..|.    +|+++   ...||.+||.|
T Consensus       127 LpyL~~LGiTaiELMPva~FpG~RgWGYDGVl~yAp~~~YG~Pd----~Lk~l---vDaAH~~GL~V  186 (564)
T TIGR02402       127 LPYLADLGITAIELMPVAQFPGTRGWGYDGVLPYAPHEAYGGPD----DLKAL---VDAAHGLGLGV  186 (564)
T ss_pred             HHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCH----HHHHH---HHHHHHCCCEE
T ss_conf             16877507888887344677326668235544456217787818----99999---99998568838


No 109
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. Members of this protein family are 4-hydroxy-2-oxovalerate aldolase, also called 4-hydroxy-2-ketovalerate aldolase and 2-oxo-4-hydroxypentanoate aldolase. This enzyme, part of the pathway for the meta-cleavage of catechol, produces pyruvate and acetaldehyde. Acetaldehyde is then converted by acetaldehyde dehydrogenase (acylating) (DmpF; EC 1.2.1.10) to acetyl-CoA. The two enzymes are tightly associated.
Probab=69.69  E-value=11  Score=19.43  Aligned_cols=122  Identities=13%  Similarity=0.144  Sum_probs=54.9

Q ss_pred             CHHHHHHHHHHCCCCEEEE-ECC---------CCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCE
Q ss_conf             9899999999749989998-247---------883348889999988740001367415888348568999998507212
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTV-HPR---------PDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQ   94 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITv-H~R---------~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~q   94 (261)
                      +.+..+....++|.+-|-| |..         .=-++-..+.+..+++.++.. .-.-+-+-+..+.+-++.+.+...+.
T Consensus        25 ~k~~ia~~Ld~aGVd~IEvg~g~g~~~ss~~~g~~~~~d~e~i~~~~~~~~~a-k~~~l~~pg~~~~~dl~~a~~~gv~~  103 (333)
T TIGR03217        25 QVRAIAAALDEAGVDAIEVTHGDGLGGSSFNYGFSAHTDLEYIEAAADVVKRA-KVAVLLLPGIGTVHDLKAAYDAGART  103 (333)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCC-CEEEEECCCCCCHHHHHHHHHCCCCE
T ss_conf             99999999997198989960688888874335788899499999999874248-05699647866699999999669997


Q ss_pred             EEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEE------CCCCCCHHHHHHHHCCCCEEEE
Q ss_conf             89710165553335782213337889999986202696389972------5444414799997406614651
Q gi|254780438|r   95 ITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFA------DGNGNEHSLQAAKLTGADCIEL  160 (261)
Q Consensus        95 vtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFI------Dpd~~q~~i~~a~~~Gad~VEl  160 (261)
                      +-+.-.-             ...+.....++..++.|..|+.|+      +|+.-....+.+.+.|+|+|=|
T Consensus       104 vri~~~~-------------te~d~~~~~i~~ak~~G~~v~~~~~~s~~~~~e~l~~~a~~~~~~Gad~I~i  162 (333)
T TIGR03217       104 VRVATHC-------------TEADVSEQHIGMARELGMDTVGFLMMSHMTPPEKLAEQAKLMESYGADCVYI  162 (333)
T ss_pred             EEEEECC-------------CHHHHHHHHHHHHHHCCCEEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             8986316-------------6788899999999976980999975056899999999999998569999997


No 110
>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism]
Probab=69.68  E-value=8.8  Score=19.98  Aligned_cols=52  Identities=17%  Similarity=0.008  Sum_probs=21.5

Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCC--HHHHHHHHCCCCEEEE
Q ss_conf             5782213337889999986202696389972544441--4799997406614651
Q gi|254780438|r  108 DHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNE--HSLQAAKLTGADCIEL  160 (261)
Q Consensus       108 egGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q--~~i~~a~~~Gad~VEl  160 (261)
                      -|+..-....+.++.+.+.+.+ .+.+|+----|.-.  -.--+|.+-||++||=
T Consensus       169 vG~~~P~~~~~~i~~l~~~v~~-~~~i~~H~HND~G~AvANslaAv~aGa~~v~~  222 (409)
T COG0119         169 VGVATPNEVADIIEALKANVPN-KVILSVHCHNDLGMAVANSLAAVEAGADQVEG  222 (409)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCC-CCEEEEEECCCCCHHHHHHHHHHHCCCCEEEE
T ss_conf             6865879999999999983788-87388983698565999999999848838999


No 111
>PRK00115 hemE uroporphyrinogen decarboxylase; Validated
Probab=68.76  E-value=11  Score=19.30  Aligned_cols=92  Identities=22%  Similarity=0.283  Sum_probs=53.3

Q ss_pred             HHHHHHHHHCCC--CCEEEEEECCCCCCHHHHHHHHCCCCEEEEC-CCCCHHHHH-------------------HHHHHH
Q ss_conf             899999862026--9638997254444147999974066146511-211102444-------------------356433
Q gi|254780438|r  119 LLTKTVARLHNL--GSRISLFADGNGNEHSLQAAKLTGADCIELY-TGPYGACYN-------------------NPQQER  176 (261)
Q Consensus       119 ~L~~~i~~l~~~--girvSLFIDpd~~q~~i~~a~~~Gad~VElh-TG~Ya~a~~-------------------~~~~~~  176 (261)
                      .++.+++.+++.  ++.+-.|.-- .. ..++...++|+|+|-+- +-+-..+..                   .++...
T Consensus       226 ~~~~I~~~ik~~~~~~piI~f~kg-~~-~~l~~~~~~~~d~is~D~~~~l~~a~~~~~~~~~lQGNlDP~~L~~~~e~i~  303 (347)
T PRK00115        226 YMKRIVAELKREGPDVPVILFPKG-AG-ELLEAMAETGVDAVGLDWTVDLAEARRRVGDKVALQGNLDPAVLLAPPEAIE  303 (347)
T ss_pred             HHHHHHHHHHHHCCCCCEEEECCC-CH-HHHHHHHHCCCCEEEECCCCCHHHHHHHCCCCEEEEECCCHHHHCCCHHHHH
T ss_conf             999999999983899987996389-60-5689998569988962787899999998499817982798688759999999


Q ss_pred             HHHHHHHHHHHHHHHCCCEEEECCCCC----HHHHHHHHHHCC
Q ss_conf             666889998766541562352078989----877999997369
Q gi|254780438|r  177 IFLNKLAITAQLAQKMDLQINAGHDLT----IQNIPNLINAIP  215 (261)
Q Consensus       177 ~el~~i~~aa~~A~~lgL~VnAGHgLn----~~Nl~~~i~~Ip  215 (261)
                      .+..++   .+.....|--+|-|||+.    .+|+..|+..+.
T Consensus       304 ~~~~~i---l~~~~~~g~IfnLGHGI~P~tp~enV~~~V~~vr  343 (347)
T PRK00115        304 EEVRAI---LDAFGGPGHIFNLGHGILPETPPENVKALVEAVH  343 (347)
T ss_pred             HHHHHH---HHHCCCCCEEEECCCCCCCCCCHHHHHHHHHHHH
T ss_conf             999999---9974899979968998498989999999999999


No 112
>PRK12655 fructose-6-phosphate aldolase; Reviewed
Probab=68.32  E-value=11  Score=19.24  Aligned_cols=197  Identities=16%  Similarity=0.169  Sum_probs=127.3

Q ss_pred             CCCHHHHHHHHHHCCCCEEEEEC----CCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECC--CHHHHHHHHH---HCCC
Q ss_conf             89989999999974998999824----7883348889999988740001367415888348--5689999985---0721
Q gi|254780438|r   23 WPNLVHIGKIALQSGASGLTVHP----RPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYP--NETFLNLCER---YKPE   93 (261)
Q Consensus        23 ~P~~~~~a~~~~~~GadgITvH~----R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p--~~e~i~ia~~---ikP~   93 (261)
                      --|+-+..+.....-.+|+|--|    |+.+.  ..+-+..+++.+.   +..++-+|--.  .++|++-+.+   ..|+
T Consensus         7 tAd~~ei~~~~~~g~i~GvTTNPsll~k~g~~--~~~~~~~i~~~~~---~~~~l~~ev~~~d~~~m~~~a~~l~~~~~~   81 (220)
T PRK12655          7 TANVAEVERLARILPIAGVTTNPSIIAASKES--IWEVLPRLQKAIG---GEGILFAQTMSRDAQGMVEEAKRLRNAIPG   81 (220)
T ss_pred             CCCHHHHHHHHCCCCCCEECCCHHHHHHCCCC--HHHHHHHHHHHHC---CCCCEEEEEECCCHHHHHHHHHHHHHHCCC
T ss_conf             48999999997079947582899999865998--7999999999828---999789999559999999999999974787


Q ss_pred             EEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHH
Q ss_conf             28971016555333578221333788999998620269638997254444147999974066146511211102444356
Q gi|254780438|r   94 QITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ  173 (261)
Q Consensus        94 qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~  173 (261)
                      .+-=||-     |.+|          + +.++.|++.|++|.+=.==++.|  .-.|...||+.|-.|.|.-.+.-.++-
T Consensus        82 ivVKIP~-----t~~G----------l-~ai~~L~~~gi~vn~Tavys~~Q--a~~Aa~aGA~YvsPyvGR~~d~G~Dg~  143 (220)
T PRK12655         82 IVVKIPV-----TAEG----------L-AAIKKLKKEGIPTLGTAVYSAAQ--GLLAALAGAKYVAPYVNRVDAQGGDGI  143 (220)
T ss_pred             EEEECCC-----CHHH----------H-HHHHHHHHCCCCEEEEECCCHHH--HHHHHHCCCCEEEEEHHHHHHCCCCHH
T ss_conf             3998688-----7789----------9-99999998699789985178999--999998599789632105755589848


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHH-HHHHHHHHHHH
Q ss_conf             4336668899987665415623520789898779999973699638842599999999940999-99999999974
Q gi|254780438|r  174 QERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKE-AVFCFRRACGQ  248 (261)
Q Consensus       174 ~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~-aI~~~~~ii~~  248 (261)
                      .   .+..+++..+ .+...-+|-|.-==|.+++.... . -+.+-+-|...+..+.+.+-+.. ++++|.+--+.
T Consensus       144 ~---~i~~i~~~~~-~~~~~tkILaASiR~~~~v~~a~-~-~Gad~vTipp~v~~~l~~~plT~~~~~~F~~Dw~~  213 (220)
T PRK12655        144 R---MVQELQTLLE-MHAPESMVLAASFKTPRQALDCL-L-AGCQSITLPLDVAQQMLNTPAVESAIEKFEQDWQA  213 (220)
T ss_pred             H---HHHHHHHHHH-HCCCCCEEEEEECCCHHHHHHHH-H-CCCCEEEECHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             9---9999999999-75999689998389999999999-8-69999981999999997690289999999999999


No 113
>PRK13121 consensus
Probab=68.20  E-value=11  Score=19.23  Aligned_cols=206  Identities=14%  Similarity=0.164  Sum_probs=122.2

Q ss_pred             CCCCCHHHHHH---HHHHCCCCEEEEE-----CCCCCCCCCHH------------HHHHHHHHHCCCCCCCEEEEEECCC
Q ss_conf             86899899999---9997499899982-----47883348889------------9999887400013674158883485
Q gi|254780438|r   21 LPWPNLVHIGK---IALQSGASGLTVH-----PRPDQRHIRYT------------DLPEIRRLIDEQFPKAELNIEGYPN   80 (261)
Q Consensus        21 ~~~P~~~~~a~---~~~~~GadgITvH-----~R~DrRHI~~~------------Dv~~l~~~~~~~~~~~elNiEg~p~   80 (261)
                      ..|||+-...+   ...++|||-|-+-     |--|---||..            ++.++-+-+.....++|+=+=+|-+
T Consensus        25 aG~P~~~~s~~~~~~l~~~GaDiiElGiPfSDP~ADGPvIq~A~~rAL~~G~~~~~~~~~~~~~r~~~~~~PivlM~Y~N  104 (265)
T PRK13121         25 AGDPDPAKTVELMHALVEGGADVIELGVPFSDPMADGPVIQRASERALAHGVSLRQVLAMVKEFRETNQTTPVVLMGYAN  104 (265)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCEEEEEHHH
T ss_conf             71899899999999999769999997898899776589999999999977998467799999831037999989862145


Q ss_pred             H-------HHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHC
Q ss_conf             6-------899999850721289710165553335782213337889999986202696389972544441479999740
Q gi|254780438|r   81 E-------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLT  153 (261)
Q Consensus        81 ~-------e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~  153 (261)
                      +       +|.+-+.+.-=+-+ ||||-|-|              .-.++.+.+++.|+..-.|+-|...+.-++...+.
T Consensus       105 ~i~~yG~e~F~~~~~~aGvdGl-IipDLP~e--------------E~~~~~~~~~~~gl~~I~lvaPtt~~~Ri~~i~~~  169 (265)
T PRK13121        105 PIERMGYDAFAAAARAAGVDGV-LVVDYPPE--------------ECEEFAAKMRAAGIDPIFLLAPTSTDERIAAVARV  169 (265)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEE-ECCCCCHH--------------HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             9999719999999987298734-34899989--------------99999999986599668995899989999999962


Q ss_pred             CCCEEEE--CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCH-HHHHHHHHHCCCCEEEEEHHHHHHHH
Q ss_conf             6614651--12111024443564336668899987665415623520789898-77999997369963884259999999
Q gi|254780438|r  154 GADCIEL--YTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTI-QNIPNLINAIPYISEISVGHAFAATA  230 (261)
Q Consensus       154 Gad~VEl--hTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~-~Nl~~~i~~Ip~I~EvsIGHaiIseA  230 (261)
                      .-..|=.  .+|.=...-.........+++++..      -.+-|.+|-|..- +-+.. ++.  .-+=|-||-+||-.=
T Consensus       170 ~~gFiY~Vs~~GvTG~~~~~~~~~~~~i~~ik~~------t~~Pv~vGFGIs~~e~~~~-v~~--~ADGvIVGSaiV~~i  240 (265)
T PRK13121        170 ASGYVYYVSLKGVTGAATLDVSSVAAKLPAIRSH------VPLPVGVGFGIRDAATARA-VAE--VADAVVIGSRLVQLI  240 (265)
T ss_pred             CCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHC------CCCCEEEECCCCCHHHHHH-HHH--CCCEEEECHHHHHHH
T ss_conf             8980999755556677756628899999999854------7998599768898999999-981--199999848999999


Q ss_pred             HHHHHHHHH---HHHHHHHHHHH
Q ss_conf             994099999---99999997410
Q gi|254780438|r  231 LECGVKEAV---FCFRRACGQHL  250 (261)
Q Consensus       231 l~~GL~~aI---~~~~~ii~~~~  250 (261)
                      -..+-++.+   .+|.+-+++..
T Consensus       241 ~~~~~e~~~~~v~~fi~~lk~al  263 (265)
T PRK13121        241 EQAPPERAAAALTDFLAELRAAL  263 (265)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHH
T ss_conf             85785768999999999999986


No 114
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2.  Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.
Probab=67.77  E-value=12  Score=19.17  Aligned_cols=76  Identities=12%  Similarity=0.187  Sum_probs=37.8

Q ss_pred             HHHHHHCCCCEEEECCCCC--HHHH-----HH--------HHHHHHHHHHHHHHHHHHH--H--CCCEEEECC----CCC
Q ss_conf             9999740661465112111--0244-----43--------5643366688999876654--1--562352078----989
Q gi|254780438|r  147 LQAAKLTGADCIELYTGPY--GACY-----NN--------PQQERIFLNKLAITAQLAQ--K--MDLQINAGH----DLT  203 (261)
Q Consensus       147 i~~a~~~Gad~VElhTG~Y--a~a~-----~~--------~~~~~~el~~i~~aa~~A~--~--lgL~VnAGH----gLn  203 (261)
                      -+.|++.|+|.||||.+.-  -+.|     +.        .++....+..+.++.+.+.  +  +|+++++--    |++
T Consensus       155 A~rA~~AGfDgVEiH~ahGYLl~qFlS~~~N~RtDeYGGS~ENR~Rf~lEii~avr~~vg~d~~v~~Ris~~d~~~~G~~  234 (338)
T cd04733         155 ARLAQEAGFDGVQIHAAHGYLLSQFLSPLTNKRTDEYGGSLENRARLLLEIYDAIRAAVGPGFPVGIKLNSADFQRGGFT  234 (338)
T ss_pred             HHHHHHCCCCEEEECCCCCHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHCCCCCC
T ss_conf             99999839998998236554899862987689968579898899889999999999971998869998453542479999


Q ss_pred             HHHHHHHHHHCC--CCEEEEE
Q ss_conf             877999997369--9638842
Q gi|254780438|r  204 IQNIPNLINAIP--YISEISV  222 (261)
Q Consensus       204 ~~Nl~~~i~~Ip--~I~EvsI  222 (261)
                      .+-...+++.+.  .++=+++
T Consensus       235 ~~d~~~~~~~l~~~GvD~i~v  255 (338)
T cd04733         235 EEDALEVVEALEEAGVDLVEL  255 (338)
T ss_pred             HHHHHHHHHHHHHCCCCEEEE
T ss_conf             899999999998769988994


No 115
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=67.30  E-value=12  Score=19.12  Aligned_cols=47  Identities=19%  Similarity=0.393  Sum_probs=34.4

Q ss_pred             HHHHHHHHH---------HCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             689999985---------07212897101655533357822133378899999862026963899725
Q gi|254780438|r   81 ETFLNLCER---------YKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFAD  139 (261)
Q Consensus        81 ~e~i~ia~~---------ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFID  139 (261)
                      +.|+.+.++         ..|.||++.|-..+..            ++..++.+.|++.||||.+=.-
T Consensus       467 ERfi~iLiE~~~G~~P~WLaPvQv~VipV~~~~~------------~ya~~v~~~L~~~giRvdvD~~  522 (589)
T COG0441         467 ERFIGILLEHYAGALPTWLAPVQVRVIPVADEHL------------DYAKEVAEKLRKAGIRVDIDDR  522 (589)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCEEEEEEECHHHH------------HHHHHHHHHHHHCCCEEEECCC
T ss_conf             9999999986469887657851799999373777------------8999999999972970241256


No 116
>PRK08318 dihydropyrimidine dehydrogenase; Validated
Probab=67.01  E-value=6.8  Score=20.76  Aligned_cols=133  Identities=24%  Similarity=0.259  Sum_probs=63.5

Q ss_pred             HHHHHHHHHCCCCEEEEE-----------CC------CCCCCC--------C----HHHHHHHHHHHCCCCCCC--EEEE
Q ss_conf             999999997499899982-----------47------883348--------8----899999887400013674--1588
Q gi|254780438|r   27 VHIGKIALQSGASGLTVH-----------PR------PDQRHI--------R----YTDLPEIRRLIDEQFPKA--ELNI   75 (261)
Q Consensus        27 ~~~a~~~~~~GadgITvH-----------~R------~DrRHI--------~----~~Dv~~l~~~~~~~~~~~--elNi   75 (261)
                      .+....+.++|+-+++..           ||      .+++.+        .    +..+..++++ +..+|+.  --+|
T Consensus        28 ~~~i~~~~~aG~GaVV~KTl~~~~~~~~~pr~~~~~~~~~~~~G~~N~elisd~~le~~L~~i~~~-k~~~P~~~vIaSI  106 (413)
T PRK08318         28 YYNVARAFEAGWGGVVWKTLGPFIVNVSSPRFDALVKEDRRFIGFNNIELITDRPLEVNLREIRRV-KRDYPDRALIASI  106 (413)
T ss_pred             HHHHHHHHHCCCEEEEECCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH-HHCCCCCEEEEEE
T ss_conf             999999987695399905078767788999825735776242362374213445899999999998-8607897089999


Q ss_pred             EECCC-HHHHHHHHHH---CCCEEEEEECCCCCCC-CCCCCCHHHHHHHHHHHHHHHCC-CCCEEEEEECCCCCC--HHH
Q ss_conf             83485-6899999850---7212897101655533-35782213337889999986202-696389972544441--479
Q gi|254780438|r   76 EGYPN-ETFLNLCERY---KPEQITLVPDDPHQLT-SDHGWDFLQNQALLTKTVARLHN-LGSRISLFADGNGNE--HSL  147 (261)
Q Consensus        76 Eg~p~-~e~i~ia~~i---kP~qvtLVPe~r~elT-TegGldv~~~~~~L~~~i~~l~~-~girvSLFIDpd~~q--~~i  147 (261)
                      =+..+ +++.+++..+   ..+...|==--|+-.+ -..|.++.++.+.+..+++..++ ..+.|..=+-|+.+.  ...
T Consensus       107 ~g~~~~e~w~~la~~~e~~GaDalELNiSCPn~~~~~~~G~~~gq~pe~v~~i~~~Vk~~~~iPV~vKLsPnvtdi~~iA  186 (413)
T PRK08318        107 MVECNEEEWKEIAPLVEETGADGIELNFGCPHGMSERGMGSAVGQVPELVEMVTRWVKRGSRLPVIAKLTPNITDIREPA  186 (413)
T ss_pred             ECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHH
T ss_conf             45878899999999866518877999555677666665551105799999999999885068856998289975289999


Q ss_pred             HHHHHCCCCEEEE
Q ss_conf             9997406614651
Q gi|254780438|r  148 QAAKLTGADCIEL  160 (261)
Q Consensus       148 ~~a~~~Gad~VEl  160 (261)
                      +++.+-|||.|=+
T Consensus       187 ~aa~~aGADgv~l  199 (413)
T PRK08318        187 RAAKRGGADAVSL  199 (413)
T ss_pred             HHHHHCCCCEEEE
T ss_conf             9999769988999


No 117
>PRK13305 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional
Probab=66.98  E-value=12  Score=19.06  Aligned_cols=123  Identities=15%  Similarity=0.150  Sum_probs=81.8

Q ss_pred             HHHHHHHHHHHHHCCCCCEE--EEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             33788999998620269638--9972544441479999740661465112111024443564336668899987665415
Q gi|254780438|r  115 QNQALLTKTVARLHNLGSRI--SLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKM  192 (261)
Q Consensus       115 ~~~~~L~~~i~~l~~~girv--SLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~l  192 (261)
                      .....++..++.-++.|..+  -|.=.++.++  .+...++|++.+.+|+|-=+.+.... .....+..++    ...++
T Consensus        90 A~~~TI~~~~~~a~~~g~~v~vDli~~~~~~~--ak~~~~lgv~~v~~H~g~D~q~~g~~-~~~~~l~~~k----~~~~~  162 (220)
T PRK13305         90 APLATVEKGHAVAQSCGGEIQIELFGNWTLDD--ARDWHRIGVRQAIYHRGRDAQASGQQ-WGEADLARMK----ALSDI  162 (220)
T ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCCCCHHH--HHHHHHCCCCEEEEEECCCHHHCCCC-CCHHHHHHHH----HHHHC
T ss_conf             89799999999999809989998458998789--99999869988999833367651898-6310199999----87606


Q ss_pred             CCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             623520789898779999973699638842599999999940999999999999741
Q gi|254780438|r  193 DLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQH  249 (261)
Q Consensus       193 gL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~~~  249 (261)
                      |+.|-.-=|+|.++++.+. .++ .+=+-.|-+|..-+   --.++-++|++.|++.
T Consensus       163 ~~~vaVAGGI~~~~i~~~~-~~~-~~ivIvGraIt~A~---dP~~aA~~~~~~I~~~  214 (220)
T PRK13305        163 GLELSITGGITPADLPLFK-DIR-VKAFIAGRALAGAA---NPAQVAGDFHAQIDAI  214 (220)
T ss_pred             CCEEEEECCCCHHHHHHHH-CCC-CCEEEECHHHCCCC---CHHHHHHHHHHHHHHH
T ss_conf             9649998887888999997-169-98999893651899---9999999999999998


No 118
>PRK08508 biotin synthase; Provisional
Probab=66.90  E-value=12  Score=19.05  Aligned_cols=142  Identities=13%  Similarity=0.132  Sum_probs=79.7

Q ss_pred             EEEECCC---HHHHHHHHHHCC---CEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC--CCEEEEEECCCCCCH
Q ss_conf             8883485---689999985072---12897101655533357822133378899999862026--963899725444414
Q gi|254780438|r   74 NIEGYPN---ETFLNLCERYKP---EQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNL--GSRISLFADGNGNEH  145 (261)
Q Consensus        74 NiEg~p~---~e~i~ia~~ikP---~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~--girvSLFIDpd~~q~  145 (261)
                      +++-++-   +++++.|...+-   ...|+|       ||..|++- ...+++..+++.+|+.  ++.+.+-+- -.+..
T Consensus        33 ~i~~Y~l~~~eeIl~~A~~a~~~G~~rf~lv-------~sg~~~~~-~~~e~v~~~v~~Ik~~~~~l~~c~slG-~l~~e  103 (279)
T PRK08508         33 DIKRYKRKEIEQIVQEAKMARANGALGFCLV-------TAGRGLDD-KKLEYVAKAAKAVKKEVPGLHLIACNG-MASVE  103 (279)
T ss_pred             CCCEECCCCHHHHHHHHHHHHHCCCCEEEEE-------EECCCCCH-HHHHHHHHHHHHHHHCCCCEEEEEECC-CCCHH
T ss_conf             9861078999999999999997599768999-------82368875-449999999999863379935761178-57999


Q ss_pred             HHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEC--CCC--CHHHH---HHHHHHCCCCE
Q ss_conf             799997406614651121110244435643366688999876654156235207--898--98779---99997369963
Q gi|254780438|r  146 SLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAG--HDL--TIQNI---PNLINAIPYIS  218 (261)
Q Consensus       146 ~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAG--HgL--n~~Nl---~~~i~~Ip~I~  218 (261)
                      +.+..++.|+|+.-..-..--..|.+--... .++.=.++.+.+++.|++|-.|  =||  +.+-.   ..+++.+. .+
T Consensus       104 ~~~~LkeAGvdrY~hNlETs~~~y~~I~tTh-ty~dRl~tl~~~k~aGl~vCsGgIiGlGEt~edrve~a~~L~eL~-~d  181 (279)
T PRK08508        104 QLKELKKAGIFSYNHNLETSKEFFPKICTTH-SWEERFQTCLNAKEAGLGLCSGGIFGLGESWEDRISMLKSLASLS-PH  181 (279)
T ss_pred             HHHHHHHCCCCEECCCCCCCHHHHCCCCCCC-CHHHHHHHHHHHHHCCCEEECCCEEECCCCHHHHHHHHHHHHHCC-CC
T ss_conf             9999998397123076676768757658998-889999999999981994867854478999899999999998389-98


Q ss_pred             EEEEHHHH
Q ss_conf             88425999
Q gi|254780438|r  219 EISVGHAF  226 (261)
Q Consensus       219 EvsIGHai  226 (261)
                      -|-|+.++
T Consensus       182 sVPIN~li  189 (279)
T PRK08508        182 STPINFFI  189 (279)
T ss_pred             EECCCCCC
T ss_conf             75156765


No 119
>PRK08444 hypothetical protein; Provisional
Probab=66.40  E-value=12  Score=18.99  Aligned_cols=128  Identities=11%  Similarity=0.120  Sum_probs=77.2

Q ss_pred             HHHHHHHHHH---CCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC--CCEEEEEECCCC----------CCH
Q ss_conf             6899999850---7212897101655533357822133378899999862026--963899725444----------414
Q gi|254780438|r   81 ETFLNLCERY---KPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNL--GSRISLFADGNG----------NEH  145 (261)
Q Consensus        81 ~e~i~ia~~i---kP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~--girvSLFIDpd~----------~q~  145 (261)
                      +++++.+.+.   .-.++|+|          ||++-.-..++..+.++.+++.  ++.+.-|-.+..          -..
T Consensus        83 eei~~~~~ea~~~G~tev~i~----------GG~~P~~~~eyY~~l~r~ik~~~P~i~i~aft~~EI~~~a~~~~~s~~e  152 (353)
T PRK08444         83 EEILEIVKESVKRGIKEVHIV----------SAHNPNYGYQWYLEIFKMIKEAYPNLHVKAMTAAEVDFLSRKFGKSYEE  152 (353)
T ss_pred             HHHHHHHHHHHHCCCCEEEEE----------CCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCHHH
T ss_conf             999999999997598789981----------4759899758899999999985885047717789999999980999999


Q ss_pred             HHHHHHHCCCCEEEECCCCCHHHHHHHHHH-----HHHHHHHHHHHHHHHHCCCEEEE----CCCCCHHHHHHHHHHCCC
Q ss_conf             799997406614651121110244435643-----36668899987665415623520----789898779999973699
Q gi|254780438|r  146 SLQAAKLTGADCIELYTGPYGACYNNPQQE-----RIFLNKLAITAQLAQKMDLQINA----GHDLTIQNIPNLINAIPY  216 (261)
Q Consensus       146 ~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~-----~~el~~i~~aa~~A~~lgL~VnA----GHgLn~~Nl~~~i~~Ip~  216 (261)
                      .+...|+.|.|.+   +|.=|.-+.+....     +..-++..+..+.|+++||..+|    ||+=+++-...-+..|..
T Consensus       153 vL~~Lk~AGL~sl---pGggAEIl~d~VR~~I~p~K~~~~~Wl~i~~~AH~lGi~ttaTmmyGhvEt~e~rv~HL~~lR~  229 (353)
T PRK08444        153 VLEDMLEYGVDSM---PGGGAEIFDEEVRKKICKGKVSSERWLEIHKYWHKKGKQSNATMLFGHIENREHRIDHMLRLRD  229 (353)
T ss_pred             HHHHHHHHCCCCC---CCCCCHHCCHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             9999998198757---8987200377789761899899999999999999829966414677887999999999999998


Q ss_pred             CEEEE
Q ss_conf             63884
Q gi|254780438|r  217 ISEIS  221 (261)
Q Consensus       217 I~Evs  221 (261)
                      +++-.
T Consensus       230 lQd~t  234 (353)
T PRK08444        230 LQDKT  234 (353)
T ss_pred             HCCCC
T ss_conf             36557


No 120
>PRK13113 consensus
Probab=66.33  E-value=12  Score=18.98  Aligned_cols=204  Identities=16%  Similarity=0.168  Sum_probs=122.4

Q ss_pred             CCCCHHH---HHHHHHHCCCCEEEE-----ECCCCCCCCCHHHHH------------HHHHHHCCCCCCCEEEEEECCCH
Q ss_conf             6899899---999999749989998-----247883348889999------------98874000136741588834856
Q gi|254780438|r   22 PWPNLVH---IGKIALQSGASGLTV-----HPRPDQRHIRYTDLP------------EIRRLIDEQFPKAELNIEGYPNE   81 (261)
Q Consensus        22 ~~P~~~~---~a~~~~~~GadgITv-----H~R~DrRHI~~~Dv~------------~l~~~~~~~~~~~elNiEg~p~~   81 (261)
                      .|||+-.   ++....++|||-|-+     -|--|--.||....+            ++.+-+....+.+|+=+=+|-++
T Consensus        26 G~P~~e~s~~~~~~l~~~GaDiiElGiPFSDP~ADGPvIq~A~~rAL~~G~~~~~~~~~v~~~r~~~~~~PivlM~Y~N~  105 (263)
T PRK13113         26 GDPDYDTSLEVMRGLPAAGVDIIELGMPFTDPMADGPTIQLAGQRALEGGMTLDRTLDMVRAFRKEDDTTPIVMMGYYNP  105 (263)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCEEEEECHHH
T ss_conf             28997999999999997699999978988887765899999999999779838899999997512389988899831368


Q ss_pred             -------HHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCC
Q ss_conf             -------8999998507212897101655533357822133378899999862026963899725444414799997406
Q gi|254780438|r   82 -------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTG  154 (261)
Q Consensus        82 -------e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~G  154 (261)
                             +|++.+.+.-=+-+ ||||-|-|              .-.++...+++.|+..-.|+-|..+..-++...+..
T Consensus       106 i~~~G~e~F~~~~~~~GvdGv-IipDLP~e--------------E~~~~~~~~~~~~l~~I~lvaPtt~~~Ri~~i~~~a  170 (263)
T PRK13113        106 IYSRGVDRFLAEAKEAGIDGL-IVVDLPPE--------------EDSELCLPAQAAGLNFIRLATPTTDDRRLPKVLQNT  170 (263)
T ss_pred             HHHHHHHHHHHHHHHCCCCEE-EECCCCHH--------------HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCC
T ss_conf             988569999999877794369-71799978--------------889999999977986799947999999999998338


Q ss_pred             CCEEEE-----CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHH
Q ss_conf             614651-----121110244435643366688999876654156235207898987799999736996388425999999
Q gi|254780438|r  155 ADCIEL-----YTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAAT  229 (261)
Q Consensus       155 ad~VEl-----hTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIse  229 (261)
                      -..|=.     =||.-..   ........+.+++..      ..+-|-.|-|..-.--...++  ..-+=|-||-++|-.
T Consensus       171 ~gFiY~Vs~~GvTG~~~~---~~~~~~~~i~~ik~~------t~~Pv~vGFGI~~~e~~~~~~--~~ADGvIVGSa~v~~  239 (263)
T PRK13113        171 SGFVYYVSITGITGAAAA---QAADVAPEVARIKAA------TDLPVIVGFGITTPEAAQAIA--GVADGCVVGSAIVKL  239 (263)
T ss_pred             CCCEEEEECCCCCCCCCC---CHHHHHHHHHHHHHC------CCCCEEEECCCCCHHHHHHHH--CCCCEEEECHHHHHH
T ss_conf             984899834556687755---437799999999854------799889983789989999997--339999986899999


Q ss_pred             HHHH-HHHHHHHHHHHHHHHHHHH
Q ss_conf             9994-0999999999999741056
Q gi|254780438|r  230 ALEC-GVKEAVFCFRRACGQHLDN  252 (261)
Q Consensus       230 Al~~-GL~~aI~~~~~ii~~~~~~  252 (261)
                      --.- +.+ -+.+|.+-+++..+.
T Consensus       240 i~e~~~~~-~~~~~v~~l~~~~~~  262 (263)
T PRK13113        240 IGEGRPVA-EVLAFVATLADGAHA  262 (263)
T ss_pred             HHHCCCHH-HHHHHHHHHHHHHHC
T ss_conf             98289989-999999999998741


No 121
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism]
Probab=66.27  E-value=12  Score=19.01  Aligned_cols=184  Identities=16%  Similarity=0.199  Sum_probs=83.5

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCC-----HHHHHHHHHHCCCEEEE---
Q ss_conf             8999999997499899982478833488899999887400013674158883485-----68999998507212897---
Q gi|254780438|r   26 LVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPN-----ETFLNLCERYKPEQITL---   97 (261)
Q Consensus        26 ~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~-----~e~i~ia~~ikP~qvtL---   97 (261)
                      +++.|+.+.++||-.--+=-  --|. +++|...+.+.+..-  +-++++|-..+     ++..+-..+.--+..+.   
T Consensus        89 Ile~Ak~ak~~Ga~r~c~~a--agr~-~~~~~~~i~~~v~~V--k~~~~le~c~slG~l~~eq~~~L~~aGvd~ynhNLe  163 (335)
T COG0502          89 ILEAAKKAKAAGATRFCMGA--AGRG-PGRDMEEVVEAIKAV--KEELGLEVCASLGMLTEEQAEKLADAGVDRYNHNLE  163 (335)
T ss_pred             HHHHHHHHHHCCCCEEEEEE--ECCC-CCCCHHHHHHHHHHH--HHHCCCHHHHCCCCCCHHHHHHHHHCCHHHEECCCC
T ss_conf             99999999974995079987--3167-774489999999999--984692864025879999999999718113303555


Q ss_pred             -EECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEE---EEECCCCCC---HHHHHHHHCC-CCEEEECCC------
Q ss_conf             -10165553335782213337889999986202696389---972544441---4799997406-614651121------
Q gi|254780438|r   98 -VPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRIS---LFADGNGNE---HSLQAAKLTG-ADCIELYTG------  163 (261)
Q Consensus        98 -VPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvS---LFIDpd~~q---~~i~~a~~~G-ad~VElhTG------  163 (261)
                       .|+--..+.|-+-|+     + -..+++..++.|+.|+   ++==....+   ..+...+++. +|.|-++.=      
T Consensus       164 Ts~~~y~~I~tt~t~e-----d-R~~tl~~vk~~Gi~vcsGgI~GlGEs~eDri~~l~~L~~l~~pdsVPIn~l~P~~GT  237 (335)
T COG0502         164 TSPEFYENIITTRTYE-----D-RLNTLENVREAGIEVCSGGIVGLGETVEDRAELLLELANLPTPDSVPINFLNPIPGT  237 (335)
T ss_pred             CCHHHHCCCCCCCCHH-----H-HHHHHHHHHHCCCCCCCCEEECCCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCC
T ss_conf             6978875657898888-----9-999999999809850451276189988899999999971899885423210379998


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHH-HCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHH
Q ss_conf             110244435643366688999876654-1562352078989877999997369963884259
Q gi|254780438|r  164 PYGACYNNPQQERIFLNKLAITAQLAQ-KMDLQINAGHDLTIQNIPNLINAIPYISEISVGH  224 (261)
Q Consensus       164 ~Ya~a~~~~~~~~~el~~i~~aa~~A~-~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGH  224 (261)
                      |+++.   +.-...+.-|....+++.- ..-+.+-+|-.-++..+..+ .-.-++..+=.|.
T Consensus       238 Ple~~---~~~~~~e~lk~IA~~Ri~~P~~~Ir~s~gr~~~~~~~q~~-~~~aGansi~~g~  295 (335)
T COG0502         238 PLENA---KPLDPFEFLKTIAVARIIMPKSMIRLSAGRETMLPELQAL-AFMAGANSIFVGD  295 (335)
T ss_pred             CCCCC---CCCCHHHHHHHHHHHHHHCCCCEEECCCCCCCCCHHHHHH-HHHHCCCEEEECC
T ss_conf             66658---9999899999999999977864567258835225888999-9984566356524


No 122
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional
Probab=66.08  E-value=12  Score=18.95  Aligned_cols=40  Identities=23%  Similarity=0.177  Sum_probs=19.0

Q ss_pred             CHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHH
Q ss_conf             9899999999749989998247883348889999988740
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI   64 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~   64 (261)
                      ||.+.|+.-+++||+.|-|---|+-=.=..+|+..+++.+
T Consensus        62 dp~~iA~~Y~~~GA~aiSVLTe~~~F~Gs~~~L~~v~~~v  101 (247)
T PRK13957         62 HPVQIAKTYETLGASAISVLTDQSYFGGSLEDLKSVSSEL  101 (247)
T ss_pred             CHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHC
T ss_conf             9999999999779928998278566799899999999857


No 123
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional
Probab=65.93  E-value=12  Score=18.93  Aligned_cols=66  Identities=15%  Similarity=0.164  Sum_probs=39.0

Q ss_pred             HHHHHHHHCCCC--EEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH-HHHHHHHHHCCCEEEEE
Q ss_conf             999999974998--999824788334888999998874000136741588834856-89999985072128971
Q gi|254780438|r   28 HIGKIALQSGAS--GLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE-TFLNLCERYKPEQITLV   98 (261)
Q Consensus        28 ~~a~~~~~~Gad--gITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~-e~i~ia~~ikP~qvtLV   98 (261)
                      +-|..|.++|||  |....|. -.|+|..+....|.+.+..    ...-+=.+++. ++.+++.+..++.|-|=
T Consensus       269 eDA~~a~~~GAD~iGfIF~~~-SpR~Vs~e~Ak~I~~~~pi----~~VgVFvn~~~~~I~~i~~~~~ld~VQLH  337 (459)
T PRK09427        269 QDAKAAYDAGAVYGGLIFVEK-SPRYVSLEQAQEIIAAAPL----RYVGVFRNADIEDVVDIAKVLSLAAVQLH  337 (459)
T ss_pred             HHHHHHHHCCCCEEEEEEECC-CCCCCCHHHHHHHHHHCCC----CEEEEECCCCHHHHHHHHHHCCCCEEEEC
T ss_conf             999999984999898997269-8887999999999986899----87999748999999999983899889989


No 124
>PRK01362 putative translaldolase; Provisional
Probab=65.93  E-value=12  Score=18.93  Aligned_cols=192  Identities=15%  Similarity=0.189  Sum_probs=117.9

Q ss_pred             CHHHHHHHHHHCC-CCEEEEECCCCCCCCC-H-HHHHHHHHHHCCCCCCCEEEEEECCC--HHHHHHHH---HHCCCEEE
Q ss_conf             9899999999749-9899982478833488-8-99999887400013674158883485--68999998---50721289
Q gi|254780438|r   25 NLVHIGKIALQSG-ASGLTVHPRPDQRHIR-Y-TDLPEIRRLIDEQFPKAELNIEGYPN--ETFLNLCE---RYKPEQIT   96 (261)
Q Consensus        25 ~~~~~a~~~~~~G-adgITvH~R~DrRHI~-~-~Dv~~l~~~~~~~~~~~elNiEg~p~--~e~i~ia~---~ikP~qvt   96 (261)
                      |+-+..+ +.+.| .+|+|--|-==+|-=+ + +-+..+.++.     +.++-+|-...  ++|++-+.   ++.|+-+-
T Consensus         9 d~~~i~~-~~~~~~i~GvTTNPsll~k~g~~~~~~~~~i~~~~-----~~~is~ev~~~~~~~m~~qA~~l~~~~~nv~V   82 (214)
T PRK01362          9 NVEEIKE-ANELGVLDGVTTNPSLIAKEGRDFKEVIKEICSIV-----DGPVSAEVIALDAEGMIKEGRELAKIAPNVVV   82 (214)
T ss_pred             CHHHHHH-HHCCCCCCEEECCHHHHHHCCCCHHHHHHHHHHHC-----CCCEEEEECCCHHHHHHHHHHHHHHHCCCEEE
T ss_conf             9999999-86479915695898999875999899999998731-----79757996364199999999999984877699


Q ss_pred             EEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             71016555333578221333788999998620269638997254444147999974066146511211102444356433
Q gi|254780438|r   97 LVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER  176 (261)
Q Consensus        97 LVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~  176 (261)
                      =||-     |.+|          + +.++.|++.|++|.+=.=-++.|  .-.|...||+.|-.|.|.-++.-.++..  
T Consensus        83 KIP~-----t~~G----------l-~ai~~L~~~Gi~vn~Tai~s~~Q--a~~Aa~aga~yispy~gR~~d~G~Dg~~--  142 (214)
T PRK01362         83 KIPM-----TTEG----------L-KAVKALSKEGIKTNVTLCFSANQ--ALLAAKAGATYVSPFVGRLDDIGTDGME--  142 (214)
T ss_pred             ECCC-----CHHH----------H-HHHHHHHHCCCCEEEEECCCHHH--HHHHHHCCCCEEEEECCHHHHCCCCHHH--
T ss_conf             8189-----6669----------9-99999998499757664588999--9999875996898631218655898289--


Q ss_pred             HHHHHHHHHHHHHHH--CCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHH-HHHHHHHHHHHH
Q ss_conf             666889998766541--562352078989877999997369963884259999999994099-999999999974
Q gi|254780438|r  177 IFLNKLAITAQLAQK--MDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVK-EAVFCFRRACGQ  248 (261)
Q Consensus       177 ~el~~i~~aa~~A~~--lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~-~aI~~~~~ii~~  248 (261)
                       .+..+   .+....  ..-++-++-==|.+++....  .-+.+-+-|.-.++.+.+..-+. +++++|.+--++
T Consensus       143 -~i~~i---~~~~~~~~~~tkIL~AS~r~~~~i~~a~--~~G~~~iTvp~~i~~~l~~~plt~~~~~~F~~Dw~~  211 (214)
T PRK01362        143 -LIEDI---REIYDNYGFETEIIAASVRHPMHVLEAA--LIGADIATIPYKVIKQLFKHPLTDKGLEKFLADWAK  211 (214)
T ss_pred             -HHHHH---HHHHHHCCCCCEEEEEECCCHHHHHHHH--HCCCCEEECCHHHHHHHHCCCCHHHHHHHHHHHHHH
T ss_conf             -99999---9999963998137520038899999999--869999983999999997693379999999999998


No 125
>CHL00162 thiG thiamin biosynthesis protein G; Validated
Probab=65.87  E-value=13  Score=18.92  Aligned_cols=121  Identities=17%  Similarity=0.081  Sum_probs=62.3

Q ss_pred             CCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH-HHHH---HHH-------
Q ss_conf             88689989999999974998999824788334888999998874000136741588834856-8999---998-------
Q gi|254780438|r   20 NLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE-TFLN---LCE-------   88 (261)
Q Consensus        20 g~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~-e~i~---ia~-------   88 (261)
                      -+.|||+-....-.+.+|++=+||-+|-=.- -+..+-..+-..+....-.+-=|--|.-+. |-+.   ++.       
T Consensus        23 TgkY~s~~~~~~ai~aSgaeiVTVAlRR~~~-~~~~~~~~~l~~i~~~~~~~LPNTAGc~taeEAVr~A~lAREl~~~~g  101 (267)
T CHL00162         23 TGKYRNLEEAINSIEASGCEIVTVAIRRAQN-NKLNGNSSLLDGLDWNKLWLLPNTAGCQTAEEAIRVAFLGRELAKQLG  101 (267)
T ss_pred             CCCCCCHHHHHHHHHHHCCCEEEEEEECCCC-CCCCCHHHHHHHCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             2899999999999999699879999732557-788874678743370241785663022879999999999999853015


Q ss_pred             ---------HHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEE
Q ss_conf             ---------50721289710165553335782213337889999986202696389972544441479999740661465
Q gi|254780438|r   89 ---------RYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIE  159 (261)
Q Consensus        89 ---------~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VE  159 (261)
                               ++-||.-||-||.-+                +-+..+.|-+.|-.|--++.+||-.  -+...++|+.+|=
T Consensus       102 ~~~tnwIKLEVi~D~~tLlPD~~e----------------tl~Aae~Lv~eGF~VlpY~~dD~v~--akrLe~~Gc~avM  163 (267)
T CHL00162        102 QEDNNFVKLEVIPDPKYLLPDPIG----------------TLKAAEFLVRKGFTVLPYINADPVL--AKQLEDIGCATVM  163 (267)
T ss_pred             CCCCCEEEEEEECCCCCCCCCHHH----------------HHHHHHHHHHCCCEEEEECCCCHHH--HHHHHHCCCEEEE
T ss_conf             678977999982798777988789----------------9999999997899998954899899--9999865986886


No 126
>pfam12617 LdpA_C Iron-Sulfur binding protein C terminal. This domain family is found in bacteria and eukaryotes, and is typically between 179 and 201 amino acids in length. The family is found in association with pfam00037. LdpA (light-dependent period) plays a role in controlling the redox state in cyanobacteria to modulate its. circadian clock. LdpA is a protein with Iron-Sulfur cluster-binding motifs.
Probab=64.84  E-value=2.8  Score=23.39  Aligned_cols=21  Identities=14%  Similarity=0.335  Sum_probs=12.8

Q ss_pred             HHHHCCCCEEEEECCCCCCCC
Q ss_conf             999749989998247883348
Q gi|254780438|r   32 IALQSGASGLTVHPRPDQRHI   52 (261)
Q Consensus        32 ~~~~~GadgITvH~R~DrRHI   52 (261)
                      .|.+.|+|-|-+|-...|-..
T Consensus         2 ll~~~~~dAIEIHT~vgr~~~   22 (182)
T pfam12617         2 LLLSLGPDAIEIHTQVGRLAA   22 (182)
T ss_pred             CCCCCCCCEEEECCCCCCCHH
T ss_conf             432269988987178885479


No 127
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional
Probab=64.75  E-value=13  Score=18.78  Aligned_cols=37  Identities=14%  Similarity=0.350  Sum_probs=23.1

Q ss_pred             CHHHHHHHHCCCCC----------------------CCCHH-HHHHHHHHCCCCEEEEECC
Q ss_conf             14432232207886----------------------89989-9999999749989998247
Q gi|254780438|r    9 LNAVAVLRNRRNLP----------------------WPNLV-HIGKIALQSGASGLTVHPR   46 (261)
Q Consensus         9 idhiAtLRnaRg~~----------------------~P~~~-~~a~~~~~~GadgITvH~R   46 (261)
                      --|.+++|.||..+                      ||--+ .=..+|.++|+|-+ ..|.
T Consensus        33 ~GHlsLi~~A~~~~d~vvvSIFVNP~QF~~~eD~~~YPr~~~~D~~ll~~~gvd~v-f~P~   92 (512)
T PRK13477         33 QGHLSLIRRARQENDVVLVSIFVNPLQFGPNEDLERYPRTLEADRELCESAGVDAI-FAPS   92 (512)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEEECCCCCCCCHHHHHCCCCHHHHHHHHHHCCCCEE-ECCC
T ss_conf             89999999999869969999727877789864577679998999999996899999-8898


No 128
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism]
Probab=64.17  E-value=7.2  Score=20.57  Aligned_cols=44  Identities=20%  Similarity=0.192  Sum_probs=21.8

Q ss_pred             HHHHHHHCCCCE--EEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             799997406614--6511211102444356433666889998766541
Q gi|254780438|r  146 SLQAAKLTGADC--IELYTGPYGACYNNPQQERIFLNKLAITAQLAQK  191 (261)
Q Consensus       146 ~i~~a~~~Gad~--VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~  191 (261)
                      .-.+|...|||.  ||.|--|=. |..+.+|+- -++.+.+..+....
T Consensus       234 la~AA~AaGAdglmiEVHp~P~~-AlsD~~Qql-~~~~f~~l~~~~~~  279 (286)
T COG2876         234 LAKAAIAAGADGLMIEVHPDPEK-ALSDAKQQL-TPEEFEELVKELRA  279 (286)
T ss_pred             HHHHHHHCCCCEEEEEECCCCCC-CCCCCCCCC-CHHHHHHHHHHHHH
T ss_conf             89999861677369996479543-457600017-99999999999987


No 129
>PRK13115 consensus
Probab=63.95  E-value=14  Score=18.68  Aligned_cols=205  Identities=15%  Similarity=0.138  Sum_probs=127.5

Q ss_pred             CCCCHH---HHHHHHHHCCCCEEEEE-----CCCCCCCC------------CHHHHHHHHHHHCCCCCCCEEEEEECCCH
Q ss_conf             689989---99999997499899982-----47883348------------88999998874000136741588834856
Q gi|254780438|r   22 PWPNLV---HIGKIALQSGASGLTVH-----PRPDQRHI------------RYTDLPEIRRLIDEQFPKAELNIEGYPNE   81 (261)
Q Consensus        22 ~~P~~~---~~a~~~~~~GadgITvH-----~R~DrRHI------------~~~Dv~~l~~~~~~~~~~~elNiEg~p~~   81 (261)
                      .+||+-   ++.....++|||-|-+-     |--|---|            +-+|+.++-+.+.  ..++|+=+=+|.++
T Consensus        33 G~P~~e~t~~~i~~l~~~GaDiiElGiPFSDP~ADGPvIQ~A~~rAL~~G~~~~~~f~~v~~~~--~~~~PivlM~Y~N~  110 (269)
T PRK13115         33 GFPDVDTSIAAMTALVESGCDIVEVGLPYSDPVMDGPVIQAATEAALRGGVRVRDVFRAVEAIS--AAGGRALVMTYWNP  110 (269)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHC--CCCCCEEEHHHHHH
T ss_conf             3899899999999999669999997999888566689999999999977995999999999841--57998885475489


Q ss_pred             -------HHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCC
Q ss_conf             -------8999998507212897101655533357822133378899999862026963899725444414799997406
Q gi|254780438|r   82 -------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTG  154 (261)
Q Consensus        82 -------e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~G  154 (261)
                             +|.+-+.+.-=+ -.||||-|-              +.-.++.+.+++.|+..-.|+-|..++.-++...+..
T Consensus       111 i~~yG~e~F~~~~~~~Gvd-GvIipDLP~--------------eE~~~~~~~~~~~gi~~I~LvaPtt~~eRi~~i~~~a  175 (269)
T PRK13115        111 VLRYGVDRFARDLAAAGGA-GLITPDLIP--------------DEAGEWLAASERHGLDRIFLVAPSSTPERLAETVEAS  175 (269)
T ss_pred             HHHHCHHHHHHHHHHCCCC-EEECCCCCH--------------HHHHHHHHHHHHCCEEEEEEECCCCCHHHHHHHHHCC
T ss_conf             9873699999999973998-076478997--------------8999999999865812899858999889999998448


Q ss_pred             CCEEEE--CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCC-CHHHHHHHHHHCCCCEEEEEHHHHHHHHH
Q ss_conf             614651--121110244435643366688999876654156235207898-98779999973699638842599999999
Q gi|254780438|r  155 ADCIEL--YTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDL-TIQNIPNLINAIPYISEISVGHAFAATAL  231 (261)
Q Consensus       155 ad~VEl--hTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgL-n~~Nl~~~i~~Ip~I~EvsIGHaiIseAl  231 (261)
                      -..|=.  .+|.=...-.........++++++      ...+-|.+|-|. +-+-+.. ++  ..-+=|-||-++|-.-.
T Consensus       176 ~GFIY~Vs~~GvTG~~~~~~~~~~~~i~~ik~------~t~~Pv~vGFGIs~~e~~~~-~~--~~aDGvIVGSa~V~~i~  246 (269)
T PRK13115        176 RGFVYAASTMGVTGARDAVSSAAPELVARVRA------ASDIPVCVGLGVSSAAQAAE-IA--GYADGVIVGSALVSALL  246 (269)
T ss_pred             CCCEEEEECCCCCCCCCCCCHHHHHHHHHHHH------HCCCCCEEECCCCCHHHHHH-HH--HHCCEEEECHHHHHHHH
T ss_conf             88089975454567764441779999999997------17998179727899999999-98--02999998689999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9409999999999997410565
Q gi|254780438|r  232 ECGVKEAVFCFRRACGQHLDNT  253 (261)
Q Consensus       232 ~~GL~~aI~~~~~ii~~~~~~~  253 (261)
                      ..|+++ |.++.+=+++..+.+
T Consensus       247 ~~g~~~-v~~~~~el~~~~k~a  267 (269)
T PRK13115        247 DGGLPA-VRALTEELAAGVRRA  267 (269)
T ss_pred             HCCHHH-HHHHHHHHHHHHHHH
T ss_conf             759799-999999999999985


No 130
>PRK12656 fructose-6-phosphate aldolase; Reviewed
Probab=63.86  E-value=14  Score=18.67  Aligned_cols=196  Identities=17%  Similarity=0.151  Sum_probs=124.6

Q ss_pred             CCHHHHHHHHHHCCCCEEEEECCCCCCCCC---HHHHHHHHHHHCCCCCCCEEEEEECC--CHHHHHHHHHH----CCCE
Q ss_conf             998999999997499899982478833488---89999988740001367415888348--56899999850----7212
Q gi|254780438|r   24 PNLVHIGKIALQSGASGLTVHPRPDQRHIR---YTDLPEIRRLIDEQFPKAELNIEGYP--NETFLNLCERY----KPEQ   94 (261)
Q Consensus        24 P~~~~~a~~~~~~GadgITvH~R~DrRHI~---~~Dv~~l~~~~~~~~~~~elNiEg~p--~~e~i~ia~~i----kP~q   94 (261)
                      -|+-+..+.....-.+|+|--|-==+|-=.   .+=+..+++++..   ..++-+|-..  .++|++-+.++    .++-
T Consensus         8 Adl~eI~~~~~~~~i~GvTTNPsll~k~g~~d~~~~l~~i~~~i~~---~~~ls~qv~~~d~~~mi~~a~~i~~~~~~nv   84 (222)
T PRK12656          8 LNLEAIKKWHHILPLAGVTSNPSIAKKEGDIDFFERIREVREIIGD---EASIHVQVVAQDYEGILKDAAEIRRQCGDDV   84 (222)
T ss_pred             CCHHHHHHHHCCCCCCEECCCHHHHHHCCCCCHHHHHHHHHHHHCC---CCCEEEEEEECCHHHHHHHHHHHHHHCCCCE
T ss_conf             8999999997489904575899999876998889999999998299---9888999763989999999999998557678


Q ss_pred             EEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHH
Q ss_conf             89710165553335782213337889999986202696389972544441479999740661465112111024443564
Q gi|254780438|r   95 ITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQ  174 (261)
Q Consensus        95 vtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~  174 (261)
                      +-=||-     |.+|           -+.++.|++.||+|..=.==++.|  .-.|.+.||+.|=.|.|.-.+.-.++..
T Consensus        85 ~VKIP~-----t~~G-----------lkai~~L~~~gi~vn~Tavfs~~Q--a~~Aa~aGA~yvsPf~GRi~d~G~Dg~~  146 (222)
T PRK12656         85 YIKVPV-----TPAG-----------LAAIKTLKAEGYHITATAIYTTFQ--GLLAIEAGADYLAPYYNRMENLNIDSEA  146 (222)
T ss_pred             EEECCC-----CHHH-----------HHHHHHHHHCCCCEEEEEECCHHH--HHHHHHCCCCEEEECCCCHHHCCCCCHH
T ss_conf             996688-----7889-----------999999997598656887279999--9999986998999714648754999289


Q ss_pred             HHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHH-HHHHHHHHH
Q ss_conf             336668899987665415623520789898779999973699638842599999999940999-999999999
Q gi|254780438|r  175 ERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKE-AVFCFRRAC  246 (261)
Q Consensus       175 ~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~-aI~~~~~ii  246 (261)
                         .+..++.... .+...-+|-|+-==|.+++....  .-+.+-+-|.-.+..+.+.+-+.. ++++|.+--
T Consensus       147 ---~i~~i~~~~~-~~~~~tkIL~ASiR~~~~v~~a~--~~G~d~iTipp~v~~~l~~hp~T~~~~~~F~~Dw  213 (222)
T PRK12656        147 ---VIGQLAEAIN-RENSNSKILAASFKNVAQVNKAF--ALGAQAVTAGPDVFEAAFAMPSIQKAVDDFGDDW  213 (222)
T ss_pred             ---HHHHHHHHHH-HCCCCCEEEEECCCCHHHHHHHH--HCCCCEEECCHHHHHHHHCCCCHHHHHHHHHHHH
T ss_conf             ---9999999998-55999619865268999999999--8699999859999999974901799999999999


No 131
>PRK10605 N-ethylmaleimide reductase; Provisional
Probab=63.47  E-value=14  Score=18.62  Aligned_cols=18  Identities=28%  Similarity=0.410  Sum_probs=14.7

Q ss_pred             HHHHHHCCCCEEEECCCC
Q ss_conf             999974066146511211
Q gi|254780438|r  147 LQAAKLTGADCIELYTGP  164 (261)
Q Consensus       147 i~~a~~~Gad~VElhTG~  164 (261)
                      -..|++.|+|.||||.+.
T Consensus       165 A~rA~~AGfDgVEIH~aH  182 (362)
T PRK10605        165 IANAREAGFDLVELHSAH  182 (362)
T ss_pred             HHHHHHCCCCEEEECCCC
T ss_conf             999998399989970247


No 132
>PRK00380 panC pantoate--beta-alanine ligase; Reviewed
Probab=62.96  E-value=14  Score=18.56  Aligned_cols=67  Identities=16%  Similarity=0.194  Sum_probs=34.1

Q ss_pred             HHHHHHHHHC--CCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCC----C---------CHH
Q ss_conf             8999998507--212897101655533357822133378899999862026963899725444----4---------147
Q gi|254780438|r   82 TFLNLCERYK--PEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNG----N---------EHS  146 (261)
Q Consensus        82 e~i~ia~~ik--P~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~----~---------q~~  146 (261)
                      +|-+.....+  -..+.|||       |=|+|-- +|...++...+  ...-+-||+||.|--    +         +.+
T Consensus         8 elr~~~~~~r~~g~~Ig~VP-------TMGaLH~-GHlsLI~~A~~--~~d~vvVSIFVNP~QF~~~eD~~~YPr~~e~D   77 (283)
T PRK00380          8 ELRAALRALRREGKRIGFVP-------TMGNLHE-GHLSLVREARA--EADVVVVSIFVNPLQFGPNEDLDRYPRTLEAD   77 (283)
T ss_pred             HHHHHHHHHHHCCCEEEEEC-------CCCHHHH-HHHHHHHHHHH--HCCEEEEEEEECCCCCCCCCCCCCCCCCHHHH
T ss_conf             99999999997199399985-------8722758-99999999997--49929999850601059875401289878999


Q ss_pred             HHHHHHCCCCEE
Q ss_conf             999974066146
Q gi|254780438|r  147 LQAAKLTGADCI  158 (261)
Q Consensus       147 i~~a~~~Gad~V  158 (261)
                      ++.+++.|+|.|
T Consensus        78 ~~~l~~~gvD~v   89 (283)
T PRK00380         78 LAKLEAAGVDLV   89 (283)
T ss_pred             HHHHHHCCCCEE
T ss_conf             999998699899


No 133
>pfam00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family. This family includes Orotidine 5'-phosphate decarboxylase enzymes EC:4.1.1.23 that are involved in the final step of pyrimidine biosynthesis. The family also includes enzymes such as hexulose-6-phosphate synthase. This family appears to be distantly related to pfam00834.
Probab=62.63  E-value=14  Score=18.52  Aligned_cols=39  Identities=31%  Similarity=0.411  Sum_probs=17.1

Q ss_pred             HHHHHHCCCCCEEEEEEC------CCCCCHHHHHHHHCCCCEEEECC
Q ss_conf             999862026963899725------44441479999740661465112
Q gi|254780438|r  122 KTVARLHNLGSRISLFAD------GNGNEHSLQAAKLTGADCIELYT  162 (261)
Q Consensus       122 ~~i~~l~~~girvSLFID------pd~~q~~i~~a~~~Gad~VElhT  162 (261)
                      +.++.+++.|  .-+|.|      |+...++++...+.|+|.+-+|.
T Consensus        42 ~~i~~l~~~~--~~iflDlKl~DI~~Tv~~~~~~~~~~~~d~~Tvh~   86 (218)
T pfam00215        42 KLVAELRKHG--FLIFLDLKFADIGNTVAKQAKYKAKLGADIVTVHA   86 (218)
T ss_pred             HHHHHHHHCC--CEEEEEEHHCCHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             9999999869--93999721227078999999999856998999915


No 134
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed
Probab=62.09  E-value=15  Score=18.46  Aligned_cols=182  Identities=14%  Similarity=0.167  Sum_probs=101.3

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHH-HHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEECCCCCCC
Q ss_conf             9999999749989998247883348889999988-740001367415888348568999998507212897101655533
Q gi|254780438|r   28 HIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR-RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLT  106 (261)
Q Consensus        28 ~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~-~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~r~elT  106 (261)
                      ....-|++.++..|--.-....++...+.+..+. .......-.+-+++-=..+-+.+.-+++.-=+.|-+  |.-    
T Consensus        33 Avi~AAee~~sPvIlq~~~~~~~~~g~~~~~~~~~~~a~~~~VPV~lHLDH~~~~e~i~~ai~~GftSVM~--DgS----  106 (284)
T PRK09195         33 VVVETAAELHSPVIIAGTPGTFSYAGTEYLLAIVSAAAKQYHHPLALHLDHHEKFDDIAQKVRSGVRSVMI--DGS----  106 (284)
T ss_pred             HHHHHHHHHCCCEEEECCHHHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEEEE--ECC----
T ss_conf             99999999599989998851664479899999999999877998899669879999999999749986886--389----


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCCEE--------------------EEEECCCCCCHHHHHHHHCCCCEEEECCCCCH
Q ss_conf             3578221333788999998620269638--------------------99725444414799997406614651121110
Q gi|254780438|r  107 SDHGWDFLQNQALLTKTVARLHNLGSRI--------------------SLFADGNGNEHSLQAAKLTGADCIELYTGPYG  166 (261)
Q Consensus       107 TegGldv~~~~~~L~~~i~~l~~~girv--------------------SLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya  166 (261)
                         -|++..|-..-+++++..+..|+.|                    ++|-||  +| ..+...++|+|+.-.=-|.-=
T Consensus       107 ---~l~~eeNi~~Tk~vv~~Ah~~gv~VEaElG~vgg~ed~~~~~~~~~~~T~p--ee-a~~Fv~~TgvD~LAvaiGt~H  180 (284)
T PRK09195        107 ---HLPFAQNISLVKEVVDFCHRFDVSVEAELGRLGGQEDDLQVDEKDALYTDP--AQ-AREFVEATGIDSLAVAIGTAH  180 (284)
T ss_pred             ---CCCHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCCCCCCCH--HH-HHHHHHHHCCCEEEEEECCCC
T ss_conf             ---899999999999999999872881899740015657787766632356899--99-999999759988986506545


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHH
Q ss_conf             244435643366688999876654156235207898987799999736996388425999
Q gi|254780438|r  167 ACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAF  226 (261)
Q Consensus       167 ~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHai  226 (261)
                      -.|....  +.-++++++. ..+....|-.|-|-|+.-+.+...++  -+|.-+|||--+
T Consensus       181 G~yk~~p--~L~~~~L~~I-~~~~~vPLVLHGgSG~~~e~i~~ai~--~Gv~KiNi~T~l  235 (284)
T PRK09195        181 GMYKSAP--KLDFDRLENI-RQWVNIPLVLHGASGLPTKDIQQTIK--LGICKVNVATEL  235 (284)
T ss_pred             CCCCCCC--CCCHHHHHHH-HHHHCCCEEEECCCCCCHHHHHHHHH--CCCEEEEECHHH
T ss_conf             5558988--4599999999-99749998987899989999999998--497699868589


No 135
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion]
Probab=62.00  E-value=15  Score=18.45  Aligned_cols=36  Identities=14%  Similarity=0.167  Sum_probs=16.5

Q ss_pred             EEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHH
Q ss_conf             3520789898779999973699638842599999999
Q gi|254780438|r  195 QINAGHDLTIQNIPNLINAIPYISEISVGHAFAATAL  231 (261)
Q Consensus       195 ~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl  231 (261)
                      -+.+|-.-+-+.....+++ ...+=|.+|-.++++-=
T Consensus       291 vi~~G~i~~~~~Ae~~l~~-g~aDlVa~gR~~ladP~  326 (363)
T COG1902         291 VIAVGGINDPEQAEEILAS-GRADLVAMGRPFLADPD  326 (363)
T ss_pred             EEEECCCCCHHHHHHHHHC-CCCCEEEECHHHHCCCC
T ss_conf             7986897999999999982-99888872636650920


No 136
>TIGR01326 OAH_OAS_sulfhy O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase; InterPro: IPR006235   This family of sequences is a distinct clade of the Cys/Met metabolism pyridoxal phosphate-dependent enzyme superfamily. Members include examples of OAH/OAS sulfhydrylase, an enzyme with activity both as O-acetylhomoserine sulfhydrylase (OAH, 2.5.1.49 from EC) and O-acetylserine sulfhydrylase (OAS, 2.5.1.47 from EC). An alternate name for OAH sulfhydrylase is homocysteine synthase.; GO: 0016765 transferase activity transferring alkyl or aryl (other than methyl) groups, 0006520 amino acid metabolic process.
Probab=61.81  E-value=7.7  Score=20.37  Aligned_cols=65  Identities=15%  Similarity=0.251  Sum_probs=40.9

Q ss_pred             HHHHHHHHCCCCCEEEEEECCC-CCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCE
Q ss_conf             9999986202696389972544-441479999740661465112111024443564336668899987665415--623
Q gi|254780438|r  120 LTKTVARLHNLGSRISLFADGN-GNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKM--DLQ  195 (261)
Q Consensus       120 L~~~i~~l~~~girvSLFIDpd-~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~l--gL~  195 (261)
                      ..-+--+||+.||.|..|=.+| |++  ++++.+=...+|  |    ++...+|+-.-   -.|.+.|+.||+.  |+=
T Consensus       110 ynLF~~TlkrlGIevrFvd~dd~pe~--~~k~id~nTKAv--f----~EtIgNP~~~v---~Die~~a~~Ah~~PhgvP  177 (434)
T TIGR01326       110 YNLFKHTLKRLGIEVRFVDGDDDPEE--LEKAIDENTKAV--F----AETIGNPALNV---PDIEAVAEVAHAHPHGVP  177 (434)
T ss_pred             HHHHHHHHHHCCEEEEEECCCCCHHH--HHHHCCCCCEEE--E----EECCCCCCCCC---CCHHHHHHHHHHCCCCCE
T ss_conf             78999955544814887278888789--997606675189--8----40123877676---785899999986789834


No 137
>COG2069 CdhD CO dehydrogenase/acetyl-CoA synthase delta subunit (corrinoid Fe-S protein) [Energy production and conversion]
Probab=61.62  E-value=10  Score=19.45  Aligned_cols=84  Identities=17%  Similarity=0.179  Sum_probs=54.6

Q ss_pred             HHHCCCCCCCCHHHHHHHHHH-CCCCEEEEECCCCCCCCCHHHHHHHHHHHCC--CCCCCEEEEEECCCH----HHHHHH
Q ss_conf             322078868998999999997-4998999824788334888999998874000--136741588834856----899999
Q gi|254780438|r   15 LRNRRNLPWPNLVHIGKIALQ-SGASGLTVHPRPDQRHIRYTDLPEIRRLIDE--QFPKAELNIEGYPNE----TFLNLC   87 (261)
Q Consensus        15 LRnaRg~~~P~~~~~a~~~~~-~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~--~~~~~elNiEg~p~~----e~i~ia   87 (261)
                      +|+--+...-||.+-|+.|.+ +|||-||+|+=-----|.|.-..+-.+++..  +--++|+-+-|+-++    +.++-|
T Consensus       141 ire~~~dVmedP~eWArk~Vk~fgadmvTiHlIsTdPki~D~p~~EAak~lEdvLqAVdvPiiiGGSGnpeKDpeVleka  220 (403)
T COG2069         141 IREHYDDVMEDPGEWARKCVKKFGADMVTIHLISTDPKIKDTPAKEAAKTLEDVLQAVDVPIIIGGSGNPEKDPEVLEKA  220 (403)
T ss_pred             HHHHHHHHHHCHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHH
T ss_conf             89988877529889999999984876599996137865567798999999999997548688966899976497999999


Q ss_pred             HHHCCCEEEEE
Q ss_conf             85072128971
Q gi|254780438|r   88 ERYKPEQITLV   98 (261)
Q Consensus        88 ~~ikP~qvtLV   98 (261)
                      -++.--.-||.
T Consensus       221 AEvaEGeRclL  231 (403)
T COG2069         221 AEVAEGERCLL  231 (403)
T ss_pred             HHHHCCCEEEE
T ss_conf             87615764775


No 138
>cd00859 HisRS_anticodon HisRS Histidyl-anticodon binding domain. HisRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only.
Probab=61.13  E-value=15  Score=18.34  Aligned_cols=47  Identities=13%  Similarity=0.140  Sum_probs=37.1

Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEEC
Q ss_conf             33788999998620269638997254444147999974066146511
Q gi|254780438|r  115 QNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELY  161 (261)
Q Consensus       115 ~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElh  161 (261)
                      ....+-..+...|++.|++|.+......-.+.++.|...|+..+=+.
T Consensus        12 ~~~~~a~~i~~~LR~~gi~v~~~~~~~~l~kqlk~A~k~~~~~~iii   58 (91)
T cd00859          12 GALSEALELAEQLRDAGIKAEIDYGGRKLKKQFKYADRSGARFAVIL   58 (91)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHCCCEEEEE
T ss_conf             99999999999999889939997368878899999997099889998


No 139
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS). KGPDC catalyzes the formation of L-xylulose 5-phosphate and carbon dioxide from 3-keto-L-gulonate 6-phosphate as part of the anaerobic pathway for L-ascorbate utilization in some eubacteria. HPS catalyzes the formation of D-arabino-3-hexulose-6-phosphate from D-ribulose 5-phosphate and formaldehyde in microorganisms that can use formaldehyde as a carbon source. Both catalyze reactions that involve the Mg2+-assisted formation and stabilization of 1,2-enediolate reaction intermediates.
Probab=61.10  E-value=15  Score=18.34  Aligned_cols=20  Identities=25%  Similarity=0.298  Sum_probs=10.6

Q ss_pred             HHHHHHCCCCEEEEECCCCC
Q ss_conf             99999749989998247883
Q gi|254780438|r   30 GKIALQSGASGLTVHPRPDQ   49 (261)
Q Consensus        30 a~~~~~~GadgITvH~R~Dr   49 (261)
                      ++.+.++|||.+|||-....
T Consensus        70 a~~~~~~Gad~~tvh~~~g~   89 (202)
T cd04726          70 AEMAFKAGADIVTVLGAAPL   89 (202)
T ss_pred             HHHHHHHCCCEEEEECCCCH
T ss_conf             99999707988999666898


No 140
>cd00465 URO-D_CIMS_like The URO-D_CIMS_like protein superfamily includes bacterial and eukaryotic uroporphyrinogen decarboxylases (URO-D), coenzyme M methyltransferases and other putative bacterial methyltransferases, as well as cobalamine (B12) independent methionine synthases. Despite their sequence similarities, members of this family have clearly different functions. Uroporphyrinogen decarboxylase (URO-D) decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, an important branching point of the tetrapyrrole biosynthetic pathway. The methyltransferases represented here are important for ability of methanogenic organisms to use other compounds than carbon dioxide for reduction to methane, and methionine synthases transfer a methyl group from a folate cofactor to L-homocysteine in a reaction requiring zinc.
Probab=60.67  E-value=15  Score=18.29  Aligned_cols=92  Identities=11%  Similarity=0.021  Sum_probs=56.2

Q ss_pred             HHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCC--CHHHHHH-------------------HHHHHH
Q ss_conf             8999998620269638997254444147999974066146511211--1024443-------------------564336
Q gi|254780438|r  119 LLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGP--YGACYNN-------------------PQQERI  177 (261)
Q Consensus       119 ~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~--Ya~a~~~-------------------~~~~~~  177 (261)
                      ..+.+++.++..++.+=+|..-+.. ..++...++|+|+|-+-...  -..+...                   ++....
T Consensus       187 ~~~~I~~~~~~~~vPiI~F~~G~~~-~~l~~~~~~g~d~i~lD~~~~d~~~a~~~~~~~~~lQGNLDP~~L~~~~e~i~~  265 (306)
T cd00465         187 AYKKVAEYKAAGEVPIVHHSCYDAA-DLLEEMIQLGVDVISFDMTVNEPKEAIEKVGEKKTLVGGVDPGYLPATDEECIA  265 (306)
T ss_pred             HHHHHHHHHCCCCCCEEEEECCCHH-HHHHHHHHCCCCEEEEECCCCCHHHHHHHHCCCEEEECCCCCHHHCCCHHHHHH
T ss_conf             9999999745799988998328667-789999861986799736777899999981899158708984676599899999


Q ss_pred             HHHHHHHHHHHHHHCCCEEEECCCCC------HHHHHHHHHHCC
Q ss_conf             66889998766541562352078989------877999997369
Q gi|254780438|r  178 FLNKLAITAQLAQKMDLQINAGHDLT------IQNIPNLINAIP  215 (261)
Q Consensus       178 el~~i~~aa~~A~~lgL~VnAGHgLn------~~Nl~~~i~~Ip  215 (261)
                      +.+++.+..    ..+--.|-|||+.      =+|+..|+..+.
T Consensus       266 ~v~~il~~~----g~~~IfNLGHGi~P~~d~~pe~v~~~v~~V~  305 (306)
T cd00465         266 KVEELVERL----GPHYIINPDCGLGPDSDYKPEHLRAVVQLVD  305 (306)
T ss_pred             HHHHHHHHH----CCCCEEECCCCCCCCCCCCHHHHHHHHHHHC
T ss_conf             999999984----8987797899889999998179999999854


No 141
>PRK11026 ftsX cell division protein FtsX; Provisional
Probab=59.53  E-value=16  Score=18.16  Aligned_cols=105  Identities=8%  Similarity=0.121  Sum_probs=47.5

Q ss_pred             HHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHH---HHHHHHHHCC---
Q ss_conf             9999986202696389972544441479999740661465112111024443564336668899---9876654156---
Q gi|254780438|r  120 LTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA---ITAQLAQKMD---  193 (261)
Q Consensus       120 L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~---~aa~~A~~lg---  193 (261)
                      +......+.+ +.++|+|.++|.++.+++...+    .++-..|--.-.|-.+++.-.++++..   +......+.-   
T Consensus        55 v~~~~~~~~~-~~~IsvfL~~~~~~~~~~~l~~----~l~~~~~V~~v~~vskeeAl~~f~~~~g~~~~l~~L~~NPLP~  129 (309)
T PRK11026         55 VNQAATQFYP-SPQLTVYLHKTLDDDAANAVVE----QLRAEQGVEKVNYLSREEALGEFRNWSGFGGALDMLEENPLPA  129 (309)
T ss_pred             HHHHHHHHCC-CCEEEEEECCCCCHHHHHHHHH----HHHCCCCCCEEEEECHHHHHHHHHHHHCCCHHHHHCCCCCCCC
T ss_conf             9999996366-8459998789989999999999----9865788437988679999999998728621666355899985


Q ss_pred             -CEEEECCC-CC---HHHHHHHHHHCCCCEEEEEHHHHHHH
Q ss_conf             -23520789-89---87799999736996388425999999
Q gi|254780438|r  194 -LQINAGHD-LT---IQNIPNLINAIPYISEISVGHAFAAT  229 (261)
Q Consensus       194 -L~VnAGHg-Ln---~~Nl~~~i~~Ip~I~EvsIGHaiIse  229 (261)
                       +.|..--+ -+   ++-+..-++++|++++|..+...+.+
T Consensus       130 s~~V~~~~~~~~~~~~~~l~~~l~~~~gV~~V~~~~~~v~r  170 (309)
T PRK11026        130 VAIIIPKLDFQSTEKLNTLRDRLSQIKGVDEVRMDDSWFAR  170 (309)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHH
T ss_conf             06887437878979999999987168980476647489999


No 142
>pfam02569 Pantoate_ligase Pantoate-beta-alanine ligase. Pantoate-beta-alanine ligase, also know as pantothenate synthase, (EC:6.3.2.1) catalyses the formation of pantothenate from pantoate and alanine.
Probab=59.44  E-value=16  Score=18.15  Aligned_cols=65  Identities=15%  Similarity=0.246  Sum_probs=35.1

Q ss_pred             HHHHHHHHH--CCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCC---------------
Q ss_conf             899999850--721289710165553335782213337889999986202696389972544441---------------
Q gi|254780438|r   82 TFLNLCERY--KPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNE---------------  144 (261)
Q Consensus        82 e~i~ia~~i--kP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q---------------  144 (261)
                      |+-......  .-..+.|||       |=|+|-- +|...++..-+  ...-+-||+||.|  .|               
T Consensus         9 el~~~~~~~~~~~~~i~~VP-------TMGaLH~-GHlsLI~~A~~--~~~~vivSIFVNP--~QF~~~eD~~~YPr~~~   76 (280)
T pfam02569         9 DLRQFRKELREEGKRIGFVP-------TMGALHE-GHLSLIDRARK--ENDVVVVSIFVNP--TQFGPNEDLDAYPRTLE   76 (280)
T ss_pred             HHHHHHHHHHHCCCCEEEEC-------CCCHHHH-HHHHHHHHHHH--HCCEEEEEEEECC--CCCCCCCHHHHCCCCHH
T ss_conf             99999999997499099984-------8731658-99999999997--5991999996163--13698630432799879


Q ss_pred             HHHHHHHHCCCCEE
Q ss_conf             47999974066146
Q gi|254780438|r  145 HSLQAAKLTGADCI  158 (261)
Q Consensus       145 ~~i~~a~~~Gad~V  158 (261)
                      .+++.+++.|+|.|
T Consensus        77 ~D~~ll~~~~vD~v   90 (280)
T pfam02569        77 RDLALLEKEGVDIV   90 (280)
T ss_pred             HHHHHHHHCCCCEE
T ss_conf             99999998699899


No 143
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed
Probab=59.43  E-value=16  Score=18.15  Aligned_cols=183  Identities=10%  Similarity=0.132  Sum_probs=108.2

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCC-CCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEECCCCCC
Q ss_conf             9999999974998999824788334888999998874000-136741588834856899999850721289710165553
Q gi|254780438|r   27 VHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDE-QFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQL  105 (261)
Q Consensus        27 ~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~-~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~r~el  105 (261)
                      ..+..-|++.++..|--.-....+|...+-+..+...... ..-.+-+++-=..+-+.+.-+++.-=+.|-+=       
T Consensus        32 ~Avi~AAee~~sPvIlq~s~~~~~~~g~~~~~~~~~~~a~~~~VPV~lHLDH~~~~e~~~~ai~~GftSVM~D-------  104 (284)
T PRK12737         32 QVVVETAAELRSPVILAGTPGTISYAGADYIIAIAEVAARKYNIPLALHLDHHEDLDDIKKKVRAGIRSVMID-------  104 (284)
T ss_pred             HHHHHHHHHHCCCEEEECCHHHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEEEEE-------
T ss_conf             9999999997899899967538877799999999999999879999998899999999999998199879870-------


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCCCEE--------------------EEEECCCCCCHHHHHHHHCCCCEEEECCCCC
Q ss_conf             33578221333788999998620269638--------------------9972544441479999740661465112111
Q gi|254780438|r  106 TSDHGWDFLQNQALLTKTVARLHNLGSRI--------------------SLFADGNGNEHSLQAAKLTGADCIELYTGPY  165 (261)
Q Consensus       106 TTegGldv~~~~~~L~~~i~~l~~~girv--------------------SLFIDpd~~q~~i~~a~~~Gad~VElhTG~Y  165 (261)
                        -.-|.+..|-..-+.+++..+..|+-|                    ++|-||  ++ ..+...++|+|+.-.=-|.-
T Consensus       105 --gS~lp~eeNi~~T~~vv~~Ah~~gv~VEaElG~igg~ed~~~~~~~~~~~T~p--ee-a~~Fv~~TgvD~LAvaiGt~  179 (284)
T PRK12737        105 --GSHLSFEENIAIVKEVVEFCHRYDASVEAELGRLGGQEDDLVVDEKDAMYTNP--DA-AAEFVERTGIDSLAVAIGTA  179 (284)
T ss_pred             --CCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCHHHCCCH--HH-HHHHHHHHCCCEEEECCCCC
T ss_conf             --99999999999999999986452886999631125767776666411131799--99-99999996989870003753


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHH
Q ss_conf             0244435643366688999876654156235207898987799999736996388425999
Q gi|254780438|r  166 GACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAF  226 (261)
Q Consensus       166 a~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHai  226 (261)
                      =-.|...  ...-++.+++..+ +...-|-.|-|.|+.-+.+...++  -+|.-+|||--+
T Consensus       180 HG~yk~~--p~L~~d~L~~I~~-~~~iPLVLHGgSG~~~e~i~~ai~--~Gi~KiNi~T~l  235 (284)
T PRK12737        180 HGLYKGE--PKLDFDRLEEIRE-KVSIPLVLHGASGVPDEDVKKAIS--LGICKVNVATEL  235 (284)
T ss_pred             CCCCCCC--CCCCHHHHHHHHH-HCCCCEEEECCCCCCHHHHHHHHH--CCEEEEEECHHH
T ss_conf             5675999--8578999999998-639998966899999999999997--795899858589


No 144
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism]
Probab=58.92  E-value=14  Score=18.49  Aligned_cols=110  Identities=21%  Similarity=0.209  Sum_probs=54.3

Q ss_pred             HHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEC------CCCCCHHHHHHHHCCCCEEE
Q ss_conf             998507212897101655533357822133378899999862026963899725------44441479999740661465
Q gi|254780438|r   86 LCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFAD------GNGNEHSLQAAKLTGADCIE  159 (261)
Q Consensus        86 ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFID------pd~~q~~i~~a~~~Gad~VE  159 (261)
                      ...+..|+..-+|=+.++..=++..|+.....    +..+.+.=--.-|.-|-.      -+...+-|.+.+++|..+||
T Consensus       108 ~~~~~~p~~aS~v~~~~~y~W~d~~~~~~~~~----~~~e~~vIYElHvGs~~~~~~~~~~e~a~~llpYl~elG~T~IE  183 (628)
T COG0296         108 RRQEVGPHTASQVVDLPDYEWQDERWDRAWRG----RFWEPIVIYELHVGSFTPDRFLGYFELAIELLPYLKELGITHIE  183 (628)
T ss_pred             HCCCCCCCCCCEECCCCCCCCCCCCCCCCCCC----CCCCCCEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCEEE
T ss_conf             20588999850664777731465444423468----77787269999765035887767899999875899970987799


Q ss_pred             EC---------------CCCCHH--HHHHHHHHHHHHHHHHHHHHHHHHCCCEEE----------ECCCCCHHH
Q ss_conf             11---------------211102--444356433666889998766541562352----------078989877
Q gi|254780438|r  160 LY---------------TGPYGA--CYNNPQQERIFLNKLAITAQLAQKMDLQIN----------AGHDLTIQN  206 (261)
Q Consensus       160 lh---------------TG~Ya~--a~~~~~~~~~el~~i~~aa~~A~~lgL~Vn----------AGHgLn~~N  206 (261)
                      |=               ||.||-  .|..++    .|+++   ...||+.||+|=          .||+|..-.
T Consensus       184 LMPv~e~p~~~sWGYq~~g~yAp~sryGtPe----dfk~f---VD~aH~~GIgViLD~V~~HF~~d~~~L~~fd  250 (628)
T COG0296         184 LMPVAEHPGDRSWGYQGTGYYAPTSRYGTPE----DFKAL---VDAAHQAGIGVILDWVPNHFPPDGNYLARFD  250 (628)
T ss_pred             ECCCCCCCCCCCCCCCCCEECCCCCCCCCHH----HHHHH---HHHHHHCCCEEEEEECCCCCCCCCCHHHHCC
T ss_conf             7144357988887777430015655679989----99999---9999876998999755776898743163428


No 145
>TIGR01163 rpe ribulose-phosphate 3-epimerase; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5.1.3.1 from EC) (also known as pentose-5-phosphate 3-epimerase or PPE) is the enzyme that converts D-ribulose 5-phosphate into D-xylulose 5-phosphate in Calvin's reductive pentose phosphate cycle. In Alcaligenes eutrophus two copies of the gene coding for PPE are known , one is chromosomally encoded P40117 from SWISSPROT, the other one is on a plasmid Q04539 from SWISSPROT. PPE has been found in a wide range of bacteria, archaebacteria, fungi and plants. All the proteins have from 209 to 241 amino acid residues. The enzyme has a TIM barrel structure.; GO: 0004750 ribulose-phosphate 3-epimerase activity, 0005975 carbohydrate metabolic process.
Probab=57.96  E-value=17  Score=17.98  Aligned_cols=126  Identities=24%  Similarity=0.264  Sum_probs=78.3

Q ss_pred             CHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH--HHHHHHHHHCCCEEEEEECCC
Q ss_conf             989999999974998999824788334888999998874000136741588834856--899999850721289710165
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE--TFLNLCERYKPEQITLVPDDP  102 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~--e~i~ia~~ikP~qvtLVPe~r  102 (261)
                      +|-++...=.++|||-||+|+ |=.+|+. +=+..||+.      ...==+=-||..  ++++-++.. =|.|=|==-.|
T Consensus        69 ~pd~~~~~Fa~aGA~~I~vH~-Ea~~h~~-R~l~~Ik~~------G~~AG~v~NP~TPl~~~~~~L~~-~D~VLlMSVnP  139 (216)
T TIGR01163        69 NPDRYIEDFAEAGADIITVHA-EATEHIH-RLLQLIKEL------GAKAGIVLNPATPLEALEYVLED-VDLVLLMSVNP  139 (216)
T ss_pred             CHHHHHHHHHHHCCCEEEEEC-CCCCCHH-HHHHHHHHC------CCCEEEEECCCCCHHHHHHHHHH-CCEEEEEEEEC
T ss_conf             857778899970899899843-7762679-999999971------89706886799998789989876-29899887607


Q ss_pred             CCCCCCCCCCHH-HHHHHHHHHHHHHC--CCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCC
Q ss_conf             553335782213-33788999998620--2696389972544441479999740661465112111
Q gi|254780438|r  103 HQLTSDHGWDFL-QNQALLTKTVARLH--NLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY  165 (261)
Q Consensus       103 ~elTTegGldv~-~~~~~L~~~i~~l~--~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Y  165 (261)
                      +    =||=-+. .-.++++.+=+-++  ..+-.+-|.||-..++.++..+.+-|||++  =+|.|
T Consensus       140 G----FgGQkFIP~~~~Kir~~R~~id~~~~~~~~~ieVDGGv~~~ni~~~~~AGAD~~--VaGSa  199 (216)
T TIGR01163       140 G----FGGQKFIPETLEKIRELRKMIDKLELGLSILIEVDGGVNEDNIAEVAEAGADIL--VAGSA  199 (216)
T ss_pred             C----CCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHCCCCEE--EEEEE
T ss_conf             9----988411057899999999999860279955899717989767999997589899--98310


No 146
>COG0284 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism]
Probab=57.74  E-value=15  Score=18.35  Aligned_cols=72  Identities=19%  Similarity=0.194  Sum_probs=36.3

Q ss_pred             CCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEC------CCCCCHHHHHHHH
Q ss_conf             8568999998507212897101655533357822133378899999862026963899725------4444147999974
Q gi|254780438|r   79 PNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFAD------GNGNEHSLQAAKL  152 (261)
Q Consensus        79 p~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFID------pd~~q~~i~~a~~  152 (261)
                      +.++-++++.++.| .+|.|=---+.+++.|..           +++.|++.+-  .+|.|      |+......+.+.+
T Consensus        22 ~~~~~~~~~~~~~~-~~~~~Kvg~~l~~~~g~~-----------~~~el~~~~~--~VflDlK~~DIpnT~~~~~~~~~~   87 (240)
T COG0284          22 TEEEALAFVDKLGP-TVDFVKVGKPLVAFFGAD-----------ILEELKARGK--KVFLDLKLADIPNTVALAAKAAAD   87 (240)
T ss_pred             CHHHHHHHHHHHHC-CCCEEEECHHHHHHCCHH-----------HHHHHHHHCC--CEEEEEECCCCHHHHHHHHHHHHH
T ss_conf             77999999997102-031899765889851389-----------9999997077--358741005636799999998654


Q ss_pred             CCCCEEEECCCC
Q ss_conf             066146511211
Q gi|254780438|r  153 TGADCIELYTGP  164 (261)
Q Consensus       153 ~Gad~VElhTG~  164 (261)
                      +|+|.|-.|.-.
T Consensus        88 ~g~d~vtvH~~~   99 (240)
T COG0284          88 LGADAVTVHAFG   99 (240)
T ss_pred             CCCCEEEEECCC
T ss_conf             378489970767


No 147
>pfam00290 Trp_syntA Tryptophan synthase alpha chain.
Probab=57.65  E-value=17  Score=17.95  Aligned_cols=200  Identities=16%  Similarity=0.202  Sum_probs=125.2

Q ss_pred             CCCCCH---HHHHHHHHHCCCCEEEEE-----CCCCCCC------------CCHHHHHHHHHHHCCCCCCCEEEEEECCC
Q ss_conf             868998---999999997499899982-----4788334------------88899999887400013674158883485
Q gi|254780438|r   21 LPWPNL---VHIGKIALQSGASGLTVH-----PRPDQRH------------IRYTDLPEIRRLIDEQFPKAELNIEGYPN   80 (261)
Q Consensus        21 ~~~P~~---~~~a~~~~~~GadgITvH-----~R~DrRH------------I~~~Dv~~l~~~~~~~~~~~elNiEg~p~   80 (261)
                      ..|||+   .++.....++|||-|-+-     |=-|---            ++-+|+.++-+-+...++++|+=+=+|.+
T Consensus        17 aG~P~~~~~~~~i~~l~~~GaDiiEiGiPFSDP~ADGpvIq~A~~~AL~~G~~~~~~~~~~~~~r~~~~~~pivlM~Y~N   96 (258)
T pfam00290        17 AGDPDLETTLEILEALEEAGADAIELGIPFSDPLADGPTIQRANLRALAGGMTLDQTLELVEEIRNKGTSVPIVLMTYYN   96 (258)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCEEEEEECH
T ss_conf             73899899999999999769999997899888766589999999999986996999999999855128998889985208


Q ss_pred             -------HHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHC
Q ss_conf             -------6899999850721289710165553335782213337889999986202696389972544441479999740
Q gi|254780438|r   81 -------ETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLT  153 (261)
Q Consensus        81 -------~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~  153 (261)
                             +.|++-+.+.-=+ -.||||-|-              +...++.+.+++.|+..-.|+-|..++.-++...+.
T Consensus        97 ~i~~~G~e~F~~~~~~~Gvd-GvIipDLP~--------------eE~~~~~~~~~~~~l~~I~lvsPtt~~~Ri~~i~~~  161 (258)
T pfam00290        97 PVLNYGIERFYAQAAEAGVD-GLIIPDLPP--------------EEADPLREAAEKHGIDLIFLVAPTTSDERLKTISEA  161 (258)
T ss_pred             HHHHCCHHHHHHHHHHCCCC-EEECCCCCH--------------HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             89872999999999975997-787079998--------------899999999984584358884588819999999960


Q ss_pred             CCCEEEEC-----CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCC-CHHHHHHHHHHCCCCEEEEEHHHHH
Q ss_conf             66146511-----21110244435643366688999876654156235207898-9877999997369963884259999
Q gi|254780438|r  154 GADCIELY-----TGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDL-TIQNIPNLINAIPYISEISVGHAFA  227 (261)
Q Consensus       154 Gad~VElh-----TG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgL-n~~Nl~~~i~~Ip~I~EvsIGHaiI  227 (261)
                      ....|=+=     ||.-...   .......++++++.      -.+-|-+|-|. +-+-+.. ++  ..-+=|=||-+||
T Consensus       162 s~gFiY~vs~~GvTG~~~~~---~~~~~~~i~~ik~~------t~~Pv~vGFGIs~~e~v~~-~~--~~aDGvIVGSaiv  229 (258)
T pfam00290       162 ASGFVYLVSRAGVTGARNAF---NAQLDELVERLKKY------TNVPVAVGFGISTPEHVKK-IA--AGADGVIVGSAIV  229 (258)
T ss_pred             CCCEEEEEECCCCCCCCCCC---CHHHHHHHHHHHHC------CCCCEEEEECCCCHHHHHH-HH--CCCCEEEECHHHH
T ss_conf             89808998534456765556---38899999999860------6998489945799999999-98--1599999849999


Q ss_pred             HHHHHHHHHH------HHHHHHHHHHH
Q ss_conf             9999940999------99999999974
Q gi|254780438|r  228 ATALECGVKE------AVFCFRRACGQ  248 (261)
Q Consensus       228 seAl~~GL~~------aI~~~~~ii~~  248 (261)
                       +.+.-+.++      .|.+|.+-++.
T Consensus       230 -~~i~~~~~~~~~~~~~v~~fv~~lk~  255 (258)
T pfam00290       230 -DIIEENLDDPEQMLAKLEEFVGKLKA  255 (258)
T ss_pred             -HHHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             -99997040688999999999999999


No 148
>pfam03129 HGTP_anticodon Anticodon binding domain. This domain is found in histidyl, glycyl, threonyl and prolyl tRNA synthetases it is probably the anticodon binding domain.
Probab=57.14  E-value=18  Score=17.89  Aligned_cols=56  Identities=18%  Similarity=0.210  Sum_probs=39.8

Q ss_pred             EEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEE
Q ss_conf             289710165553335782213337889999986202696389972544441479999740661465
Q gi|254780438|r   94 QITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIE  159 (261)
Q Consensus        94 qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VE  159 (261)
                      ||.+||=...          ....++-..+.+.|++.|++|.+-.....-.+.+..|-..|+..+=
T Consensus         1 qV~Vipi~~~----------~~~~~~a~~i~~~Lr~~gi~v~~d~~~~~~~~k~~~a~~~g~p~~i   56 (93)
T pfam03129         1 QVVVIPLGEK----------DELEDYAQKLAEELREAGIRVELDDRNESLGKKFRDADLIGIPFRL   56 (93)
T ss_pred             CEEEEEECCC----------HHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHCCCEEE
T ss_conf             9999982286----------7689999999999987899799988999978999989870999078


No 149
>cd01017 AdcA Metal binding protein AcdA.  These proteins have been shown to function in the ABC uptake of Zn2+ and Mn2+ and in competence for genetic transformation and adhesion.  The AcdA proteins belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  They are comprised of two globular subdomains connected by a long alpha helix and they bind their ligand in the cleft between these domains.  In addition, many of these proteins have a low complexity region containing metal binding histidine-rich motif (repetitive HDH sequence).
Probab=57.04  E-value=18  Score=17.88  Aligned_cols=44  Identities=23%  Similarity=0.267  Sum_probs=23.3

Q ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHH-HHHCCCCEEEEC
Q ss_conf             788999998620269638997254444147999-974066146511
Q gi|254780438|r  117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQA-AKLTGADCIELY  161 (261)
Q Consensus       117 ~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~-a~~~Gad~VElh  161 (261)
                      ...+..+++.+++.+++ .+|++|..+.+.++. ++++|+..++|.
T Consensus       206 ~~~l~~l~~~ik~~~v~-~If~e~~~~~~~~~~ia~e~g~~v~~l~  250 (282)
T cd01017         206 PKQLAELVEFVKKSDVK-YIFFEENASSKIAETLAKETGAKLLVLN  250 (282)
T ss_pred             HHHHHHHHHHHHHCCCC-EEEEECCCCCHHHHHHHHHHCCCEEEEC
T ss_conf             99999999999985998-9998189990999999998199678544


No 150
>pfam04055 Radical_SAM Radical SAM superfamily. Radical SAM proteins catalyse diverse reactions, including unusual methylations, isomerisation, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation.
Probab=56.98  E-value=18  Score=17.88  Aligned_cols=82  Identities=17%  Similarity=0.130  Sum_probs=47.6

Q ss_pred             CCCCEEEEEECCCC-CCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCE--EEECCCCCHH
Q ss_conf             26963899725444-41479999740661465112111024443564336668899987665415623--5207898987
Q gi|254780438|r  129 NLGSRISLFADGNG-NEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQ--INAGHDLTIQ  205 (261)
Q Consensus       129 ~~girvSLFIDpd~-~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~--VnAGHgLn~~  205 (261)
                      ..+.++++...+.. +...++..++.|.+.|.+.=..........-.....++.+.++.+.+++.|+.  +..-.++..+
T Consensus        74 ~~~~~~~~~t~~~~~~~~~~~~l~~~g~~~i~~~ie~~~~~~~~~~~~~~~~~~~~~~i~~~~~~gi~~~~~~i~~~~~e  153 (165)
T pfam04055        74 LEGIRITLETNGTLLDEELLEELKEAGLDRVSISLQSGDDEVLKIINRGHTFEEVLEALELLREAGIPVVVDNIVGLPGE  153 (165)
T ss_pred             CCCEEEEEEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCC
T ss_conf             67648999985143310456899971985222463559999999857999989999999999987997889999979999


Q ss_pred             HHHHH
Q ss_conf             79999
Q gi|254780438|r  206 NIPNL  210 (261)
Q Consensus       206 Nl~~~  210 (261)
                      |...+
T Consensus       154 ~~~~~  158 (165)
T pfam04055       154 NDEDL  158 (165)
T ss_pred             CHHHH
T ss_conf             99999


No 151
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase; InterPro: IPR011981    This enzyme catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate. 4-hydroxyphenylacetate arises from the degradation of tyrosine. The substrate, 3,4-dihydroxyphenylacetate (homoprotocatechuate) arises from the action of a hydroxylase on 4-hydroxyphenylacetate. The aromatic ring is opened by this dioxygenase exo to the 3,4-diol resulting in 2-hydroxy-5-carboxymethylmuconate semialdehyde..
Probab=56.81  E-value=4.6  Score=21.94  Aligned_cols=11  Identities=64%  Similarity=0.890  Sum_probs=5.4

Q ss_pred             CEEEECCCCCH
Q ss_conf             14651121110
Q gi|254780438|r  156 DCIELYTGPYG  166 (261)
Q Consensus       156 d~VElhTG~Ya  166 (261)
                      .||||||+.|-
T Consensus       265 hRIElYt~DY~  275 (312)
T TIGR02295       265 HRIELYTGDYL  275 (312)
T ss_pred             CEEEEECCCCE
T ss_conf             78999828822


No 152
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism]
Probab=56.59  E-value=18  Score=17.83  Aligned_cols=197  Identities=13%  Similarity=0.179  Sum_probs=95.1

Q ss_pred             CHHHHHHHHHHCCCCEEEEECCC----CCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEEC
Q ss_conf             98999999997499899982478----83348889999988740001367415888348568999998507212897101
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTVHPRP----DQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPD  100 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITvH~R~----DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe  100 (261)
                      .+-+-.+.++++|||.|-+-.=-    ..=-+-+.=+..|++..  .+ .....+=-.+-+.+++-..+..|+++|+=+|
T Consensus        17 ~l~~el~~~~~agad~iH~DVMDghFVPNiTfGp~~v~~l~~~t--~~-p~DvHLMV~~p~~~i~~fa~agad~It~H~E   93 (220)
T COG0036          17 RLGEELKALEAAGADLIHIDVMDGHFVPNITFGPPVVKALRKIT--DL-PLDVHLMVENPDRYIEAFAKAGADIITFHAE   93 (220)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHCC--CC-CEEEEEECCCHHHHHHHHHHHCCCEEEEEEC
T ss_conf             79999999997699879996457876787334899999886368--97-3589973289899999999819998999712


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             65553335782213337889999986202696389972544441479999740661465112111024443564336668
Q gi|254780438|r  101 DPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN  180 (261)
Q Consensus       101 ~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~  180 (261)
                           .|+|          +..+++.+|+.|++..+-+.|......++.-. --+|.|=+-|=.=.  |...+....-++
T Consensus        94 -----~~~~----------~~r~i~~Ik~~G~kaGv~lnP~Tp~~~i~~~l-~~vD~VllMsVnPG--fgGQ~Fi~~~l~  155 (220)
T COG0036          94 -----ATEH----------IHRTIQLIKELGVKAGLVLNPATPLEALEPVL-DDVDLVLLMSVNPG--FGGQKFIPEVLE  155 (220)
T ss_pred             -----CCCC----------HHHHHHHHHHCCCEEEEEECCCCCHHHHHHHH-HHCCEEEEEEECCC--CCCCCCCHHHHH
T ss_conf             -----7768----------99999999975985779978999778999898-65789999857799--866314799999


Q ss_pred             HHHHHHHHHHHC-CCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             899987665415-6235207898987799999736996388425999999999409999999999997
Q gi|254780438|r  181 KLAITAQLAQKM-DLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACG  247 (261)
Q Consensus       181 ~i~~aa~~A~~l-gL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~  247 (261)
                      |+++.-++..+. ...+-.-=|.|.+|++. +.. -+.+=+=.|-++....=   ++++++.++....
T Consensus       156 Ki~~lr~~~~~~~~~~IeVDGGI~~~t~~~-~~~-AGad~~VaGSalF~~~d---~~~~i~~~~~~~~  218 (220)
T COG0036         156 KIRELRAMIDERLDILIEVDGGINLETIKQ-LAA-AGADVFVAGSALFGADD---YKATIRELRGELL  218 (220)
T ss_pred             HHHHHHHHHCCCCCEEEEEECCCCHHHHHH-HHH-CCCCEEEEEEEEECCCC---HHHHHHHHHHHHH
T ss_conf             999999974024775999968969888999-997-39999999777867811---9999999998762


No 153
>cd01966 Nitrogenase_NifN_1 Nitrogenase_nifN1: A subgroup of the NifN subunit of the NifEN complex: NifN forms an alpha2beta2 tetramer with NifE.  NifN and nifE are structurally homologous to nitrogenase MoFe protein beta and alpha subunits respectively.  NifEN participates in the synthesis of the iron-molybdenum cofactor (FeMoco) of the MoFe protein.  NifB-co (an iron and sulfur containing precursor of the FeMoco) from NifB is transferred to the NifEN complex where it is further processed to FeMoco. The nifEN bound precursor of FeMoco has been identified as a molybdenum-free, iron- and sulfur- containing analog of FeMoco. It has been suggested that this nifEN bound precursor also acts as a cofactor precursor in nitrogenase systems which require a cofactor other than FeMoco: i.e. iron-vanadium cofactor (FeVco) or iron only cofactor (FeFeco).
Probab=56.25  E-value=18  Score=17.80  Aligned_cols=197  Identities=14%  Similarity=0.155  Sum_probs=94.5

Q ss_pred             CHHHHHHHHHHCCCCEEEE---------ECCCCCCCCCHHH--HHHHHHHHCCCCCCCEEEEEECCC-------------
Q ss_conf             9899999999749989998---------2478833488899--999887400013674158883485-------------
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTV---------HPRPDQRHIRYTD--LPEIRRLIDEQFPKAELNIEGYPN-------------   80 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITv---------H~R~DrRHI~~~D--v~~l~~~~~~~~~~~elNiEg~p~-------------   80 (261)
                      |+-+.-.+....|.+-+.+         |+.++...+..-+  +.+++.+-     +-.+||...++             
T Consensus       172 Dl~eik~ll~~~Gl~~~ilpD~s~~lDg~~~~~~~~~~~Ggt~~~ei~~~~-----~A~~~i~~~~~~~~~a~~L~~~~g  246 (417)
T cd01966         172 DVEELKDIIEAFGLEPIILPDLSGSLDGHLADDWSPTTTGGTTLEDIRQMG-----RSAATLAIGESMRKAAEALEERTG  246 (417)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHC-----CCCEEEEECHHHHHHHHHHHHHHC
T ss_conf             799999999982995698236534557787777344579998699998651-----280778866888999999999979


Q ss_pred             ---------------HHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCC--CCCEEEEEECCCCC
Q ss_conf             ---------------6899999850721289710165553335782213337889999986202--69638997254444
Q gi|254780438|r   81 ---------------ETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHN--LGSRISLFADGNGN  143 (261)
Q Consensus        81 ---------------~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~--~girvSLFIDpd~~  143 (261)
                                     ++|+.-+.++-=..   |||+           +.....+|.+.....+.  .|-|+.+|-|||..
T Consensus       247 iP~~~~~~p~G~~~Td~fl~~l~~~~G~~---vpe~-----------~~~er~rl~da~~d~h~~l~gkrvai~gd~d~~  312 (417)
T cd01966         247 VPYYVFPSLTGLEAVDALIATLAKLSGRP---VPEK-----------IRRQRAQLQDAMLDGHFYLGGKRVAIALEPDLL  312 (417)
T ss_pred             CCEEECCCCCCHHHHHHHHHHHHHHHCCC---CCHH-----------HHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHH
T ss_conf             98383078615587899999999982899---8499-----------999999999999999998569779998771699


Q ss_pred             CHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEH
Q ss_conf             14799997406614651121110244435643366688999876654156235207898987799999736996388425
Q gi|254780438|r  144 EHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVG  223 (261)
Q Consensus       144 q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIG  223 (261)
                      --...+..|+|..-+-.-|+.-...+.+-.........+.+.-..+...-|-+  ||.-... ++. -..+|.+   .+|
T Consensus       313 ~~l~~fL~ElG~~~~~~~~~~~~~~~~~~~~~~v~~gDl~~le~~~~~~dlii--g~s~~~~-~A~-~~~ipll---r~g  385 (417)
T cd01966         313 AALSSFLAEMGAEIVAAVATTDSPALEKLPAEEVVVGDLEDLEDLAAEADLLV--TNSHGRQ-AAE-RLGIPLL---RAG  385 (417)
T ss_pred             HHHHHHHHHCCCEEEEEEECCCCHHHHHCCCCEEEECCHHHHHHHCCCCCEEE--ECCCHHH-HHH-HCCCCEE---EEC
T ss_conf             99999999789988899978998577737657265078899984178999999--5873689-999-8499989---926


Q ss_pred             HHHH-----HHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999-----99999409999999999997
Q gi|254780438|r  224 HAFA-----ATALECGVKEAVFCFRRACG  247 (261)
Q Consensus       224 HaiI-----seAl~~GL~~aI~~~~~ii~  247 (261)
                      .-+.     -+..+.|.+-++.-..++.+
T Consensus       386 fPi~Dr~g~~~~~~~GY~G~~~Ll~~I~N  414 (417)
T cd01966         386 FPIFDRLGAAHKCTIGYRGTRDLLFEIAN  414 (417)
T ss_pred             CCHHHCCCCCCCCEECHHHHHHHHHHHHH
T ss_conf             97042057546631456779999999988


No 154
>PRK04101 fosfomycin resistance protein FosB; Provisional
Probab=56.22  E-value=18  Score=17.79  Aligned_cols=63  Identities=19%  Similarity=0.236  Sum_probs=38.2

Q ss_pred             CCCEEEEEECCC---CCCCC---CCCCCHHHHHHHHHHHHHHHCCCCCEE------------EE-EECCCCCCHHHHHHH
Q ss_conf             721289710165---55333---578221333788999998620269638------------99-725444414799997
Q gi|254780438|r   91 KPEQITLVPDDP---HQLTS---DHGWDFLQNQALLTKTVARLHNLGSRI------------SL-FADGNGNEHSLQAAK  151 (261)
Q Consensus        91 kP~qvtLVPe~r---~elTT---egGldv~~~~~~L~~~i~~l~~~girv------------SL-FIDpd~~q~~i~~a~  151 (261)
                      ...+++|..++.   .+.++   --.+.|.  ...+....++|++.|+.+            |+ |-|||-         
T Consensus        43 gg~~l~l~~~~~ip~~~~~~~~~HiAF~V~--~~dl~~~~~~L~~~gV~i~~~~~~~~~~g~SiYF~DPDG---------  111 (139)
T PRK04101         43 NGLWIALNEEKDIPRNEIHQSYTHIAFSIE--EEDFEYWYQRLKENDVNILEGRERDVRDRKSIYFTDPDG---------  111 (139)
T ss_pred             CCEEEEEECCCCCCCCCCCCCCEEEEEEEC--HHHHHHHHHHHHHCCCEECCCCCCCCCCCEEEEEECCCC---------
T ss_conf             980999522789998777888307999935--898999999999879867068611579952999998999---------


Q ss_pred             HCCCCEEEECCCCCHHH
Q ss_conf             40661465112111024
Q gi|254780438|r  152 LTGADCIELYTGPYGAC  168 (261)
Q Consensus       152 ~~Gad~VElhTG~Ya~a  168 (261)
                          ..+|||||+.+.-
T Consensus       112 ----h~lElh~g~l~~r  124 (139)
T PRK04101        112 ----HKFEFHTGTLQDR  124 (139)
T ss_pred             ----CEEEEEECCHHHH
T ss_conf             ----9899970989999


No 155
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain.  DHPD catalyzes the first step in pyrimidine degradation: the NADPH-dependent reduction of uracil and thymine to the corresponding 5,6-dihydropyrimidines. DHPD contains two FAD, two FMN, and eight [4Fe-4S] clusters, arranged in two electron transfer chains that pass the dimer interface twice. Two of the Fe-S clusters show a hitherto unobserved coordination involving a glutamine residue.
Probab=56.18  E-value=12  Score=19.13  Aligned_cols=81  Identities=19%  Similarity=0.187  Sum_probs=32.2

Q ss_pred             CHHHHHHHHHHC---CCEEEEEECCCCCCC-CCCCCCHHHHHHHHHHHHHHHCCC-CCEEEEEECCCCCC--HHHHHHHH
Q ss_conf             568999998507---212897101655533-357822133378899999862026-96389972544441--47999974
Q gi|254780438|r   80 NETFLNLCERYK---PEQITLVPDDPHQLT-SDHGWDFLQNQALLTKTVARLHNL-GSRISLFADGNGNE--HSLQAAKL  152 (261)
Q Consensus        80 ~~e~i~ia~~ik---P~qvtLVPe~r~elT-TegGldv~~~~~~L~~~i~~l~~~-girvSLFIDpd~~q--~~i~~a~~  152 (261)
                      .+++.+++..+.   .+.+.|===-|+... .+.|.++..+.+.+..+++.+++. .+.+.+=+-||.+.  ...+++.+
T Consensus       112 ~~~~~~~a~~~~~~gad~lElNiScPN~~~~~~~g~~~~~~~~~l~~i~~~v~~~~~~Pi~vKLsP~~~~i~~ia~~~~~  191 (299)
T cd02940         112 KEDWTELAKLVEEAGADALELNFSCPHGMPERGMGAAVGQDPELVEEICRWVREAVKIPVIAKLTPNITDIREIARAAKE  191 (299)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
T ss_conf             78999999999871888899826788987612345552449999999999998624786489628871549999999998


Q ss_pred             CCCCEEEE
Q ss_conf             06614651
Q gi|254780438|r  153 TGADCIEL  160 (261)
Q Consensus       153 ~Gad~VEl  160 (261)
                      .|+|.|=+
T Consensus       192 ~gadgiv~  199 (299)
T cd02940         192 GGADGVSA  199 (299)
T ss_pred             CCCCEEEE
T ss_conf             59989999


No 156
>PRK08208 coproporphyrinogen III oxidase; Validated
Probab=55.98  E-value=18  Score=17.77  Aligned_cols=104  Identities=14%  Similarity=0.200  Sum_probs=62.1

Q ss_pred             CHHHHHHHHHHHCCCC----CCCEEEEEECCC---HHHHHHHHHHCCCEEEE-----EECCCCCCCCCCCCCHHHHHHHH
Q ss_conf             8899999887400013----674158883485---68999998507212897-----10165553335782213337889
Q gi|254780438|r   53 RYTDLPEIRRLIDEQF----PKAELNIEGYPN---ETFLNLCERYKPEQITL-----VPDDPHQLTSDHGWDFLQNQALL  120 (261)
Q Consensus        53 ~~~Dv~~l~~~~~~~~----~~~elNiEg~p~---~e~i~ia~~ikP~qvtL-----VPe~r~elTTegGldv~~~~~~L  120 (261)
                      .++.+..|-..+...|    ...|+.+|++|.   .+.+....+.-=+.+.|     .|+.-..+--.|      ..+..
T Consensus       112 ~~~~l~~ll~~l~~~f~~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvNRiSlGVQsf~~~~L~~lgR~h------~~~~~  185 (436)
T PRK08208        112 NIAQLEKLFFSVFDVLGVDLWNIPKSVETSPTTTTAEKLALLNAFGVNRVSIGVQSFHDSELHALHRRQ------NAASV  185 (436)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHCCCC------CHHHH
T ss_conf             999999999999985899846715999866363609999999973987278741448989999846889------99999


Q ss_pred             HHHHHHHCCCCC-EEEE-EECCCCCC------HHHHHHHHCCCCEEEECC
Q ss_conf             999986202696-3899-72544441------479999740661465112
Q gi|254780438|r  121 TKTVARLHNLGS-RISL-FADGNGNE------HSLQAAKLTGADCIELYT  162 (261)
Q Consensus       121 ~~~i~~l~~~gi-rvSL-FIDpd~~q------~~i~~a~~~Gad~VElhT  162 (261)
                      ...++.+++.|+ .||+ +|---|.|      .+|+.+.+++++.|-+|.
T Consensus       186 ~~ai~~~r~~gf~niniDLIyGlPgQt~~~~~~~l~~~l~l~p~HIS~Y~  235 (436)
T PRK08208        186 HQALELIRAAHFPSLNIDLIYGIPGQTHASFMESLHQALVYRPEELFLYP  235 (436)
T ss_pred             HHHHHHHHHCCCCEEEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEECCC
T ss_conf             99999999819985755244369999999999999999827989898763


No 157
>TIGR02660 nifV_homocitr homocitrate synthase; InterPro: IPR013477    Most NifV-type homocitrate synthases are encoded within operons for nitrogen fixation. They are homologous to enzymes that include 2-isopropylmalate synthase, (R)-citramalate synthase, and homocitrate synthases associated with other processes. The homocitrate made by these enzymes becomes a part of the iron-molybdenum cofactor of nitrogenase.; GO: 0004410 homocitrate synthase activity, 0051188 cofactor biosynthetic process.
Probab=55.91  E-value=18  Score=17.76  Aligned_cols=102  Identities=16%  Similarity=0.108  Sum_probs=46.7

Q ss_pred             EECCCCCCCCCCCCC-HHHHHHHHHHHHHHHCCCCCEEEEEEC------CCCCCHHHHHHHHCCCCEEEECCCCCHHHHH
Q ss_conf             101655533357822-133378899999862026963899725------4444147999974066146511211102444
Q gi|254780438|r   98 VPDDPHQLTSDHGWD-FLQNQALLTKTVARLHNLGSRISLFAD------GNGNEHSLQAAKLTGADCIELYTGPYGACYN  170 (261)
Q Consensus        98 VPe~r~elTTegGld-v~~~~~~L~~~i~~l~~~girvSLFID------pd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~  170 (261)
                      ||-...++-.=.+=| -..-.+.++..|..=++.|.+||+=-+      |++=+.-++.|++.||+|.     -||+-..
T Consensus        93 ~PvSd~~~~~KL~~~Cr~w~~~~~~~~V~~A~~~Gl~VsVG~EDASRAd~~FL~~~~~~A~~aGA~Rf-----RfADTvG  167 (369)
T TIGR02660        93 IPVSDLQIEAKLRKDCRAWVLERLARLVSFARDRGLEVSVGGEDASRADPEFLVELAEVAQEAGADRF-----RFADTVG  167 (369)
T ss_pred             CCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHHHHHHHHCCCCCC-----CHHHHCC
T ss_conf             27779999997488578999999999999987644203105625545888899999999987063110-----1431202


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHH
Q ss_conf             356433666889998766541562352078989877
Q gi|254780438|r  171 NPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQN  206 (261)
Q Consensus       171 ~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~N  206 (261)
                      ==..... ++++ .+-.-+-++.|++||==||=+=+
T Consensus       168 ~LDPF~~-~~~~-~~Lr~~~~l~lE~HaHnDlGmAT  201 (369)
T TIGR02660       168 ILDPFST-YELV-RALRQAVDLPLEFHAHNDLGMAT  201 (369)
T ss_pred             CCCHHHH-HHHH-HHHHHCCCCCEEEEEECCHHHHH
T ss_conf             2572789-9999-99872179962585047634799


No 158
>pfam03102 NeuB NeuB family. NeuB is the prokaryotic N-acetylneuraminic acid (Neu5Ac) synthase. It catalyses the direct formation of Neu5Ac (the most common sialic acid) by condensation of phosphoenolpyruvate (PEP) and N-acetylmannosamine (ManNAc). This reaction has only been observed in prokaryotes; eukaryotes synthesize the 9-phosphate form, Neu5Ac-9-P, and utilize ManNAc-6-P instead of ManNAc. Such eukaryotic enzymes are not present in this family. This family also contains SpsE spore coat polysaccharide biosynthesis proteins.
Probab=55.46  E-value=19  Score=17.71  Aligned_cols=16  Identities=19%  Similarity=0.289  Sum_probs=10.6

Q ss_pred             HHHHHCCCCEEEEECC
Q ss_conf             9999749989998247
Q gi|254780438|r   31 KIALQSGASGLTVHPR   46 (261)
Q Consensus        31 ~~~~~~GadgITvH~R   46 (261)
                      ..|.++|||.+-...|
T Consensus         3 ~~Ak~sGADaVKFQ~~   18 (240)
T pfam03102         3 DAAAEAGADAVKFQTF   18 (240)
T ss_pred             HHHHHHCCCEEEEECC
T ss_conf             8999819899998146


No 159
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDP is a member of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.
Probab=55.11  E-value=19  Score=17.67  Aligned_cols=178  Identities=16%  Similarity=0.177  Sum_probs=93.3

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEE--EEEEC----CCHHHHHHHHHHCCCEEEEEECC
Q ss_conf             9999999749989998247883348889999988740001367415--88834----85689999985072128971016
Q gi|254780438|r   28 HIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAEL--NIEGY----PNETFLNLCERYKPEQITLVPDD  101 (261)
Q Consensus        28 ~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~el--NiEg~----p~~e~i~ia~~ikP~qvtLVPe~  101 (261)
                      +.|.-+-++|.-|.--.-.- ...-..+.+..+++...     .+|  |+=..    ..+++++++++.+|..|++    
T Consensus        17 ~LaaAvs~aGglG~l~~~~~-~~~~l~~~i~~~~~~~~-----~pfgvnl~~~~~~~~~~~~~~~~~~~~v~~v~~----   86 (236)
T cd04730          17 ELAAAVSNAGGLGFIGAGYL-TPEALRAEIRKIRALTD-----KPFGVNLLVPSSNPDFEALLEVALEEGVPVVSF----   86 (236)
T ss_pred             HHHHHHHHCCCEEEECCCCC-CHHHHHHHHHHHHHHCC-----CCEEECCCCCCCCCCHHHHHHHHHHCCCCEEEE----
T ss_conf             99999996898558578889-99999999999997469-----972443324677636899999999769999998----


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHH--HHHHHH
Q ss_conf             555333578221333788999998620269638997254444147999974066146511211102444356--433666
Q gi|254780438|r  102 PHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ--QERIFL  179 (261)
Q Consensus       102 r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~--~~~~el  179 (261)
                            -+|.        -+++++.+|+.|++|=..+ +.+  +..+.+.+.|+|.|=. .|+=|--+....  .....+
T Consensus        87 ------~~g~--------p~~~v~~l~~~g~~v~~~v-~s~--~~A~~a~~~GaD~iv~-qG~eAGGH~g~~~~~~~~lv  148 (236)
T cd04730          87 ------SFGP--------PAEVVERLKAAGIKVIPTV-TSV--EEARKAEAAGADALVA-QGAEAGGHRGTFDIGTFALV  148 (236)
T ss_pred             ------CCCC--------CHHHHHHHHHCCCEEEEEC-CCH--HHHHHHHHCCCCEEEE-ECCCCCCCCCCCCCCHHHHH
T ss_conf             ------7989--------7899999998299899958-989--9999999818998999-77777778898755567799


Q ss_pred             HHHHHHHHHHHHCCCEEEECCCCC-HHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             889998766541562352078989-877999997369963884259999999994099999999
Q gi|254780438|r  180 NKLAITAQLAQKMDLQINAGHDLT-IQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF  242 (261)
Q Consensus       180 ~~i~~aa~~A~~lgL~VnAGHgLn-~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~  242 (261)
                      ..+.+.      .++-|=|.=|.- -.-+...++ .. -+=|-+|-.+++- -..+.....|++
T Consensus       149 ~~v~~~------~~ipviaAGGI~~g~~i~aal~-lG-A~gV~~GTrfl~t-~Es~~~~~~K~~  203 (236)
T cd04730         149 PEVRDA------VDIPVIAAGGIADGRGIAAALA-LG-ADGVQMGTRFLAT-EESGASPAYKQA  203 (236)
T ss_pred             HHHHHH------HCCCEEEECCCCCHHHHHHHHH-HC-CCEEEECCHHHHC-CCCCCCHHHHHH
T ss_conf             999998------2986896546277899999998-08-9799955385708-454799999999


No 160
>KOG0636 consensus
Probab=54.89  E-value=4.9  Score=21.76  Aligned_cols=127  Identities=14%  Similarity=0.167  Sum_probs=87.3

Q ss_pred             CCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHH-CCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHH
Q ss_conf             53322144322322078868998999999997-49989998247883348889999988740001367415888348568
Q gi|254780438|r    4 SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQ-SGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNET   82 (261)
Q Consensus         4 ~LsVNidhiAtLRnaRg~~~P~~~~~a~~~~~-~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e   82 (261)
                      .-++-.||--+=||+-|.+|-+|+.+-...+. ..+++|++-||--.----++|+++=...+.+-++ .++|+-|.|++.
T Consensus       253 H~~~~~~~a~~~k~~l~m~f~~P~~~~~~v~gytke~dipl~~~m~q~~~~~EDv~dP~~tv~si~~-~~l~~sGt~~~~  331 (466)
T KOG0636         253 HFIHGRDHAGPGKNSLGMDFYGPYDAQHLVEGYTKEDDIPLVPFMMQTYLPDEDVYDPEDTVVSIFT-RTLNISGTELRR  331 (466)
T ss_pred             HHCEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCHHHHHHCCCHHHHCCCCCEEEECCC-CCEEECCCCCEE
T ss_conf             0100000368654533466668187653443002135872137784111452431485220455365-420205871402


Q ss_pred             ----------------HHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEE
Q ss_conf             ----------------99999850721289710165553335782213337889999986202696389972
Q gi|254780438|r   83 ----------------FLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFA  138 (261)
Q Consensus        83 ----------------~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFI  138 (261)
                                      ...+--...|     --||++=.--+||  +.+..-...+-+++|+-.+-|+.-.-
T Consensus       332 r~~v~arI~e~~sy~~V~r~~~~~g~-----P~~kq~~~~a~~g--~~k~vLsmAp~le~Lni~~~R~aa~~  396 (466)
T KOG0636         332 RLRVGARIPEWFSYPEVVRILRGSGP-----PTEKQGFYDADHG--ATKKVLSMAPLLERLNILGFRVAAYD  396 (466)
T ss_pred             EEEECCCCCCCCCCCEEEECHHHCCC-----CCCCCCCEECCCC--CCHHEECCCHHHHHHCCCCEEEEEEE
T ss_conf             45303446765555034521211399-----9656774513786--21000130245687522770578874


No 161
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism]
Probab=53.41  E-value=20  Score=17.49  Aligned_cols=108  Identities=22%  Similarity=0.332  Sum_probs=47.1

Q ss_pred             CCHHHHHHHHHHHCCCC----CCCEEEEEECCC---HHHHHHHHHHCCCEEEE-EECCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             88899999887400013----674158883485---68999998507212897-10165553335782213337889999
Q gi|254780438|r   52 IRYTDLPEIRRLIDEQF----PKAELNIEGYPN---ETFLNLCERYKPEQITL-VPDDPHQLTSDHGWDFLQNQALLTKT  123 (261)
Q Consensus        52 I~~~Dv~~l~~~~~~~~----~~~elNiEg~p~---~e~i~ia~~ikP~qvtL-VPe~r~elTTegGldv~~~~~~L~~~  123 (261)
                      ..++++..|-+.+...+    ++.|+-+|.+|+   .++++...+..=+.+-| |=.-..++=--.||  ..+.+.....
T Consensus       101 L~~~~l~~ll~~l~~~~~~~~~~~EitiE~nP~~~~~e~~~~l~~~GvNRiSlGVQsf~~~~lk~lgR--~h~~~~~~~a  178 (416)
T COG0635         101 LSPEQLERLLKALRELFNDLDPDAEITIEANPGTVEAEKFKALKEAGVNRISLGVQSFNDEVLKALGR--IHDEEEAKEA  178 (416)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHHCCCEEEEECCCCCHHHHHHHCC--CCCHHHHHHH
T ss_conf             79999999999999972357888279995088866899999999829877986014599899997478--8878999999


Q ss_pred             HHHHCCCCCEEEEEEC---CCCCC------HHHHHHHHCCCCEEEECC
Q ss_conf             9862026963899725---44441------479999740661465112
Q gi|254780438|r  124 VARLHNLGSRISLFAD---GNGNE------HSLQAAKLTGADCIELYT  162 (261)
Q Consensus       124 i~~l~~~girvSLFID---pd~~q------~~i~~a~~~Gad~VElhT  162 (261)
                      +..+++.|+ .|+=+|   .-|.|      .+++.+.++++|.|-+|-
T Consensus       179 ~~~~~~~g~-~~in~DLIyglP~QT~~~~~~~l~~a~~l~pdhis~y~  225 (416)
T COG0635         179 VELARKAGF-TSINIDLIYGLPGQTLESLKEDLEQALELGPDHLSLYS  225 (416)
T ss_pred             HHHHHHCCC-CCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             999986389-74788724389999999999999999834998786462


No 162
>cd03307 Mta_CmuA_like MtaA_CmuA_like family. MtaA/CmuA, also MtsA, or methyltransferase 2 (MT2) MT2-A and MT2-M isozymes, are methylcobamide:Coenzyme M methyltransferases, which play a role in metabolic pathways of methane formation from various substrates, such as methylated amines and methanol. Coenzyme M, 2-mercaptoethylsulfonate or CoM, is methylated during methanogenesis in a reaction catalyzed by three proteins. A methyltransferase methylates the corrinoid cofactor, which is bound to a second polypeptide, a corrinoid protein. The methylated corrinoid protein then serves as a substrate for MT2-A and related enzymes, which methylate CoM.
Probab=52.71  E-value=21  Score=17.42  Aligned_cols=92  Identities=20%  Similarity=0.191  Sum_probs=41.8

Q ss_pred             HHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEEC-CCCCHHHHHH------------HHH--HHHHHHHHHH
Q ss_conf             999998620269638997254444147999974066146511-2111024443------------564--3366688999
Q gi|254780438|r  120 LTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELY-TGPYGACYNN------------PQQ--ERIFLNKLAI  184 (261)
Q Consensus       120 L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElh-TG~Ya~a~~~------------~~~--~~~el~~i~~  184 (261)
                      ++.+++.++  +..+.+|+--+.. ..++...++|+|++-+. +-+.+.+...            +..  .....+.+++
T Consensus       213 ~~~i~~~i~--~~~~i~h~~G~~~-~~~~~~~~~g~d~is~D~~~~l~~a~~~~~~~~~iqGNldP~~ll~~g~~e~i~~  289 (326)
T cd03307         213 HKKIVKELH--GCPTILHICGNTT-PILEYIAQCGFDGISVDEKVDVKTAKEIVGGRAALIGNVSPSQTLLNGTPEDVKA  289 (326)
T ss_pred             HHHHHHHCC--CCCEEEEECCCHH-HHHHHHHHCCCCEEECCCCCCHHHHHHHCCCCEEEEECCCCHHHHCCCCHHHHHH
T ss_conf             999999658--9982788458758-8999999719989966898999999998089816994288489876799999999


Q ss_pred             HHHHHHHCCC-EEEECCCCC----HHHHHHHHHHC
Q ss_conf             8766541562-352078989----87799999736
Q gi|254780438|r  185 TAQLAQKMDL-QINAGHDLT----IQNIPNLINAI  214 (261)
Q Consensus       185 aa~~A~~lgL-~VnAGHgLn----~~Nl~~~i~~I  214 (261)
                      .+..+-+.|- -+|-|||+.    .+|+..++..+
T Consensus       290 ~~~~~l~~g~~I~nlGhgi~p~tp~env~a~v~av  324 (326)
T cd03307         290 EARKCLEDGVDILAPGCGIAPRTPLANLKAMVEAR  324 (326)
T ss_pred             HHHHHHHCCCCEEECCCCCCCCCCHHHHHHHHHHH
T ss_conf             99999973899558989669998999999999986


No 163
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins. A family of small methanogenic corrinoid proteins that bind methyl-Co(III) 5-hydroxybenzimidazolylcobamide as a cofactor. They play a role on the methanogenesis from trimethylamine, dimethylamine or monomethylamine, which is initiated by a series of corrinoid-dependent methyltransferases.
Probab=52.34  E-value=21  Score=17.38  Aligned_cols=65  Identities=20%  Similarity=0.329  Sum_probs=45.4

Q ss_pred             CCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCC--EEEEEECCCCCCHHHHHHHHCCCC
Q ss_conf             856899999850721289710165553335782213337889999986202696--389972544441479999740661
Q gi|254780438|r   79 PNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGS--RISLFADGNGNEHSLQAAKLTGAD  156 (261)
Q Consensus        79 p~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~gi--rvSLFIDpd~~q~~i~~a~~~Gad  156 (261)
                      |.++|++.+.+.+|+-++|-=            -...+...++.+++.+++.+.  ++-++|---+-.  =+.++.+|||
T Consensus       121 p~e~~v~~~~~~~~divglS~------------~~~~~~~~~~~~i~~lr~~~~~~~v~i~vGG~a~~--~~~a~~~GAD  186 (201)
T cd02070         121 PPEEFVEAVKEHKPDILGLSA------------LMTTTMGGMKEVIEALKEAGLRDKVKVMVGGAPVN--QEFADEIGAD  186 (201)
T ss_pred             CHHHHHHHHHHHCCCEEEEEC------------CCCCCHHHHHHHHHHHHHCCCCCCCEEEEECCCCC--HHHHHHHCCC
T ss_conf             979999999972989999962------------56688999999999999728988985999880179--9999992988


Q ss_pred             E
Q ss_conf             4
Q gi|254780438|r  157 C  157 (261)
Q Consensus       157 ~  157 (261)
                      .
T Consensus       187 ~  187 (201)
T cd02070         187 G  187 (201)
T ss_pred             E
T ss_conf             7


No 164
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed
Probab=52.13  E-value=16  Score=18.25  Aligned_cols=131  Identities=14%  Similarity=0.181  Sum_probs=61.3

Q ss_pred             HHHHHHHHHHCCCEEEEE-ECCCCCCCCCCCCCHHH--HHHHHHHHHHHHCCCCCEE-EEEECCCCCCHHHHHHHHCCCC
Q ss_conf             689999985072128971-01655533357822133--3788999998620269638-9972544441479999740661
Q gi|254780438|r   81 ETFLNLCERYKPEQITLV-PDDPHQLTSDHGWDFLQ--NQALLTKTVARLHNLGSRI-SLFADGNGNEHSLQAAKLTGAD  156 (261)
Q Consensus        81 ~e~i~ia~~ikP~qvtLV-Pe~r~elTTegGldv~~--~~~~L~~~i~~l~~~girv-SLFIDpd~~q~~i~~a~~~Gad  156 (261)
                      +.+++.|..+|..-+++- ----.-.||-..|.=.+  -.+.|+++-+   +.|..| +=.+|  ++|  ++.+.+. +|
T Consensus       107 eq~~~~A~~vk~~ga~~lRgGa~KPRTsPysFqGlg~eGL~~L~~~~~---e~GlpvvTEV~~--~~~--ve~v~~~-vD  178 (335)
T PRK08673        107 EQILEIARAVKEAGAQILRGGAFKPRTSPYSFQGLGEEGLKLLAEARE---ETGLPIVTEVMD--PRD--VELVAEY-AD  178 (335)
T ss_pred             HHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHH---HHCCCEEEEECC--HHH--HHHHHHH-CC
T ss_conf             999999999997799688066657899985414551669999999999---869952899668--999--9999964-97


Q ss_pred             EEEECCCCCHHHH-----HH-------HHHHHHHHHHHHHHHHHHHHCC----CEEEEC----CCCCHHHHHHHHHHCCC
Q ss_conf             4651121110244-----43-------5643366688999876654156----235207----89898779999973699
Q gi|254780438|r  157 CIELYTGPYGACY-----NN-------PQQERIFLNKLAITAQLAQKMD----LQINAG----HDLTIQNIPNLINAIPY  216 (261)
Q Consensus       157 ~VElhTG~Ya~a~-----~~-------~~~~~~el~~i~~aa~~A~~lg----L~VnAG----HgLn~~Nl~~~i~~Ip~  216 (261)
                      .+-+=+-.--+-+     .+       ++-....++....+++|..+.|    +-|+-|    ..-+++++ . ++.+|.
T Consensus       179 ilQIGARnmqN~~LL~evg~~~kPVllKrg~~~ti~ewl~AaEyi~~~Gn~~ViLcERGirtfe~~tRntl-D-l~aip~  256 (335)
T PRK08673        179 ILQIGARNMQNFDLLKEVGKTNKPVLLKRGMSATIEEWLMAAEYILAEGNPNVILCERGIRTFETATRNTL-D-LSAVPV  256 (335)
T ss_pred             EEEECHHHHCCHHHHHHHHHHCCEEEECCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCC-C-HHHHHH
T ss_conf             99989155059999999997299489737887889999878999997699867999346545676667877-8-788899


Q ss_pred             CEEEE
Q ss_conf             63884
Q gi|254780438|r  217 ISEIS  221 (261)
Q Consensus       217 I~Evs  221 (261)
                      +++.+
T Consensus       257 ~k~~t  261 (335)
T PRK08673        257 LKKLT  261 (335)
T ss_pred             HHHCC
T ss_conf             97188


No 165
>PRK02991 D-serine dehydratase; Provisional
Probab=52.05  E-value=21  Score=17.35  Aligned_cols=74  Identities=18%  Similarity=0.378  Sum_probs=50.8

Q ss_pred             CCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHH---------------HHHHHHH-HHHHH---
Q ss_conf             2696389972544441479999740661465112111024443564336---------------6688999-87665---
Q gi|254780438|r  129 NLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI---------------FLNKLAI-TAQLA---  189 (261)
Q Consensus       129 ~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~---------------el~~i~~-aa~~A---  189 (261)
                      ..|-+|+.-+-.|..|=--+.....|+..|| |.+.|+.|.....++..               -+--|.- +.++.   
T Consensus       180 ~LGF~vtVHMSaDAkqWKKd~LR~~GV~VvE-~~~DY~~AV~~gR~~a~~Dp~~~FVDDEnS~~LFlGYavAa~RLk~Ql  258 (443)
T PRK02991        180 ALGFKVTVHMSADARQWKKDKLRSHGVTVVE-YEGDYGVAVEEGRKAAESDPNCYFIDDENSRTLFLGYAVAGLRLKAQL  258 (443)
T ss_pred             HHCCCEEEEECCCHHHHHHHHHHHCCCEEEE-ECCCHHHHHHHHHHHHHCCCCCEEECCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             6078369984303788999999875978999-557479999999998721998567548881788877899899999999


Q ss_pred             HHCCCEEEECCCCC
Q ss_conf             41562352078989
Q gi|254780438|r  190 QKMDLQINAGHDLT  203 (261)
Q Consensus       190 ~~lgL~VnAGHgLn  203 (261)
                      .+.|+.|.+-|-|-
T Consensus       259 ~~~gi~Vd~~hPLf  272 (443)
T PRK02991        259 AEQGIVVDADHPLF  272 (443)
T ss_pred             HHCCCCCCCCCCEE
T ss_conf             97598527999707


No 166
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed
Probab=51.59  E-value=22  Score=17.30  Aligned_cols=187  Identities=18%  Similarity=0.152  Sum_probs=109.6

Q ss_pred             CCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHH----HHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEE
Q ss_conf             8998999999997499899982478833488899999----887400013674158883485689999985072128971
Q gi|254780438|r   23 WPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPE----IRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLV   98 (261)
Q Consensus        23 ~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~----l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLV   98 (261)
                      .-++++....++++|++-  +++|+-  +..+.+...    ++++|..+  +++|=|-     ..+++|.++..+-|-  
T Consensus        19 ~~~~~~~~~~~l~~Gv~~--vQlR~K--~~~~~~~~~~a~~l~~i~~~~--~~~liIN-----d~~~lA~~~~adGvH--   85 (210)
T PRK00043         19 TGDLLEVVEAALAGGVTL--VQLREK--GADARERLELARALKALCRRY--GVPLIVN-----DRVDLALAVGADGVH--   85 (210)
T ss_pred             CCCHHHHHHHHHHCCCCE--EEECCC--CCCHHHHHHHHHHHHHHHHHH--CCEEEEC-----CHHHHHHHHCCCEEE--
T ss_conf             554999999999869999--999269--989999999999999999980--9959976-----889999871999897--


Q ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHH-HHH
Q ss_conf             0165553335782213337889999986202696389972544441479999740661465112111024443564-336
Q gi|254780438|r   99 PDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQ-ERI  177 (261)
Q Consensus        99 Pe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~-~~~  177 (261)
                                    +.++.-.+...-+.+ ..+..+.+-.- +.++  +..|.+.|+|.|=|  ||+-..-.++.. ...
T Consensus        86 --------------Lgq~d~~~~~~r~~l-~~~~iiG~S~h-~~~e--~~~A~~~gaDYi~~--Gpvf~T~tK~~~~~~~  145 (210)
T PRK00043         86 --------------LGQDDLPVADARAIL-GPDAIIGVSTH-TLEE--AAAAAAAGADYVGV--GPIFPTPTKKDAKPAV  145 (210)
T ss_pred             --------------CCCCCCCHHHHHHHC-CCCCEEEEECC-CHHH--HHHHHHHCCCEEEE--CCCCCCCCCCCCCCCC
T ss_conf             --------------698876899999751-98878998479-9999--99998828983887--4521479888887778


Q ss_pred             HHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6688999876654156235207898987799999736996388425999999999409999999999997410
Q gi|254780438|r  178 FLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQHL  250 (261)
Q Consensus       178 el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~~~~  250 (261)
                      -++.+++   +.....+-|-|==|+|.+|+..+.+ . +.+=+-+--+|...   ---+.++++|++.++..+
T Consensus       146 g~~~l~~---~~~~~~iPvvAIGGI~~~ni~~~~~-~-Ga~giAvis~I~~a---~dp~~a~~~l~~~~~~~~  210 (210)
T PRK00043        146 GLELLRE---AREAIDIPIVAIGGITPENAAEVLE-A-GADGVAVVSAITAA---EDPAAAARALLAAFRAAR  210 (210)
T ss_pred             CHHHHHH---HHHHCCCCEEEECCCCHHHHHHHHH-C-CCCEEEEEHHHHCC---CCHHHHHHHHHHHHHHCC
T ss_conf             9999999---9984799989980889999999998-0-99999970897769---999999999999999749


No 167
>cd00560 PanC PanC  Pantoate-beta-alanine ligase, also known as pantothenate synthase, catalyzes the formation of pantothenate from pantoate and alanine.  PanC  belongs to a large superfamily of nucleotidyltransferases that includes , ATP sulfurylase (ATPS), phosphopantetheine adenylyltransferase (PPAT), and the amino-acyl tRNA synthetases. The enzymes of this family are structurally similar and share a dinucleotide-binding domain.
Probab=51.49  E-value=22  Score=17.29  Aligned_cols=14  Identities=21%  Similarity=0.418  Sum_probs=7.8

Q ss_pred             HHHHHHHHCCCCEE
Q ss_conf             47999974066146
Q gi|254780438|r  145 HSLQAAKLTGADCI  158 (261)
Q Consensus       145 ~~i~~a~~~Gad~V  158 (261)
                      .+++.+++.|+|.|
T Consensus        77 ~D~~~l~~~gvd~v   90 (276)
T cd00560          77 ADLKLLEKAGVDAV   90 (276)
T ss_pred             HHHHHHHHCCCCEE
T ss_conf             99999997699899


No 168
>cd01019 ZnuA Zinc binding protein ZnuA. These proteins have been shown to function as initial receptors in the ABC uptake of Zn2+.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism.  They are comprised of two globular subdomains connected by a single helix and bind their specific ligands in the cleft between these domains.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).
Probab=51.33  E-value=22  Score=17.27  Aligned_cols=45  Identities=24%  Similarity=0.231  Sum_probs=26.9

Q ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHH-HHHCCCCEEEECC
Q ss_conf             788999998620269638997254444147999-9740661465112
Q gi|254780438|r  117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQA-AKLTGADCIELYT  162 (261)
Q Consensus       117 ~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~-a~~~Gad~VElhT  162 (261)
                      ...|..+++.+++.++++ +|++|..+.+.++. |+++|+..++|..
T Consensus       214 ~~~l~~l~~~ik~~~v~~-If~e~~~~~k~a~~ia~e~g~~v~~ld~  259 (286)
T cd01019         214 AKRLAKIRKEIKEKGATC-VFAEPQFHPKIAETLAEGTGAKVGELDP  259 (286)
T ss_pred             HHHHHHHHHHHHHCCCCE-EEEECCCCHHHHHHHHHHCCCCEEEECC
T ss_conf             999999999999839988-9982898939999999971993899637


No 169
>COG0766 MurA UDP-N-acetylglucosamine enolpyruvyl transferase [Cell envelope biogenesis, outer membrane]
Probab=50.90  E-value=18  Score=17.89  Aligned_cols=113  Identities=21%  Similarity=0.311  Sum_probs=66.7

Q ss_pred             CCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHH-HHHHHHHCCCEEEEEECCCCCCC-------CC
Q ss_conf             99899982478833488899999887400013674158883485689-99998507212897101655533-------35
Q gi|254780438|r   37 GASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETF-LNLCERYKPEQITLVPDDPHQLT-------SD  108 (261)
Q Consensus        37 GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~-i~ia~~ikP~qvtLVPe~r~elT-------Te  108 (261)
                      -|+|-|+=--    -.++-.+.+|..+++    +.--+|+|+-|+.+ ++=+.+...-.-+.+||+=+.-|       |.
T Consensus       177 lA~G~TvIeN----AA~EPEIvDLa~~Ln----~MGA~I~GaGT~~I~I~GV~~L~g~~h~VipDRIEAGT~~~aaA~tg  248 (421)
T COG0766         177 LAEGTTVIEN----AAREPEIVDLANFLN----KMGAKIEGAGTSTITIEGVEKLHGAEHSVIPDRIEAGTFLVAAAITG  248 (421)
T ss_pred             HCCCCEEEEE----CCCCCHHHHHHHHHH----HCCCEEEECCCCEEEEECCCCCCCCEEEECCCHHHHHHHHHHHHHHC
T ss_conf             6698489820----256825899999999----74882687687739996604556705663573313879999999948


Q ss_pred             CCCCHHH-HHHHHHHHHHHHCCCCCEE-----EEEECCCCCCHHHHHHHHCCCCEEEECCCCCHH
Q ss_conf             7822133-3788999998620269638-----997254444147999974066146511211102
Q gi|254780438|r  109 HGWDFLQ-NQALLTKTVARLHNLGSRI-----SLFADGNGNEHSLQAAKLTGADCIELYTGPYGA  167 (261)
Q Consensus       109 gGldv~~-~~~~L~~~i~~l~~~girv-----SLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~  167 (261)
                      |..-+.. ..+.|..++.+|++.|..+     ++++++....          ...|.+-|.||--
T Consensus       249 g~v~i~~v~~~hl~~~~~kL~e~G~~~~~~~~~i~v~~~~~~----------~k~v~i~T~p~PG  303 (421)
T COG0766         249 GDVTIENVRPEHLEAVLAKLREAGVDIEEGEDGIRVDMEGKR----------LKAVDIKTLPYPG  303 (421)
T ss_pred             CCEEEECCCHHHHHHHHHHHHHHCCEEEECCCEEEEECCCCC----------CCCCEECCCCCCC
T ss_conf             947990789899999999999849807962885999656777----------8862330589999


No 170
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA). TPRS is a bifunctional tetrameric enzyme (2 alpha and 2 beta subunits) that catalyzes the last two steps of L-tryptophan biosynthesis. Alpha and beta subunit catalyze two distinct reactions which are both strongly stimulated by the formation of the complex. The alpha subunit catalyzes the cleavage of indole 3-glycerol phosphate (IGP) to indole and d-glyceraldehyde 3-phosphate (G3P). Indole is then channeled to the active site of the beta subunit, a PLP-dependent enzyme that catalyzes a replacement reaction to convert L-serine into L-tryptophan.
Probab=49.80  E-value=23  Score=17.11  Aligned_cols=200  Identities=19%  Similarity=0.254  Sum_probs=122.8

Q ss_pred             CCCC---HHHHHHHHHHCCCCEEEE-----ECCCCCCCCC------------HHHHHHHHHHHCCCCCCCEEEEEECCCH
Q ss_conf             6899---899999999749989998-----2478833488------------8999998874000136741588834856
Q gi|254780438|r   22 PWPN---LVHIGKIALQSGASGLTV-----HPRPDQRHIR------------YTDLPEIRRLIDEQFPKAELNIEGYPNE   81 (261)
Q Consensus        22 ~~P~---~~~~a~~~~~~GadgITv-----H~R~DrRHI~------------~~Dv~~l~~~~~~~~~~~elNiEg~p~~   81 (261)
                      .|||   -.+++....++|||-|-+     -|--|---||            -+|+.++.+-+.+.. ++++=+=+|.++
T Consensus         9 G~P~~~~~~~~~~~l~~~G~d~iEiGiPfsDP~aDGpvIq~A~~~aL~~g~~~~~~~~~~~~~r~~~-~~pivlM~Y~N~   87 (242)
T cd04724           9 GDPDLETTLEILKALVEAGADIIELGIPFSDPVADGPVIQAASERALANGVTLKDVLELVKEIRKKN-TIPIVLMGYYNP   87 (242)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCC-CCCEEEEEECHH
T ss_conf             7899799999999999769999997899888776589999999999976994999999999987347-988899984457


Q ss_pred             -------HHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCC
Q ss_conf             -------8999998507212897101655533357822133378899999862026963899725444414799997406
Q gi|254780438|r   82 -------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTG  154 (261)
Q Consensus        82 -------e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~G  154 (261)
                             +|++.+.+.-= .-.|+||-|-              +...++...+++.|+....|+-|.....-++...+..
T Consensus        88 i~~~G~e~F~~~~~~~Gv-~GviipDLP~--------------ee~~~~~~~~~~~~i~~I~lvsPtt~~~ri~~i~~~s  152 (242)
T cd04724          88 ILQYGLERFLRDAKEAGV-DGLIIPDLPP--------------EEAEEFREAAKEYGLDLIFLVAPTTPDERIKKIAELA  152 (242)
T ss_pred             HHHHCHHHHHHHHHHCCC-CEEEECCCCH--------------HHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHC
T ss_conf             665289999999997599-7587069995--------------7846899999865983889968988789999999747


Q ss_pred             CCEEEE--CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCC-CHHHHHHHHHHCCCCEEEEEHHHHHHHHH
Q ss_conf             614651--121110244435643366688999876654156235207898-98779999973699638842599999999
Q gi|254780438|r  155 ADCIEL--YTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDL-TIQNIPNLINAIPYISEISVGHAFAATAL  231 (261)
Q Consensus       155 ad~VEl--hTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgL-n~~Nl~~~i~~Ip~I~EvsIGHaiIseAl  231 (261)
                      -..|=.  .+|.=...-.........++++++.      ..+-|-+|-|. +-+-+.. +.+.  -+=|=||-++|-.=-
T Consensus       153 ~gfiY~vs~~GvTG~~~~~~~~~~~~i~~ik~~------t~~Pv~vGFGI~~~e~v~~-~~~~--aDGvIVGSa~V~~i~  223 (242)
T cd04724         153 SGFIYYVSRTGVTGARTELPDDLKELIKRIRKY------TDLPIAVGFGISTPEQAAE-VAKY--ADGVIVGSALVKIIE  223 (242)
T ss_pred             CCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHH------CCCCEEEECCCCCHHHHHH-HHHH--CCEEEECHHHHHHHH
T ss_conf             984999857777787755649999999999871------6897487438799999999-9965--999998789999999


Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             940999999999999
Q gi|254780438|r  232 ECGVKEAVFCFRRAC  246 (261)
Q Consensus       232 ~~GL~~aI~~~~~ii  246 (261)
                      ..|.++.+...++++
T Consensus       224 ~~~~~~~~~~~~~~~  238 (242)
T cd04724         224 EGGEEEALEALKELA  238 (242)
T ss_pred             HCCHHHHHHHHHHHH
T ss_conf             639688999999999


No 171
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones]
Probab=49.54  E-value=15  Score=18.44  Aligned_cols=39  Identities=10%  Similarity=0.164  Sum_probs=25.8

Q ss_pred             CEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECC
Q ss_conf             89998247883348889999988740001367415888348
Q gi|254780438|r   39 SGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYP   79 (261)
Q Consensus        39 dgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p   79 (261)
                      -.||+|||||..+  .-+-+.|+++++.+..-+++-|.+--
T Consensus       172 T~I~L~Lk~~e~e--fl~~~rl~~ivkkYSd~i~~PI~~~~  210 (623)
T COG0326         172 TEITLHLKEEEDE--FLEEWRLREIVKKYSDHIAYPIYIEG  210 (623)
T ss_pred             CEEEEEECCCHHH--HHHHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             5799998876677--74066799999987325431669964


No 172
>cd06447 D-Ser-dehyd D-Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- or D-serine  to pyruvate and ammonia.  D-serine dehydratase serves as a detoxifying enzyme in most E. coli strains where D-serine is a competitive antagonist of beta-alanine in the biosynthetic pathway to pentothenate and coenzyme A.  D-serine dehydratase is different from other pyridoxal-5'-phosphate-dependent enzymes in that it catalyzes alpha, beta-elimination reactions on amino acids.
Probab=49.53  E-value=23  Score=17.09  Aligned_cols=74  Identities=15%  Similarity=0.360  Sum_probs=51.0

Q ss_pred             CCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHH---------------HHHHHH-HHHHHHH--
Q ss_conf             2696389972544441479999740661465112111024443564336---------------668899-9876654--
Q gi|254780438|r  129 NLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI---------------FLNKLA-ITAQLAQ--  190 (261)
Q Consensus       129 ~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~---------------el~~i~-~aa~~A~--  190 (261)
                      ..|-+|+.-|-.|..|---+....-|+..|| |++.|+.|.....++..               -+--|. .+.+++.  
T Consensus       155 ~LGF~v~VHMSaDAkqWKKd~LR~~GV~VvE-~~~DYs~AV~~gR~~a~~DP~~~FVDDEnS~~LFlGYavAa~rLk~QL  233 (404)
T cd06447         155 ALGFKVTVHMSADAKQWKKDKLRSKGVTVVE-YETDYSKAVEEGRKQAAADPMCYFVDDENSRDLFLGYAVAASRLKAQL  233 (404)
T ss_pred             HCCCCEEEECCCCHHHHHHHHHHHCCCEEEE-ECCCHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             6078679971566477899999865987999-528779999999998740997279518871778877899999999999


Q ss_pred             -HCCCEEEECCCCC
Q ss_conf             -1562352078989
Q gi|254780438|r  191 -KMDLQINAGHDLT  203 (261)
Q Consensus       191 -~lgL~VnAGHgLn  203 (261)
                       +.|+.|.+-|-|-
T Consensus       234 ~~~gi~Vd~~hPLf  247 (404)
T cd06447         234 AELGIKVDAEHPLF  247 (404)
T ss_pred             HHCCCEECCCCCEE
T ss_conf             98297336998718


No 173
>cd00738 HGTP_anticodon HGTP anticodon binding domain, as found at the C-terminus of histidyl, glycyl, threonyl and prolyl tRNA synthetases, which are classified as a group of class II aminoacyl-tRNA synthetases (aaRS). In aaRSs, the anticodon binding domain is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only. This domain is also found in the accessory subunit of mitochondrial polymerase gamma (Pol gamma b).
Probab=49.37  E-value=23  Score=17.07  Aligned_cols=58  Identities=17%  Similarity=0.202  Sum_probs=40.0

Q ss_pred             CCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEE
Q ss_conf             2128971016555333578221333788999998620269638997254444147999974066146
Q gi|254780438|r   92 PEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCI  158 (261)
Q Consensus        92 P~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~V  158 (261)
                      |.||.++|=...         -..-.++-.++...|+++||+|.+--....--+.+..|-..|+..+
T Consensus         1 P~qv~Iipi~~~---------~~e~~~~a~~l~~~L~~~gi~v~~Ddr~~~~g~k~~~a~~~giP~~   58 (94)
T cd00738           1 PIDVAIVPLTDP---------RVEAREYAQKLLNALLANGIRVLYDDRERKIGKKFREADLRGVPFA   58 (94)
T ss_pred             CEEEEEEEECCC---------CHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHCCCCEE
T ss_conf             919999984389---------7789999999999999889989998799997599999997499899


No 174
>PRK06267 hypothetical protein; Provisional
Probab=49.00  E-value=24  Score=17.03  Aligned_cols=45  Identities=20%  Similarity=0.251  Sum_probs=17.5

Q ss_pred             HHHHHHHHHHHHCCCEEEEC----CCCCHHHHH---HHHHHCCCCEEEEEHHH
Q ss_conf             88999876654156235207----898987799---99973699638842599
Q gi|254780438|r  180 NKLAITAQLAQKMDLQINAG----HDLTIQNIP---NLINAIPYISEISVGHA  225 (261)
Q Consensus       180 ~~i~~aa~~A~~lgL~VnAG----HgLn~~Nl~---~~i~~Ip~I~EvsIGHa  225 (261)
                      +.-.++-+.++++|+++-.|    =|=+.+.+.   .|++.+. +++|-||-+
T Consensus       153 e~Ri~~l~~lk~~G~e~gsG~ivGlGET~ed~~~~~~~lkel~-~d~I~I~~f  204 (324)
T PRK06267        153 DKIKEMLKKAKDLGLKTGITIILGLGETEDDIELLLNLIEELN-LDRITFYSL  204 (324)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEEEECCCCHHHHHHHHHHHHHCC-CCEEEECCC
T ss_conf             9999999999983983200468737988999999999999769-997632584


No 175
>pfam02638 DUF187 Uncharacterized BCR, COG1649.
Probab=48.30  E-value=20  Score=17.47  Aligned_cols=17  Identities=24%  Similarity=0.302  Sum_probs=11.4

Q ss_pred             HHHHHHCCCCEEEEECC
Q ss_conf             99999749989998247
Q gi|254780438|r   30 GKIALQSGASGLTVHPR   46 (261)
Q Consensus        30 a~~~~~~GadgITvH~R   46 (261)
                      +.++.+|...|+.||+=
T Consensus       113 ~~~I~EaHkRGlevhAW  129 (394)
T pfam02638       113 AFMIDEAHKRNLRVHPW  129 (394)
T ss_pred             HHHHHHHHHCCCEEEEE
T ss_conf             99999998769989899


No 176
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed
Probab=48.28  E-value=19  Score=17.60  Aligned_cols=26  Identities=27%  Similarity=0.319  Sum_probs=13.4

Q ss_pred             HHHHHHCCCCE--EEECCCCCHHHHHHHH
Q ss_conf             99997406614--6511211102444356
Q gi|254780438|r  147 LQAAKLTGADC--IELYTGPYGACYNNPQ  173 (261)
Q Consensus       147 i~~a~~~Gad~--VElhTG~Ya~a~~~~~  173 (261)
                      -.+|..+|+|.  ||.|.-|= +|+.+..
T Consensus       308 a~aa~a~GaDGlmIEvHp~P~-~AlSD~~  335 (360)
T PRK12595        308 AKAALAIGADGVMAEVHPDPA-VALSDSA  335 (360)
T ss_pred             HHHHHHCCCCEEEEEECCCHH-HCCCCCC
T ss_conf             999997499979998668823-2158710


No 177
>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM. This superfamily contains MoaA, NifB, PqqE, coproporphyrinogen III oxidase, biotin synthase and MiaB families, and includes a representative in the eukaryotic elongator subunit, Elp-3. Some members of the family are methyltransferases.
Probab=47.30  E-value=25  Score=16.86  Aligned_cols=81  Identities=15%  Similarity=0.184  Sum_probs=33.3

Q ss_pred             CHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC-CEEEE-EEC--CCCC----CHHHHHHH
Q ss_conf             5689999985072128971016555333578221333788999998620269-63899-725--4444----14799997
Q gi|254780438|r   80 NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLG-SRISL-FAD--GNGN----EHSLQAAK  151 (261)
Q Consensus        80 ~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~g-irvSL-FID--pd~~----q~~i~~a~  151 (261)
                      ++++++...+..=+++.+=+|.-++-+=+- .+-..+.+.....++.+++.| ++++. ||=  |+-+    ..+++.+.
T Consensus        99 ~~e~l~~l~~~g~~~v~~giEs~~~~~l~~-i~k~~~~~~~~~~i~~~~~~g~~~~~~~~i~GlP~et~e~~~~t~~~~~  177 (216)
T smart00729       99 TEELLEALKEAGVNRVSLGVQSGSDEVLKA-INRGHTVEDVLEAVEKLREAGPIKVSTDLIVGLPGETEEDFEETLKLLK  177 (216)
T ss_pred             CHHHHHHHHHCCCCCCCCCCCCCHHHHHHH-HCCCCCHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             899999999849986666735507899987-1799999999999999998589368775786799999999999999999


Q ss_pred             HCCCCEEEEC
Q ss_conf             4066146511
Q gi|254780438|r  152 LTGADCIELY  161 (261)
Q Consensus       152 ~~Gad~VElh  161 (261)
                      ++++|.|-++
T Consensus       178 ~~~~~~i~~~  187 (216)
T smart00729      178 ELGPDRVSIF  187 (216)
T ss_pred             HCCCCEEEEE
T ss_conf             4691989987


No 178
>PRK08599 coproporphyrinogen III oxidase; Provisional
Probab=47.16  E-value=25  Score=16.84  Aligned_cols=106  Identities=18%  Similarity=0.243  Sum_probs=65.5

Q ss_pred             CCHHHHHHHHHHHCCCC---CCCEEEEEECCC---HHHHHHHHHHCCCEEEE-----EECCCCCCCCCCCCCHHHHHHHH
Q ss_conf             88899999887400013---674158883485---68999998507212897-----10165553335782213337889
Q gi|254780438|r   52 IRYTDLPEIRRLIDEQF---PKAELNIEGYPN---ETFLNLCERYKPEQITL-----VPDDPHQLTSDHGWDFLQNQALL  120 (261)
Q Consensus        52 I~~~Dv~~l~~~~~~~~---~~~elNiEg~p~---~e~i~ia~~ikP~qvtL-----VPe~r~elTTegGldv~~~~~~L  120 (261)
                      ...+++..|-+.+...+   +..|+.+|++|.   .+.+....+.--+.+-+     .|+....+--.      ...+..
T Consensus        65 L~~~~l~~ll~~i~~~f~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvNRiSlGvQsf~~~~l~~lgR~------h~~~~~  138 (377)
T PRK08599         65 LSAEQLERLLNAIHRTLPLSDLEEFTFEANPGDLTKEKLQVLKDYGVNRISLGVQTFNDELLKKIGRT------HNEEDV  138 (377)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHHCCC------CCHHHH
T ss_conf             99999999999999976977673279995515163999999997099879996535987999986899------989999


Q ss_pred             HHHHHHHCCCCCE-EEE-EECCCCCC------HHHHHHHHCCCCEEEECCC
Q ss_conf             9999862026963-899-72544441------4799997406614651121
Q gi|254780438|r  121 TKTVARLHNLGSR-ISL-FADGNGNE------HSLQAAKLTGADCIELYTG  163 (261)
Q Consensus       121 ~~~i~~l~~~gir-vSL-FIDpd~~q------~~i~~a~~~Gad~VElhTG  163 (261)
                      .+.++.+++.|.. ||+ +|---|.|      .+++.+.++|++.|-+|.=
T Consensus       139 ~~~i~~~r~~gf~~iniDLIyGlP~Qt~~~~~~~l~~~~~l~p~hiS~Y~L  189 (377)
T PRK08599        139 YESIANAKKAGFKNISIDLIYALPGQTIEDVKESLDKALALDIPHYSLYSL  189 (377)
T ss_pred             HHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEEE
T ss_conf             999999997599741156542788898999999999997306363455442


No 179
>cd00443 ADA_AMPD Adenosine/AMP deaminase. Adenosine deaminases (ADAs) are present in pro- and eukaryotic organisms and catalyze  the zinc dependent irreversible deamination of adenosine nucleosides to inosine nucleosides and ammonia. The eukaryotic AMP deaminase catalyzes a similar reaction leading to the hydrolytic removal of an amino group at the 6 position of the adenine nucleotide ring, a branch point in the adenylate catabolic pathway.
Probab=46.32  E-value=26  Score=16.76  Aligned_cols=113  Identities=14%  Similarity=0.162  Sum_probs=57.4

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCC--CCEEEEEECCCCCC----------HHHHHHHHC--CCCEEEECCCCCHHHH
Q ss_conf             533357822133378899999862026--96389972544441----------479999740--6614651121110244
Q gi|254780438|r  104 QLTSDHGWDFLQNQALLTKTVARLHNL--GSRISLFADGNGNE----------HSLQAAKLT--GADCIELYTGPYGACY  169 (261)
Q Consensus       104 elTTegGldv~~~~~~L~~~i~~l~~~--girvSLFIDpd~~q----------~~i~~a~~~--Gad~VElhTG~Ya~a~  169 (261)
                      ...++.||+......-+...++..++.  ||++.+-+..+..+          ..+++++..  |+-.+.|--       
T Consensus        71 ~~~~~~~l~~~~~~~~v~~g~~~a~~~~~gi~~~lI~~~~R~~~~~~~~~~~~~~~~~~~~~~~~vvGidl~G-------  143 (305)
T cd00443          71 LLETEKGLTKEQYWLLVIEGISEAKQWFPPIKVRLILSVDRRGPYVQNYLVASEILELAKFLSNYVVGIDLVG-------  143 (305)
T ss_pred             HCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEC-------
T ss_conf             1166579998999999999999999865896699999985489978999999999999987599489999625-------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH---CCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHH
Q ss_conf             4356433666889998766541---5623520789898779999973699638842599999
Q gi|254780438|r  170 NNPQQERIFLNKLAITAQLAQK---MDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAA  228 (261)
Q Consensus       170 ~~~~~~~~el~~i~~aa~~A~~---lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIs  228 (261)
                       ..........++..+...|+.   +++-+|||-.-.-+++...+. +   .-=-|||.+-+
T Consensus       144 -~e~~~~~~~~~f~~~~~~a~~~g~l~~t~HaGE~~~~~~i~~al~-l---~a~RIGHG~~~  200 (305)
T cd00443         144 -DESKGENPLRDFYSYYEYARRLGLLGLTLHCGETGNREELLQALL-L---LPDRIGHGIFL  200 (305)
T ss_pred             -CCCCCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHH-H---HHHHCCCHHHH
T ss_conf             -666788986999999999996499835641587797789999998-4---55522531211


No 180
>COG1649 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=46.16  E-value=26  Score=16.74  Aligned_cols=125  Identities=18%  Similarity=0.128  Sum_probs=73.5

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEC-CCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             3357822133378899999862026963899725-444414799997406614651121110244435643366688999
Q gi|254780438|r  106 TSDHGWDFLQNQALLTKTVARLHNLGSRISLFAD-GNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI  184 (261)
Q Consensus       106 TTegGldv~~~~~~L~~~i~~l~~~girvSLFID-pd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~  184 (261)
                      -|..+.++..+...+++.+..|...|+.+-.|.= |+-+  .+  -..-.+.+...-||..+..   +     -.+.+..
T Consensus        52 ltn~~~~v~~~~~el~~~ld~l~~ln~NTv~~qV~~~G~--~l--ypS~~~p~s~~~~~~~~~~---~-----g~DpLa~  119 (418)
T COG1649          52 LTNADSRVLFQRQELKDILDDLQKLNFNTVYPQVWNDGD--AL--YPSAVLPWSDGLPGVLGVD---P-----GYDPLAF  119 (418)
T ss_pred             EECCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCC--CC--CCCCCCCCCCCCCCCCCCC---C-----CCCHHHH
T ss_conf             803887410369999999999997098526899965855--01--3422356545767655778---8-----9786899


Q ss_pred             HHHHHHHCCCEEEEC------------------CCCCHHHHHHHHHHCCC----CEEEEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             876654156235207------------------89898779999973699----63884259999999994099999999
Q gi|254780438|r  185 TAQLAQKMDLQINAG------------------HDLTIQNIPNLINAIPY----ISEISVGHAFAATALECGVKEAVFCF  242 (261)
Q Consensus       185 aa~~A~~lgL~VnAG------------------HgLn~~Nl~~~i~~Ip~----I~EvsIGHaiIseAl~~GL~~aI~~~  242 (261)
                      ....||+.||+|||=                  |+++-.+ ..-+.....    --=++=||--+++=+.....+.|++|
T Consensus       120 ~I~~AHkr~l~v~aWf~~~~~a~~~s~~~~~~p~~~~~~~-~~~~~~~~~~~~~~~~ldPg~Pevq~~i~~lv~evV~~Y  198 (418)
T COG1649         120 VIAEAHKRGLEVHAWFNPYRMAPPTSPLTKRHPHWLTTKR-PGWVYVRHQGWGKRVWLDPGIPEVQDFITSLVVEVVRNY  198 (418)
T ss_pred             HHHHHHHCCCEEEECHHHCCCCCCCCHHHHHCCCCCCCCC-CCEEEEECCCCEEEEEECCCCHHHHHHHHHHHHHHHHCC
T ss_conf             9999986498321141010358777756764888754579-983799548860015767998699999999999999678


Q ss_pred             H
Q ss_conf             9
Q gi|254780438|r  243 R  243 (261)
Q Consensus       243 ~  243 (261)
                      .
T Consensus       199 d  199 (418)
T COG1649         199 D  199 (418)
T ss_pred             C
T ss_conf             8


No 181
>PRK09776 putative sensor protein; Provisional
Probab=46.15  E-value=26  Score=16.74  Aligned_cols=26  Identities=8%  Similarity=0.149  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHCCCCEEEEEHHHHHHHHH
Q ss_conf             8779999973699638842599999999
Q gi|254780438|r  204 IQNIPNLINAIPYISEISVGHAFAATAL  231 (261)
Q Consensus       204 ~~Nl~~~i~~Ip~I~EvsIGHaiIseAl  231 (261)
                      |.++.+ ++++| ++.+-|--++|.+..
T Consensus      1023 ySSL~y-Lk~lP-vD~LKID~sFV~~l~ 1048 (1116)
T PRK09776       1023 LSSFNY-LKAFM-ADYLKIDGELCANLQ 1048 (1116)
T ss_pred             HHHHHH-HHHCC-CCEEEECHHHHCCCC
T ss_conf             789999-97289-998998989971757


No 182
>TIGR01307 pgm_bpd_ind 2,3-bisphosphoglycerate-independent phosphoglycerate mutase; InterPro: IPR005995   This 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (iPGAM) is a metalloenzyme found particularly in eubacteria and higher plants. It is distantly related to archaeal iPGAM (IPR004456 from INTERPRO) and distinct from the unrelated cofactor-dependent PGAM (PIRSF001490 from PIRSF). Activity has been demonstrated for proteins from a variety of organisms, including Pseudomonas syringae pv. tomato , Bacillus subtilis , Bacillus stearothermophilus , maize , castor bean , and Trypanosoma brucei . The structure of the B. stearothermophilus enzyme (PDB:1EJJ) has two domains . Residues 1-76 and 311-511 form the phosphatase domain, containing the active site residue and two metal-binding sites. This domain is similar to alkaline phosphatase (PDB:1ALK) and arylsulphatase (PDB:1AUK), which are members of the SCOP alkaline phosphatase-like superfamily, but there is meagre sequence similarity outside of the metal-binding segments. Residues 77-310 form the phosphotransferase domain, which is poorly conserved (or perhaps unrelated) in the archaeal enzymes.; GO: 0004619 phosphoglycerate mutase activity, 0006007 glucose catabolic process.
Probab=45.89  E-value=26  Score=16.73  Aligned_cols=40  Identities=18%  Similarity=0.248  Sum_probs=18.8

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCC
Q ss_conf             12111024443564336668899987665415623520789
Q gi|254780438|r  161 YTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHD  201 (261)
Q Consensus       161 hTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHg  201 (261)
                      |||.|..|...=+--...|.+|.++++ ....-+-+-|=||
T Consensus       416 HTG~~~Aai~AvEA~D~~~gri~~~~~-~~g~~~llTADHG  455 (529)
T TIGR01307       416 HTGNFEAAIKAVEALDVCLGRIVEACK-KVGGTLLLTADHG  455 (529)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHH-HCCCEEEEEECCC
T ss_conf             477289999999998799999999997-4896299960556


No 183
>PRK13122 consensus
Probab=45.86  E-value=26  Score=16.71  Aligned_cols=200  Identities=17%  Similarity=0.251  Sum_probs=126.1

Q ss_pred             CCCHHHHHHHHHHCCCCEEEEE-----CCCCCCCCCHHHHHHHH------------HHHCCCCCCCEEEEEECCC-----
Q ss_conf             8998999999997499899982-----47883348889999988------------7400013674158883485-----
Q gi|254780438|r   23 WPNLVHIGKIALQSGASGLTVH-----PRPDQRHIRYTDLPEIR------------RLIDEQFPKAELNIEGYPN-----   80 (261)
Q Consensus        23 ~P~~~~~a~~~~~~GadgITvH-----~R~DrRHI~~~Dv~~l~------------~~~~~~~~~~elNiEg~p~-----   80 (261)
                      +||..+.++...++|||-|-+-     |--|---||...-+.|+            +-.... .++++=+=+|.+     
T Consensus        12 ~pd~~~~~~~l~~~GaDiiElGiPfSDP~ADGpvIQ~A~~rAL~~G~~~~~~~~~l~~~r~~-~~~pivlM~Y~N~i~~~   90 (242)
T PRK13122         12 NKDLIENATLLSENGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITIDYIFNQLEKHGDQ-IKCNYVLMTYYNIICHY   90 (242)
T ss_pred             CCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCC-CCCCEEEEEECHHHHHH
T ss_conf             99999999999975999999789888866658999999999997699899999999973136-79877999851698872


Q ss_pred             --HHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEE
Q ss_conf             --689999985072128971016555333578221333788999998620269638997254444147999974066146
Q gi|254780438|r   81 --ETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCI  158 (261)
Q Consensus        81 --~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~V  158 (261)
                        +.|++-+.+..=+ -.|+||-|-|.              -.++.+.++++|+..-.|+-|..+..-++...+..-..|
T Consensus        91 G~~~F~~~~~~~Gvd-GvIipDLP~ee--------------~~~~~~~~~~~gi~~I~lvaPtt~~~Ri~~i~~~s~GFi  155 (242)
T PRK13122         91 GEQAFFEKCRDTGVY-GLIIPDLPYEL--------------SQRLKQQFSHYGVKIISLVAMTTDDKRIKDIVSHAEGFI  155 (242)
T ss_pred             CHHHHHHHHHHCCCC-EEECCCCCHHH--------------HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCE
T ss_conf             799999999876998-67778998788--------------999999998679868987189998999999998299966


Q ss_pred             EEC-----CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCC-CHHHHHHHHHHCCCCEEEEEHHHHHHHHHH
Q ss_conf             511-----21110244435643366688999876654156235207898-987799999736996388425999999999
Q gi|254780438|r  159 ELY-----TGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDL-TIQNIPNLINAIPYISEISVGHAFAATALE  232 (261)
Q Consensus       159 Elh-----TG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgL-n~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~  232 (261)
                      =.-     ||.=...   .......++++++    .  -.+-|-.|-|. +-+-+.. ++.  .-+=|-||-++|-.=-.
T Consensus       156 Y~vs~~GvTG~~~~~---~~~~~~~i~~ik~----~--t~~Pv~vGFGI~~~e~v~~-i~~--~ADGvIVGSaivk~i~~  223 (242)
T PRK13122        156 YTVTMNATTGQNGAF---HPELKRKIESIKA----I--ANVPVVAGFGIRTPQHVAD-IKE--VADGIVIGSEIVKRFKS  223 (242)
T ss_pred             EEEECCCCCCCCCCC---CHHHHHHHHHHHH----H--CCCCEEEECCCCCHHHHHH-HHH--HCCEEEECHHHHHHHHH
T ss_conf             987335435765556---5889999999997----2--5998587158799999999-981--19999984899999996


Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q ss_conf             4099999999999974105
Q gi|254780438|r  233 CGVKEAVFCFRRACGQHLD  251 (261)
Q Consensus       233 ~GL~~aI~~~~~ii~~~~~  251 (261)
                      .| .+.+.+|.+-+++.++
T Consensus       224 ~~-~e~~~~~i~~l~~aL~  241 (242)
T PRK13122        224 NT-REEIIKYLQSIQQTLN  241 (242)
T ss_pred             CC-HHHHHHHHHHHHHHHC
T ss_conf             79-8999999999999855


No 184
>cd00717 URO-D Uroporphyrinogen decarboxylase (URO-D) is a dimeric cytosolic enzyme that decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, without requiring any prosthetic groups or cofactors. This reaction is located at the branching point of the tetrapyrrole biosynthetic pathway, leading to the biosynthesis of heme, chlorophyll or bacteriochlorophyll. URO-D deficiency is responsible for the human genetic diseases familial porphyria cutanea tarda (fPCT) and hepatoerythropoietic porphyria (HEP).
Probab=45.74  E-value=26  Score=16.70  Aligned_cols=93  Identities=17%  Similarity=0.248  Sum_probs=47.5

Q ss_pred             HHHHHHHHHHCCC--CCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCC-CHHHHH-------------------HHHHH
Q ss_conf             8899999862026--9638997254444147999974066146511211-102444-------------------35643
Q gi|254780438|r  118 ALLTKTVARLHNL--GSRISLFADGNGNEHSLQAAKLTGADCIELYTGP-YGACYN-------------------NPQQE  175 (261)
Q Consensus       118 ~~L~~~i~~l~~~--girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~-Ya~a~~-------------------~~~~~  175 (261)
                      ..++++++.+++.  ++.+-.|-- +. ...++..+++|+|++-+-... -..+..                   .++..
T Consensus       215 p~~~~I~~~ik~~~~~vpiI~f~~-~~-~~~l~~~~~~~~d~isiD~~~~l~~a~~~l~~~~~lQGNlDP~~L~~~~e~i  292 (335)
T cd00717         215 PYLKRIIEEVKKRLPGVPVILFAK-GA-GGLLEDLAQLGADVVGLDWRVDLDEARKRLGPKVALQGNLDPALLYAPKEAI  292 (335)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEECC-CC-HHHHHHHHHCCCCEEECCCCCCHHHHHHHCCCCEEEECCCCHHHHCCCHHHH
T ss_conf             999999999985289997899768-85-7899999863987774277789899999819982796689878976999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCEEEECCCC----CHHHHHHHHHHC
Q ss_conf             366688999876654156235207898----987799999736
Q gi|254780438|r  176 RIFLNKLAITAQLAQKMDLQINAGHDL----TIQNIPNLINAI  214 (261)
Q Consensus       176 ~~el~~i~~aa~~A~~lgL~VnAGHgL----n~~Nl~~~i~~I  214 (261)
                      ..+..++.+.  +...-|--+|-|||+    ..+|+..|+..+
T Consensus       293 ~~~~~~il~~--~~~~~g~IfnLGHGI~p~tp~enV~~~ve~V  333 (335)
T cd00717         293 EKEVKRILKA--FGGAPGHIFNLGHGILPDTPPENVKALVEAV  333 (335)
T ss_pred             HHHHHHHHHH--HCCCCCEEEECCCCCCCCCCHHHHHHHHHHH
T ss_conf             9999999998--4899985987999869898999999999996


No 185
>TIGR00418 thrS threonyl-tRNA synthetase; InterPro: IPR002320   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .   Threonyl-tRNA synthetase (6.1.1.3 from EC) exists as a monomer and belongs to class IIa. The enzyme from Escherichia coli represses the translation of its own mRNA. The crystal structure of the complex between tRNA(Thr) and ThrRS show structural features that reveal novel strategies for providing specificity in tRNA selection. These include an amino-terminal domain containing a novel protein fold that makes minor groove contacts with the tRNA acceptor stem. The enzyme induces a large deformation of the anticodon loop, resulting in an interaction between two adjacent anticodon bases, which accounts for their prominent role in tRNA identity and translational regulation. A zinc ion found in the active site is implicated in amino acid recognition/discrimination . The zinc ion may act to ensure that only amino acids that possess a hydroxyl group attached to the beta-position are activated .; GO: 0004829 threonine-tRNA ligase activity, 0005524 ATP binding, 0006412 translation, 0006435 threonyl-tRNA aminoacylation, 0005737 cytoplasm.
Probab=45.60  E-value=26  Score=16.68  Aligned_cols=37  Identities=19%  Similarity=0.371  Sum_probs=30.2

Q ss_pred             HHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             507212897101655533357822133378899999862026963899
Q gi|254780438|r   89 RYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISL  136 (261)
Q Consensus        89 ~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSL  136 (261)
                      =..|-||-++|-.           +..+.++=.++.+.|+++||||.+
T Consensus       493 WLaP~QV~viPV~-----------i~~h~~yA~kv~~~L~~~giRv~~  529 (595)
T TIGR00418       493 WLAPVQVVVIPVS-----------IEKHLDYAKKVAEKLKKEGIRVDV  529 (595)
T ss_pred             ECCCEEEEEEECC-----------HHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             2176238997057-----------788999999999999857977988


No 186
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed
Probab=45.20  E-value=27  Score=16.64  Aligned_cols=192  Identities=11%  Similarity=0.141  Sum_probs=98.8

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCC--CCEEEEEECCCHHHHHHHHHHCCCEEEEEECCCCCC
Q ss_conf             999999974998999824788334888999998874000136--741588834856899999850721289710165553
Q gi|254780438|r   28 HIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFP--KAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQL  105 (261)
Q Consensus        28 ~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~--~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~r~el  105 (261)
                      .+..-|++.++.-|--.----+++....-+..+.......++  .+-+++-=..+.+++.-+++.-=+.|-+=--.  .=
T Consensus        33 Avi~AAee~~sPvIlq~s~g~~~~~g~~~l~~~~~~a~~~~~~VPValHLDHg~~~e~i~~ai~~GFtSVMiDgS~--lp  110 (347)
T PRK09196         33 AIMEAADETDSPVILQASAGARKYAGEPFLRHLILAAVEEYPHIPVVMHQDHGNSPATCQRAIQLGFTSVMMDGSL--KA  110 (347)
T ss_pred             HHHHHHHHHCCCEEEECCHHHHHHCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHCCCCEEEEECCC--CC
T ss_conf             9999999968998999873177665879999999999985689988997478899999999986489838973655--65


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCCCEE------------------------------EEEECCCCCCHHHHHHHHCCC
Q ss_conf             33578221333788999998620269638------------------------------997254444147999974066
Q gi|254780438|r  106 TSDHGWDFLQNQALLTKTVARLHNLGSRI------------------------------SLFADGNGNEHSLQAAKLTGA  155 (261)
Q Consensus       106 TTegGldv~~~~~~L~~~i~~l~~~girv------------------------------SLFIDpd~~q~~i~~a~~~Ga  155 (261)
                      -.+...++..|-..-+++++..+..|+-|                              ++|-|  |+| ..+..+++|+
T Consensus       111 ~~~~~~sfeeNi~~Tkevve~Ah~~gv~VEaElG~vGg~e~g~~g~edg~~~e~~~~~~~~yTd--Pee-A~~Fv~~Tgv  187 (347)
T PRK09196        111 DGKTPASYEYNVDVTRKVVEMAHACGVSVEGELGCLGSLETGMGGEEDGHGAEGKLSHDQLLTD--PEE-AADFVKKTQV  187 (347)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHCCC--HHH-HHHHHHHHCC
T ss_conf             5567778899999999999999873984999602104756677776667555555544431689--999-9999997487


Q ss_pred             CEEEECCCCCHHHHH---HHHHHHHHHHHHHHHHHHHHHCCCEEEECC---------------------CCCHHHHHHHH
Q ss_conf             146511211102444---356433666889998766541562352078---------------------98987799999
Q gi|254780438|r  156 DCIELYTGPYGACYN---NPQQERIFLNKLAITAQLAQKMDLQINAGH---------------------DLTIQNIPNLI  211 (261)
Q Consensus       156 d~VElhTG~Ya~a~~---~~~~~~~el~~i~~aa~~A~~lgL~VnAGH---------------------gLn~~Nl~~~i  211 (261)
                      |+.=.=-|.-=-.|.   .+.....-++++++.........|-.|-|-                     |+.-+.+...+
T Consensus       188 D~LAvaiGt~HG~YK~~~~P~~~~L~~~rL~eI~~~vp~~pLVLHGgS~vp~~~~~~~~~~gg~~~~~~G~~~e~i~~ai  267 (347)
T PRK09196        188 DALAIAIGTSHGAYKFTRKPTGDVLAIDRIKEIHARIPNTHLVMHGSSSVPQELLDIINEYGGDMPETYGVPVEEIQEGI  267 (347)
T ss_pred             CCCHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHH
T ss_conf             70300110134666577899722036999999998456786787789688678999998736766544698999999999


Q ss_pred             HHCCCCEEEEEHHHH
Q ss_conf             736996388425999
Q gi|254780438|r  212 NAIPYISEISVGHAF  226 (261)
Q Consensus       212 ~~Ip~I~EvsIGHai  226 (261)
                      +  .+|.-+||.--+
T Consensus       268 ~--~Gv~KiNi~Tdl  280 (347)
T PRK09196        268 K--HGVRKVNIDTDL  280 (347)
T ss_pred             H--HCCEEEECCHHH
T ss_conf             8--096466337489


No 187
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase; InterPro: IPR006234    These sequences represent O-succinylhomoserine sulfhydrylase, one of several related pyridoxal phosphate-dependent enzymes of cysteine and methionine metabolism. This enzyme is part of an alternative pathway of homocysteine biosynthesis, a step in methionine biosynthesis..
Probab=45.17  E-value=27  Score=16.64  Aligned_cols=61  Identities=21%  Similarity=0.268  Sum_probs=43.9

Q ss_pred             HHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             862026963899725444414799997406614651121110244435643366688999876654156235
Q gi|254780438|r  125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQI  196 (261)
Q Consensus       125 ~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~V  196 (261)
                      +-|+..||+|+ |+|++ +.+.=++|.+.....+=         ++.|.+--.|+-.|...+++||..|=.|
T Consensus       112 ~~l~rFGv~v~-fv~~~-Dl~~WeaA~~~nTkl~f---------~EtPSNPl~e~~Di~AlaELAHA~GA~l  172 (386)
T TIGR01325       112 EILPRFGVEVS-FVDAT-DLKAWEAALKPNTKLVF---------VETPSNPLAELVDIAALAELAHAVGALL  172 (386)
T ss_pred             CCCCCCCEEEE-ECCCC-CHHHHHHHCCCCCCEEE---------EECCCCHHHHHHHHHHHHHHHHHCCCEE
T ss_conf             25343540675-17867-87888985699950788---------6368870467999999999887334100


No 188
>pfam01729 QRPTase_C Quinolinate phosphoribosyl transferase, C-terminal domain. Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase EC:2.4.2.19 is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes. It catalyses the reaction of quinolinic acid with 5-phosphoribosyl-1-pyrophosphate (PRPP) in the presence of Mg2+ to give rise to nicotinic acid mononucleotide (NaMN), pyrophosphate and carbon dioxide. The QA substrate is bound between the C-terminal domain of one subunit, and the N-terminal domain of the other. The C-terminal domain has a 7 beta-stranded TIM barrel-like fold.
Probab=45.11  E-value=27  Score=16.63  Aligned_cols=85  Identities=21%  Similarity=0.248  Sum_probs=53.7

Q ss_pred             HHHHHHHCCC---CCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCE
Q ss_conf             9999862026---96389972544441479999740661465112111024443564336668899987665415--623
Q gi|254780438|r  121 TKTVARLHNL---GSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKM--DLQ  195 (261)
Q Consensus       121 ~~~i~~l~~~---girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~l--gL~  195 (261)
                      .+.++.+++.   ..++-+-+| +.+  ++..+.+.|+|.|=|-.-+.              +.++++..+.++.  ...
T Consensus        67 ~~~i~~~~~~~~~~~~I~VEv~-tl~--e~~~a~~~~~d~I~LDn~sp--------------e~l~~~v~~l~~~~~~v~  129 (169)
T pfam01729        67 TEAVRRAREVAPFAVKIEVEVE-NLE--ELEEALEAGADIIMLDNFSP--------------EEVREAVEELDERAGRVL  129 (169)
T ss_pred             HHHHHHHHHHCCCCCEEEEEEE-HHH--HHHHHHHCCCCEEEECCCCH--------------HHHHHHHHHHHHHCCCEE
T ss_conf             9999999996799970999960-199--89999846998999779999--------------999999999997589679


Q ss_pred             EEECCCCCHHHHHHHHHHCCCCEEEEEHH
Q ss_conf             52078989877999997369963884259
Q gi|254780438|r  196 INAGHDLTIQNIPNLINAIPYISEISVGH  224 (261)
Q Consensus       196 VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGH  224 (261)
                      +-|-=|+|.+|+..+ ++ .+++=+|+|-
T Consensus       130 iEaSGgI~~~ni~~y-A~-tGvD~IS~ga  156 (169)
T pfam01729       130 LEVSGGITLDNVLEY-AK-TGVDVISVGA  156 (169)
T ss_pred             EEECCCCCHHHHHHH-HH-CCCCEEECCH
T ss_conf             996189999999999-97-6999998586


No 189
>pfam05913 DUF871 Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
Probab=44.80  E-value=27  Score=16.60  Aligned_cols=78  Identities=19%  Similarity=0.304  Sum_probs=45.7

Q ss_pred             EEEEECCC---HHHHHHHHHHCCCEEEE------EECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCC
Q ss_conf             58883485---68999998507212897------1016555333578221333788999998620269638997254444
Q gi|254780438|r   73 LNIEGYPN---ETFLNLCERYKPEQITL------VPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGN  143 (261)
Q Consensus        73 lNiEg~p~---~e~i~ia~~ikP~qvtL------VPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~  143 (261)
                      +.||.|++   +++++-..+..|+.-.|      -|-      .+-||+.    +++...-+.|++.|++|.-||--+-.
T Consensus       111 l~I~LNASti~~~~l~~l~~~~~n~~~l~a~HNfYPr------~~TGLs~----~~f~~~n~~~k~~gi~~~AFI~g~~~  180 (357)
T pfam05913       111 LKIELNASTITTEYLDNLLSYGANFENLEACHNFYPR------PYTGLSY----EFFLEKNRWFKKYGIKTAAFIPGDGG  180 (357)
T ss_pred             CEEEEECCCCCHHHHHHHHHCCCCHHHEEEEECCCCC------CCCCCCH----HHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             6799978649999999999809987897997444799------8878899----99999999999779968999727986


Q ss_pred             CHHHHHHHHCCCCEEEECCC
Q ss_conf             14799997406614651121
Q gi|254780438|r  144 EHSLQAAKLTGADCIELYTG  163 (261)
Q Consensus       144 q~~i~~a~~~Gad~VElhTG  163 (261)
                         ...-.--|-..+|-|-+
T Consensus       181 ---~rGPl~eGLPTLE~HR~  197 (357)
T pfam05913       181 ---LRGPLYEGLPTLEKHRY  197 (357)
T ss_pred             ---CCCCCCCCCCCCHHHCC
T ss_conf             ---66883688774198769


No 190
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional
Probab=43.99  E-value=28  Score=16.52  Aligned_cols=53  Identities=17%  Similarity=0.098  Sum_probs=23.1

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEE
Q ss_conf             1655533357822133378899999862026963899725444414799997406614651
Q gi|254780438|r  100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIEL  160 (261)
Q Consensus       100 e~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VEl  160 (261)
                      ++|.-..|-.|+-+ .-.+.|+++-+.   .|+.|--=| .+++|  ++.+.+. +|.+-+
T Consensus        52 K~RTs~~sfrG~G~-egL~~L~~vk~~---~glpi~TdV-h~~~q--~e~v~~~-vDilQI  104 (250)
T PRK13397         52 KPRTSAASFQGLGL-QGIRYLHEVCQE---FGLLSVSEI-MSERQ--LEEAYDY-LDVIQV  104 (250)
T ss_pred             CCCCCCCCCCCCCH-HHHHHHHHHHHH---CCCCEEEEC-CCHHH--HHHHHHH-CCEEEE
T ss_conf             88899977678888-899999999998---399748847-99999--9999844-748987


No 191
>PRK09249 coproporphyrinogen III oxidase; Provisional
Probab=43.65  E-value=28  Score=16.48  Aligned_cols=112  Identities=21%  Similarity=0.294  Sum_probs=63.6

Q ss_pred             CCHHHHHHHHHHHCCCC---CCCEEEEEECC---CHHHHHHHHHHCCCEEEE-EECCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             88899999887400013---67415888348---568999998507212897-101655533357822133378899999
Q gi|254780438|r   52 IRYTDLPEIRRLIDEQF---PKAELNIEGYP---NETFLNLCERYKPEQITL-VPDDPHQLTSDHGWDFLQNQALLTKTV  124 (261)
Q Consensus        52 I~~~Dv~~l~~~~~~~~---~~~elNiEg~p---~~e~i~ia~~ikP~qvtL-VPe~r~elTTegGldv~~~~~~L~~~i  124 (261)
                      ..++++..|-..+...|   ++.|+-+|++|   +++.++...+.--+.+.| |-+-.+++---  ++-....+.....+
T Consensus       118 L~~~~l~~l~~~l~~~f~~~~~~EitiE~nP~~~~~~~l~~l~~~GvnRiSlGVQsfd~~vl~~--igR~h~~~~~~~~i  195 (456)
T PRK09249        118 LSPEQLTRLMALLREHFNFAPDAEISIEIDPRELDLEMLDALRELGFNRLSLGVQDFDPEVQKA--INRIQPFELTFALV  195 (456)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCHHHHHH--HCCCCCHHHHHHHH
T ss_conf             9999999999999986688988359998434758799999998459756886053578799998--52889999999999


Q ss_pred             HHHCCCCCE-EEE---EECCCC----CCHHHHHHHHCCCCEEEECCCCCHH
Q ss_conf             862026963-899---725444----4147999974066146511211102
Q gi|254780438|r  125 ARLHNLGSR-ISL---FADGNG----NEHSLQAAKLTGADCIELYTGPYGA  167 (261)
Q Consensus       125 ~~l~~~gir-vSL---FIDpd~----~q~~i~~a~~~Gad~VElhTG~Ya~  167 (261)
                      +.+++.|+. +|+   |==|.-    =+.+++.+.++++|+|-+|-  ||.
T Consensus       196 ~~ar~~Gf~~in~DLIyGLP~QT~~~~~~tl~~~~~l~Pdhis~y~--yah  244 (456)
T PRK09249        196 EAARELGFTSINFDLIYGLPKQTPESFARTLEKVLELRPDRLAVFN--YAH  244 (456)
T ss_pred             HHHHHCCCCCCCHHHHHCCCCCCHHHHHHHHHHHHCCCCCEEEECC--CCC
T ss_conf             9999819972104886069987699999999999655998899502--234


No 192
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only]
Probab=43.32  E-value=29  Score=16.45  Aligned_cols=186  Identities=18%  Similarity=0.208  Sum_probs=98.1

Q ss_pred             CCCCCCHHHH----HHHHHHCCCCEEEEECCCCCCCCC------HHH----HHHHHHHHCCCCCCCEEEEEECCCHHHHH
Q ss_conf             8868998999----999997499899982478833488------899----99988740001367415888348568999
Q gi|254780438|r   20 NLPWPNLVHI----GKIALQSGASGLTVHPRPDQRHIR------YTD----LPEIRRLIDEQFPKAELNIEGYPNETFLN   85 (261)
Q Consensus        20 g~~~P~~~~~----a~~~~~~GadgITvH~R~DrRHI~------~~D----v~~l~~~~~~~~~~~elNiEg~p~~e~i~   85 (261)
                      +++.+.+++.    |...+++|+|+|-+-=--|----+      -.-    +.++...+.  . .+-.|+=-|-.-.-..
T Consensus        26 ~~~~~~vid~A~~dA~~leegG~DavivEN~gD~Pf~k~v~~~tvaaMa~iv~~v~r~v~--i-PvGvNVLrNd~vaA~~  102 (263)
T COG0434          26 AGSLEAVIDRAVRDAAALEEGGVDAVIVENYGDAPFLKDVGPETVAAMAVIVREVVREVS--I-PVGVNVLRNDAVAALA  102 (263)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC--C-CCEEEEECCCCHHHHH
T ss_conf             678799999999899999848976899713578877777974788999999999987507--6-6103210266288899


Q ss_pred             HHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECC-----------CCCCHHHHHHHHCC
Q ss_conf             9985072128971016555333578221333788999998620269638997254-----------44414799997406
Q gi|254780438|r   86 LCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADG-----------NGNEHSLQAAKLTG  154 (261)
Q Consensus        86 ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDp-----------d~~q~~i~~a~~~G  154 (261)
                      ||....-+++-. ----+-.-||-|+ +..+...+.....+|.   .+|.+|-|-           +.++-..+..-.-+
T Consensus       103 IA~a~gA~FIRV-N~~tg~~~tdqGi-ieg~A~e~~r~r~~L~---~~v~vlADv~VKHa~~l~~~~~~~~v~dtver~~  177 (263)
T COG0434         103 IAYAVGADFIRV-NVLTGAYATDQGI-IEGNAAELARYRARLG---SRVKVLADVHVKHAVHLGNRSLEEAVKDTVERGL  177 (263)
T ss_pred             HHHHCCCCEEEE-EEEECEEECCCCC-CCCHHHHHHHHHHHCC---CCCEEEEECHHHCCCCCCCCCHHHHHHHHHHCCC
T ss_conf             998607977998-7343427635650-1444889999898616---7737976111321532378688999999997048


Q ss_pred             CCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHH
Q ss_conf             6146511211102444356433666889998766541562352078989877999997369963884259999
Q gi|254780438|r  155 ADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFA  227 (261)
Q Consensus       155 ad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiI  227 (261)
                      +|.|= -||.-.-   .+ -...||+.   +.+.+.   +-|-+|-|.|++|+..+++ +  -+-+-+|-+|=
T Consensus       178 aDaVI-~tG~~TG---~~-~d~~el~~---a~~~~~---~pvlvGSGv~~eN~~~~l~-~--adG~IvgT~lK  236 (263)
T COG0434         178 ADAVI-VTGSRTG---SP-PDLEELKL---AKEAVD---TPVLVGSGVNPENIEELLK-I--ADGVIVGTSLK  236 (263)
T ss_pred             CCEEE-EECCCCC---CC-CCHHHHHH---HHHCCC---CCEEEECCCCHHHHHHHHH-H--CCCEEEEEEEC
T ss_conf             87799-9566678---99-99899999---986269---8789736888889999998-7--28669978660


No 193
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional
Probab=43.29  E-value=29  Score=16.45  Aligned_cols=68  Identities=19%  Similarity=0.228  Sum_probs=33.5

Q ss_pred             CHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEC------CCCCCHHHHHHHHC
Q ss_conf             568999998507212897101655533357822133378899999862026963899725------44441479999740
Q gi|254780438|r   80 NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFAD------GNGNEHSLQAAKLT  153 (261)
Q Consensus        80 ~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFID------pd~~q~~i~~a~~~  153 (261)
                      .++.++++.++.|+-+.+          +=||.+.....  .+.++.|++.+ .  +|.|      |+.-.+.++.+.+.
T Consensus        15 ~~~a~~l~~~l~~~i~~i----------KiG~~l~~~~G--~~~i~~l~~~~-~--If~DlK~~DIpnTv~~~~~~~~~~   79 (215)
T PRK13813         15 REEALKIAEELSDYVDAI----------KVNWPLILASG--LSIIRELKQYT-P--VIADLKVADIPNTNRLICEKVFEA   79 (215)
T ss_pred             HHHHHHHHHHHCCCCEEE----------EECHHHHHHCC--HHHHHHHHHHC-C--EEEEEEECCCHHHHHHHHHHHHHC
T ss_conf             999999999847756099----------98979987549--99999999858-9--079986244637999999999962


Q ss_pred             CCCEEEECC
Q ss_conf             661465112
Q gi|254780438|r  154 GADCIELYT  162 (261)
Q Consensus       154 Gad~VElhT  162 (261)
                      |+|.+=+|.
T Consensus        80 ga~~vTvh~   88 (215)
T PRK13813         80 GADGIIVHG   88 (215)
T ss_pred             CCCEEEEEC
T ss_conf             999999925


No 194
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases. FSA catalyze an aldol cleavage of fructose 6-phosphate and do not utilize fructose, fructose 1-phosphate, fructose 1,6-phosphate, or dihydroxyacetone phosphate. The enzymes belong to the transaldolase family that serves in transfer reactions in the pentose phosphate cycle, and are more distantly related to fructose 1,6-bisphosphate aldolase.
Probab=43.13  E-value=29  Score=16.43  Aligned_cols=188  Identities=17%  Similarity=0.194  Sum_probs=115.5

Q ss_pred             CHHHHHHHHHHCC-CCEEEEECCCCCCCC--CHHH-HHHHHHHHCCCCCCCEEEEEECCC--HHHHHHHH---HHCCCEE
Q ss_conf             9899999999749-989998247883348--8899-999887400013674158883485--68999998---5072128
Q gi|254780438|r   25 NLVHIGKIALQSG-ASGLTVHPRPDQRHI--RYTD-LPEIRRLIDEQFPKAELNIEGYPN--ETFLNLCE---RYKPEQI   95 (261)
Q Consensus        25 ~~~~~a~~~~~~G-adgITvH~R~DrRHI--~~~D-v~~l~~~~~~~~~~~elNiEg~p~--~e~i~ia~---~ikP~qv   95 (261)
                      |+-+..+ +.+.| .+|+|--|-==+|-=  ...+ +..++++.     +.++-+|-..+  ++|++-+.   +..|+.+
T Consensus         8 d~~~i~~-~~~~g~i~GvTTNPsll~k~g~~~~~~~~~~i~~~~-----~~~ls~qv~~~~~~~m~~~a~~l~~~~~ni~   81 (211)
T cd00956           8 DLEEIKK-ASETGLLDGVTTNPSLIAKSGRIDFEAVLKEICEII-----DGPVSAQVVSTDAEGMVAEARKLASLGGNVV   81 (211)
T ss_pred             CHHHHHH-HHCCCCCCEECCCHHHHHHCCCCCHHHHHHHHHHHC-----CCCEEEEEEECCHHHHHHHHHHHHHHCCCEE
T ss_conf             9999999-864899375826889998749999999999999854-----9988999973879999999999997389579


Q ss_pred             EEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHH
Q ss_conf             97101655533357822133378899999862026963899725444414799997406614651121110244435643
Q gi|254780438|r   96 TLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE  175 (261)
Q Consensus        96 tLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~  175 (261)
                      -=+|-.     .+ |          -+.++.|++.||+|.+=.=-.+.|  .-.|.+.|++.|-.|.|.-.+.-.++.  
T Consensus        82 vKIP~t-----~~-g----------l~ai~~L~~~gi~~n~Tav~s~~Q--a~~Aa~aga~yvspf~GRi~d~G~d~~--  141 (211)
T cd00956          82 VKIPVT-----ED-G----------LKAIKKLSEEGIKTNVTAIFSAAQ--ALLAAKAGATYVSPFVGRIDDLGGDGM--  141 (211)
T ss_pred             EEECCC-----HH-H----------HHHHHHHHHCCCCEEEEEECCHHH--HHHHHHCCCCEEEEECCCHHHCCCCHH--
T ss_conf             992685-----65-9----------999999998599767775068999--999998799788630340754589859--


Q ss_pred             HHHHHHHHHHHHHHHHC--CCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHH-HHHHHHHH
Q ss_conf             36668899987665415--62352078989877999997369963884259999999994099-99999999
Q gi|254780438|r  176 RIFLNKLAITAQLAQKM--DLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVK-EAVFCFRR  244 (261)
Q Consensus       176 ~~el~~i~~aa~~A~~l--gL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~-~aI~~~~~  244 (261)
                          +-++++..+....  .-+|-|+-==|.+++....  .-+.+-+-|...+..+.+..-+. +++++|.+
T Consensus       142 ----~~i~~~~~~~~~~~~~tkiL~AS~R~~~~v~~a~--~~G~d~iTip~~vl~~l~~~~~T~~~v~~F~~  207 (211)
T cd00956         142 ----ELIREIRTIFDNYGFDTKILAASIRNPQHVIEAA--LAGADAITLPPDVLEQLLKHPLTDKGVEKFLE  207 (211)
T ss_pred             ----HHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHH--HCCCCEEECCHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             ----9999999999982998268852048899999999--86999998499999999769038999999999


No 195
>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane]
Probab=42.74  E-value=29  Score=16.39  Aligned_cols=16  Identities=19%  Similarity=0.243  Sum_probs=8.6

Q ss_pred             HHHHHHCCCCEEEEEC
Q ss_conf             9999974998999824
Q gi|254780438|r   30 GKIALQSGASGLTVHP   45 (261)
Q Consensus        30 a~~~~~~GadgITvH~   45 (261)
                      ...|-++|||-|-.-.
T Consensus        36 IdaAk~aGADavKfQt   51 (347)
T COG2089          36 IDAAKEAGADAVKFQT   51 (347)
T ss_pred             HHHHHHCCCCEEEEEC
T ss_conf             9999973866555320


No 196
>pfam00697 PRAI N-(5'phosphoribosyl)anthranilate (PRA) isomerase.
Probab=42.69  E-value=29  Score=16.39  Aligned_cols=163  Identities=17%  Similarity=0.180  Sum_probs=83.9

Q ss_pred             HHHHHHHHHCCCCEEEE-ECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCC-HHHHHHHHHHCCCEEEEEECCCCC
Q ss_conf             99999999749989998-2478833488899999887400013674158883485-689999985072128971016555
Q gi|254780438|r   27 VHIGKIALQSGASGLTV-HPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPN-ETFLNLCERYKPEQITLVPDDPHQ  104 (261)
Q Consensus        27 ~~~a~~~~~~GadgITv-H~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~-~e~i~ia~~ikP~qvtLVPe~r~e  104 (261)
                      .+-+..|.++|||-|=+ +-..-.|+|..+....|.+.+..   ++ .-+=.+++ +++.+++....|+.+-|-=+... 
T Consensus         9 ~ed~~~~~~~gad~iGfif~~~SpR~i~~~~a~~i~~~~~~---~~-VgVfv~~~~~~i~~~~~~~~~d~vQlHG~e~~-   83 (195)
T pfam00697         9 IEDVVAAVPAGADYLGLIFAPSSKRQVFPEQAQELRSAVPL---LL-VGVFVNQPIEEVLRIAQVLGLDVVQLHGDEPQ-   83 (195)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHCCC---CE-EEEECCCCHHHHHHHHHHCCCCEEEECCCCCH-
T ss_conf             99999999589999988357999988799999999975898---65-99984786899999998379987998899998-


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHCC-CCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHH-HHHHHH
Q ss_conf             3335782213337889999986202-69638997254444147999974066146511211102444356433-666889
Q gi|254780438|r  105 LTSDHGWDFLQNQALLTKTVARLHN-LGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER-IFLNKL  182 (261)
Q Consensus       105 lTTegGldv~~~~~~L~~~i~~l~~-~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~-~el~~i  182 (261)
                                   ++    +..++. ..+-..+-+..+.+.. -.....-.+|.+=|-+.+-.    .+.... ..+.++
T Consensus        84 -------------~~----~~~~~~~~~~ikai~~~~~~~~~-~~~~~~~~~d~~L~Ds~~GG----tG~~fdw~~~~~~  141 (195)
T pfam00697        84 -------------EY----ANLLPTGVPVIKAFHVPASVDDA-DLARRADHVDLPLLDSGQGG----TGKLFDWSLISKL  141 (195)
T ss_pred             -------------HH----HHHHHHCCCCEEEEEECCCCCHH-HHHHHCCCCCEEEECCCCCC----CCCCCCHHHHHHH
T ss_conf             -------------99----99998468833899947860658-89873303125511267898----8775489998655


Q ss_pred             HHHHHHHHHCCCEEEECCCCCHHHHHHHHHHC-CCCEEEEEH
Q ss_conf             99876654156235207898987799999736-996388425
Q gi|254780438|r  183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAI-PYISEISVG  223 (261)
Q Consensus       183 ~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~I-p~I~EvsIG  223 (261)
                      .      . ....+=-.=|||.+|+...++.. |.--.||=|
T Consensus       142 ~------~-~~~~~~LAGGL~~~NV~~ai~~~~p~gVDvsSG  176 (195)
T pfam00697       142 L------L-SGLPVILAGGLTPENVSEAIQTLGPAGVDVSSG  176 (195)
T ss_pred             H------H-CCCCEEEECCCCHHHHHHHHHHCCCCEEEECCC
T ss_conf             5------2-168789946889899999998529989994070


No 197
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional
Probab=42.51  E-value=28  Score=16.51  Aligned_cols=110  Identities=14%  Similarity=0.130  Sum_probs=48.8

Q ss_pred             HHHHHHHHHHCCCEEEEE-ECCCCCCCCCCCCCHHH--HHHHHHHHHHHHCCCCCEE-EEEECCCCCCHHHHHHHHCCCC
Q ss_conf             689999985072128971-01655533357822133--3788999998620269638-9972544441479999740661
Q gi|254780438|r   81 ETFLNLCERYKPEQITLV-PDDPHQLTSDHGWDFLQ--NQALLTKTVARLHNLGSRI-SLFADGNGNEHSLQAAKLTGAD  156 (261)
Q Consensus        81 ~e~i~ia~~ikP~qvtLV-Pe~r~elTTegGldv~~--~~~~L~~~i~~l~~~girv-SLFIDpd~~q~~i~~a~~~Gad  156 (261)
                      +.+++.|..+|..-+++. ----.-.||-+.|.=.+  -.+.|.++-   ++.|..+ +=..  |++|  ++.+.+. +|
T Consensus       115 eq~~~~A~~vk~~Ga~~lRgGa~KPRTsPysFqGlGeeGL~~L~~ak---~e~GLpvvTEV~--~~~~--ve~v~~~-~D  186 (352)
T PRK13396        115 EMIVETAKRVKAAGAKFLRGGAYKPRTSPYAFQGHGESALELLAAAR---EATGLGIITEVM--DAAD--LDKIAEV-AD  186 (352)
T ss_pred             HHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCCCCHHHHHHHHHHH---HHHCCCEEEEEC--CHHH--HHHHHHH-CC
T ss_conf             99999999999839987826502478998543587087999999999---986997268867--9999--9999865-88


Q ss_pred             EEEECCCCCHHHHHH-------------HHHHHHHHHHHHHHHHHHHHCC----CEEEEC
Q ss_conf             465112111024443-------------5643366688999876654156----235207
Q gi|254780438|r  157 CIELYTGPYGACYNN-------------PQQERIFLNKLAITAQLAQKMD----LQINAG  199 (261)
Q Consensus       157 ~VElhTG~Ya~a~~~-------------~~~~~~el~~i~~aa~~A~~lg----L~VnAG  199 (261)
                      .+-+=+-.-- .|.-             ++-....++....+++|..+-|    +-|+=|
T Consensus       187 ilQIGARn~q-Nf~LL~~~g~t~kPVllKrg~~~ti~ewl~AaEyi~~~Gn~~viLcERG  245 (352)
T PRK13396        187 VIQVGARNMQ-NFSLLKKVGAQDKPVLLKRGMSATIDEWLMAAEYILAAGNPNVILCERG  245 (352)
T ss_pred             EEEECCHHHC-CHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             8998925405-9999999854698079737888999999869999997699858999489


No 198
>PRK13347 coproporphyrinogen III oxidase; Provisional
Probab=42.40  E-value=29  Score=16.36  Aligned_cols=103  Identities=17%  Similarity=0.307  Sum_probs=47.0

Q ss_pred             CHHHHHHHHHHHCCCC---CCCEEEEEECCC---HHHHHHHHHHCCCEEEE-----EECCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             8899999887400013---674158883485---68999998507212897-----101655533357822133378899
Q gi|254780438|r   53 RYTDLPEIRRLIDEQF---PKAELNIEGYPN---ETFLNLCERYKPEQITL-----VPDDPHQLTSDHGWDFLQNQALLT  121 (261)
Q Consensus        53 ~~~Dv~~l~~~~~~~~---~~~elNiEg~p~---~e~i~ia~~ikP~qvtL-----VPe~r~elTTegGldv~~~~~~L~  121 (261)
                      .++++..|-..+...|   ++.|+-+|++|.   .+.+....+.-=+.+-|     .|+-...+--      ....+...
T Consensus       118 ~~~~l~~ll~~l~~~f~~~~~~EitiE~nP~~~~~~~l~~l~~~GvNRlSlGVQsfd~~vl~~lgR------~h~~~~~~  191 (453)
T PRK13347        118 NPDQFERLMAALRDAFDFAPEAEIAVEIDPRTVTAEMLQALAALGFNRASFGVQDFDPQVQKAINR------IQPEEMVA  191 (453)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHHCC------CCCHHHHH
T ss_conf             999999999999975899999669998677868999999998649865887134578789998259------89999999


Q ss_pred             HHHHHHCCCCCE-EEE-EECCCCCC------HHHHHHHHCCCCEEEEC
Q ss_conf             999862026963-899-72544441------47999974066146511
Q gi|254780438|r  122 KTVARLHNLGSR-ISL-FADGNGNE------HSLQAAKLTGADCIELY  161 (261)
Q Consensus       122 ~~i~~l~~~gir-vSL-FIDpd~~q------~~i~~a~~~Gad~VElh  161 (261)
                      ..++.+++.|.. +|+ +|---|.|      .+|+.+.++++|+|-+|
T Consensus       192 ~av~~ar~~Gf~~iniDLIyGlP~QT~~~~~~tL~~~~~l~pdhiS~Y  239 (453)
T PRK13347        192 RAVELLRAAGFESINFDLIYGLPHQTVESFRETLDKVIALSPDRIAVF  239 (453)
T ss_pred             HHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             999999981898655555524899989999999999983199978852


No 199
>PRK11170 nagA N-acetylglucosamine-6-phosphate deacetylase; Provisional
Probab=42.39  E-value=29  Score=16.36  Aligned_cols=61  Identities=16%  Similarity=0.269  Sum_probs=41.2

Q ss_pred             CCHHHHHHHHHHC--CCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEE-EECCCCCCHHHHHHHHCCC
Q ss_conf             8568999998507--212897101655533357822133378899999862026963899-7254444147999974066
Q gi|254780438|r   79 PNETFLNLCERYK--PEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISL-FADGNGNEHSLQAAKLTGA  155 (261)
Q Consensus        79 p~~e~i~ia~~ik--P~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSL-FIDpd~~q~~i~~a~~~Ga  155 (261)
                      |+.++++...+..  ...+||=||.+       |      .    +.++.|.+.||.||+ .=+++.+|  ...|.+-|+
T Consensus       151 p~~e~~~~l~~~~~~i~~vTlAPE~~-------~------~----e~i~~l~~~GI~vs~GHS~A~y~~--~~~A~~~Ga  211 (381)
T PRK11170        151 PDAEMVDFLCENADVITKVTLAPEMV-------D------A----EVISKLVKAGIVVSAGHSNATYKE--AKAGFRAGI  211 (381)
T ss_pred             CCHHHHHHHHHCCCCEEEEEECCCCC-------C------H----HHHHHHHHCCCEEEEECCCCCHHH--HHHHHHCCC
T ss_conf             89999999985169757999788888-------8------8----999999988998988558899999--999998699


Q ss_pred             CEE
Q ss_conf             146
Q gi|254780438|r  156 DCI  158 (261)
Q Consensus       156 d~V  158 (261)
                      ..+
T Consensus       212 ~~~  214 (381)
T PRK11170        212 TFA  214 (381)
T ss_pred             CEE
T ss_conf             861


No 200
>PRK12457 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional
Probab=42.25  E-value=22  Score=17.30  Aligned_cols=25  Identities=16%  Similarity=0.117  Sum_probs=15.1

Q ss_pred             HHHHHHCCCCE--EEECCCCCHHHHHHH
Q ss_conf             99997406614--651121110244435
Q gi|254780438|r  147 LQAAKLTGADC--IELYTGPYGACYNNP  172 (261)
Q Consensus       147 i~~a~~~Gad~--VElhTG~Ya~a~~~~  172 (261)
                      -.+|...|+|.  ||.|--|= +|+.+.
T Consensus       223 a~Aava~GadGlfiEvHp~P~-~AlSDg  249 (281)
T PRK12457        223 ARAGMAVGLAGLFLEAHPDPD-RARCDG  249 (281)
T ss_pred             HHHHHHHCCCEEEEEECCCCC-CCCCCH
T ss_conf             999998088889998379824-378860


No 201
>PRK05198 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional
Probab=42.11  E-value=26  Score=16.77  Aligned_cols=46  Identities=11%  Similarity=0.211  Sum_probs=17.8

Q ss_pred             HHHHHHHHHHCC----CEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHH
Q ss_conf             999876654156----235207898987799999736996388425999999
Q gi|254780438|r  182 LAITAQLAQKMD----LQINAGHDLTIQNIPNLINAIPYISEISVGHAFAAT  229 (261)
Q Consensus       182 i~~aa~~A~~lg----L~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIse  229 (261)
                      +..++++..+.|    +-+.=|---.|.|+..-+..||.++|.  ||-+|.|
T Consensus       140 ~~~a~eki~~~Gn~~v~lcERG~~fgY~~lvvD~~~i~~lk~~--~~PVi~D  189 (264)
T PRK05198        140 MKNVVDKVRETGNDKIILCERGTSFGYNNLVVDMRGLPIMRET--GAPVIFD  189 (264)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHC--CCCCEEC
T ss_conf             9999999997499849998489986888763126778999852--8982665


No 202
>PRK11359 cAMP phosphodiesterase; Provisional
Probab=41.75  E-value=30  Score=16.29  Aligned_cols=44  Identities=14%  Similarity=0.067  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEEC
Q ss_conf             788999998620269638997254444147999974066146511
Q gi|254780438|r  117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELY  161 (261)
Q Consensus       117 ~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElh  161 (261)
                      ...+...+..|++.|+++||==. ..--.++.+.+.+.+|.|-|-
T Consensus       677 ~~~~~~~l~~lr~~G~~ialDDF-GtGyssl~~L~~lp~d~iKiD  720 (799)
T PRK11359        677 DTEIFKRIQILRDMGVGLSVDDF-GTGFSGLSRLVSLPVTEIKID  720 (799)
T ss_pred             HHHHHHHHHHHHHCCCEEEEECC-CCCHHHHHHHHHCCCCEEEEC
T ss_conf             99999999999978998999899-998678999973899899989


No 203
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism]
Probab=41.66  E-value=23  Score=17.15  Aligned_cols=142  Identities=15%  Similarity=0.208  Sum_probs=61.2

Q ss_pred             CCCCHHHHHHHHHHCC-CCEEEEEC----CCCCCCCC-H-HHHHHHHHHHCCCCCCCEEEEEECCC-HHHHHHH---HHH
Q ss_conf             6899899999999749-98999824----78833488-8-99999887400013674158883485-6899999---850
Q gi|254780438|r   22 PWPNLVHIGKIALQSG-ASGLTVHP----RPDQRHIR-Y-TDLPEIRRLIDEQFPKAELNIEGYPN-ETFLNLC---ERY   90 (261)
Q Consensus        22 ~~P~~~~~a~~~~~~G-adgITvH~----R~DrRHI~-~-~Dv~~l~~~~~~~~~~~elNiEg~p~-~e~i~ia---~~i   90 (261)
                      ......+.+...++++ ||.|++-.    -|--|-++ + +-+.+|.+-+++. .++|+=+-.+|+ ++|.++|   .+.
T Consensus       107 ~~~~~~d~~~~~~~~~~ad~ielNiScPnt~g~~~l~~~~e~l~~l~~~vk~~-~~~Pv~vKl~P~~~di~~iA~~~~~~  185 (310)
T COG0167         107 SEEAWADYARLLEEAGDADAIELNISCPNTPGGRALGQDPELLEKLLEAVKAA-TKVPVFVKLAPNITDIDEIAKAAEEA  185 (310)
T ss_pred             CHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHC-CCCCEEEEECCCHHHHHHHHHHHHHC
T ss_conf             57889999999975077887999853899977466543999999999999863-56865999388889999999999974


Q ss_pred             CCCEEEEEECCC----CCCCC--------CCCCCHHHHHHHHHHHHHHHCCC-CCEEEEE----ECCCCCCHHHHHHHHC
Q ss_conf             721289710165----55333--------57822133378899999862026-9638997----2544441479999740
Q gi|254780438|r   91 KPEQITLVPDDP----HQLTS--------DHGWDFLQNQALLTKTVARLHNL-GSRISLF----ADGNGNEHSLQAAKLT  153 (261)
Q Consensus        91 kP~qvtLVPe~r----~elTT--------egGldv~~~~~~L~~~i~~l~~~-girvSLF----IDpd~~q~~i~~a~~~  153 (261)
                      .-|-++++=-..    -.+.+        -||+.=..-+..-..+|..+... +.++-+.    |+.  -+..++. ...
T Consensus       186 g~Dgl~~~NT~~~~~~i~~~~~~~~~~~~~GGLSG~~ikp~al~~v~~l~~~~~~~ipIIGvGGI~s--~~DA~E~-i~a  262 (310)
T COG0167         186 GADGLIAINTTKSGMKIDLETKKPVLANETGGLSGPPLKPIALRVVAELYKRLGGDIPIIGVGGIET--GEDALEF-ILA  262 (310)
T ss_pred             CCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEECCCCC--HHHHHHH-HHC
T ss_conf             9858999700366553012345556676777757510027899999999984289974898468696--9999999-982


Q ss_pred             CCCEEEECCCCCHH
Q ss_conf             66146511211102
Q gi|254780438|r  154 GADCIELYTGPYGA  167 (261)
Q Consensus       154 Gad~VElhTG~Ya~  167 (261)
                      ||+.|.+||+-|-+
T Consensus       263 GA~~vQv~Tal~~~  276 (310)
T COG0167         263 GASAVQVGTALIYK  276 (310)
T ss_pred             CCCHHEEEEEEEEE
T ss_conf             97564041121020


No 204
>pfam06506 PrpR_N Propionate catabolism activator. This domain is found at the N terminus of several sigma54- dependent transcriptional activators including PrpR, which activates catabolism of propionate.
Probab=41.55  E-value=30  Score=16.27  Aligned_cols=125  Identities=18%  Similarity=0.215  Sum_probs=68.2

Q ss_pred             CCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCE-EEEEECCCH--HHHHHHHHHCCCEEEEE
Q ss_conf             689989999999974998999824788334888999998874000136741-588834856--89999985072128971
Q gi|254780438|r   22 PWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAE-LNIEGYPNE--TFLNLCERYKPEQITLV   98 (261)
Q Consensus        22 ~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~e-lNiEg~p~~--e~i~ia~~ikP~qvtLV   98 (261)
                      ++-+-++.|+..++.|+|=|--      |   -.-...|++.+     ++| ..++...++  ..+..+.++.+. +-+|
T Consensus        17 ~l~~av~~a~~~~~~g~dvIIs------R---Ggta~~ir~~~-----~iPVv~I~~s~~Dil~al~~a~~~~~k-iavv   81 (169)
T pfam06506        17 GLEDAVEVARALVAEGVDVIIS------R---GGTAAYLRDRL-----SVPVVEIKVSGFDLLRALARARRYGGR-IGLV   81 (169)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEE------C---CHHHHHHHHHC-----CCCEEEEECCHHHHHHHHHHHHHHCCC-EEEE
T ss_conf             7899999999999779959998------9---65899999858-----998899827886999999999975897-9999


Q ss_pred             ECC-----CCCCCCCCCCCH----HHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCH
Q ss_conf             016-----555333578221----33378899999862026963899725444414799997406614651121110
Q gi|254780438|r   99 PDD-----PHQLTSDHGWDF----LQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG  166 (261)
Q Consensus        99 Pe~-----r~elTTegGldv----~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya  166 (261)
                      -=.     -..+..=-|.++    ..+.+.+...++.+++.|+.  .+|-+..   ..+.|.+.|.+.|.+++|.-+
T Consensus        82 g~~~~~~~~~~~~~il~~~i~~~~~~~~~e~~~~i~~l~~~G~~--vvVG~~~---~~~~A~~~Gl~~vli~sg~eS  153 (169)
T pfam06506        82 GYENIIPGLKALSELLGLDIVQRAYQSEEEARAAVKELKAQGIK--VIVGDGL---VCDLAEQAGLQGVLIYSGKES  153 (169)
T ss_pred             ECCCCCHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCE--EEECCCH---HHHHHHHCCCCEEEEECCHHH
T ss_conf             27630368999999969935999966889999999999986995--9985828---999999839957999667899


No 205
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism]
Probab=41.52  E-value=30  Score=16.27  Aligned_cols=29  Identities=21%  Similarity=0.190  Sum_probs=25.6

Q ss_pred             CCCCCCHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             88689989999999974998999824788
Q gi|254780438|r   20 NLPWPNLVHIGKIALQSGASGLTVHPRPD   48 (261)
Q Consensus        20 g~~~P~~~~~a~~~~~~GadgITvH~R~D   48 (261)
                      -+.|||+-........+|++-+||-+|--
T Consensus        23 Tgky~s~~~~~~av~asg~~ivTvAlRR~   51 (262)
T COG2022          23 TGKYPSPAVLAEAVRASGSEIVTVALRRV   51 (262)
T ss_pred             CCCCCCHHHHHHHHHHCCCCEEEEEEEEE
T ss_conf             47899989999999972786699998862


No 206
>PRK11059 regulatory protein CsrD; Provisional
Probab=41.13  E-value=31  Score=16.23  Aligned_cols=82  Identities=15%  Similarity=0.088  Sum_probs=37.7

Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             33378899999862026963899725444414799997406614651121110244435643366688999876654156
Q gi|254780438|r  114 LQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMD  193 (261)
Q Consensus       114 ~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lg  193 (261)
                      ..|.+.+.+++..|++.|+++++==. ...-.++.+.+++.+|.|-||- .|-.......+...   -++.....|+++|
T Consensus       531 ~~~~~~~~~~l~~L~~lG~~~aiDdF-G~g~sSl~YLk~lpvd~LKID~-SfVr~I~~~~enq~---~V~sIi~~a~~l~  605 (642)
T PRK11059        531 VQHIDRLRPVLRMLRGLGCRLAVDQA-GLTVVSTSYIKELNVELIKLHP-SLVRNIHQRTENQL---FVRSLVGACAGTE  605 (642)
T ss_pred             HHCHHHHHHHHHHHHHCCCEEEEECC-CCCHHHHHHHHHCCCCEEEECH-HHHCCCCCCCCCHH---HHHHHHHHHHHCC
T ss_conf             64899999999999976987999899-9976668999639999999888-88637126931079---9999999998679


Q ss_pred             CEEEECC
Q ss_conf             2352078
Q gi|254780438|r  194 LQINAGH  200 (261)
Q Consensus       194 L~VnAGH  200 (261)
                      +.|-|=.
T Consensus       606 ~~VIAEG  612 (642)
T PRK11059        606 TQVFAEG  612 (642)
T ss_pred             CEEEEEE
T ss_conf             9799962


No 207
>cd06061 PurM-like1 AIR synthase (PurM) related protein, subgroup 1 of unknown function. The family of PurM related proteins includes Hydrogen expression/formation protein HypE, AIR synthases, FGAM synthase and Selenophosphate synthetase (SelD). They all contain two conserved domains and seem to dimerize. The N-terminal domain forms the dimer interface and is a putative ATP binding domain.
Probab=41.03  E-value=31  Score=16.22  Aligned_cols=11  Identities=36%  Similarity=0.292  Sum_probs=6.6

Q ss_pred             CEEEECCCCCH
Q ss_conf             23520789898
Q gi|254780438|r  194 LQINAGHDLTI  204 (261)
Q Consensus       194 L~VnAGHgLn~  204 (261)
                      ..+||-||.+=
T Consensus       208 ~~v~a~~Dis~  218 (298)
T cd06061         208 AGVTAMHDATE  218 (298)
T ss_pred             CCCEEEEECCC
T ss_conf             57559871675


No 208
>PRK01060 endonuclease IV; Provisional
Probab=40.74  E-value=31  Score=16.19  Aligned_cols=172  Identities=16%  Similarity=0.226  Sum_probs=102.4

Q ss_pred             CHHHHHHHHHHCCCCEEEEECCCCCCC----CCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEEC
Q ss_conf             989999999974998999824788334----8889999988740001367415888348568999998507212897101
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTVHPRPDQRH----IRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPD  100 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITvH~R~DrRH----I~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe  100 (261)
                      .+..++..+.+.||+.+-+-++.-|.-    +.+.++...++.+...      ++               .|  .++|+-
T Consensus        13 G~~~a~~~a~~~g~~~~QiF~~npr~w~~~~~~~~~~~~f~~~~~~~------~~---------------~~--~~iv~H   69 (281)
T PRK01060         13 GLENAPAEAAEIGANAFMIFTGNPQQWKRKPLEELNIEAFKAACEKY------GI---------------SP--EDILVH   69 (281)
T ss_pred             CHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHC------CC---------------CC--CCEEEE
T ss_conf             59999999997599899987899888999999989999999999981------99---------------97--545752


Q ss_pred             CCCCCCCCCCCCHHH-HHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             655533357822133-3788999998620269638997254444147999974066146511211102444356433666
Q gi|254780438|r  101 DPHQLTSDHGWDFLQ-NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFL  179 (261)
Q Consensus       101 ~r~elTTegGldv~~-~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el  179 (261)
                      .+==      .|+.+ +.+...+.++.|.+                .++.+..+|++.+=+|.|.+...   .. ++.-+
T Consensus        70 a~Yl------INLasp~~~~~~kS~~~l~~----------------el~r~~~lG~~~vV~HpGs~~g~---~~-~~~gi  123 (281)
T PRK01060         70 APYL------INLGNPNPEKLEKSRDALID----------------EIERCEALGAKLLNFHPGSHLGA---ID-EADCL  123 (281)
T ss_pred             CCCE------ECCCCCCHHHHHHHHHHHHH----------------HHHHHHHCCCCEEEECCCCCCCC---CC-HHHHH
T ss_conf             4532------32689987899999999999----------------99999980998598457633688---87-99999


Q ss_pred             HHHHHHHHHH------HHCCCEEEECCC----CCHHHHHHHHHHCCCCEEEE----------EHHHHHHHHHHHHHHHHH
Q ss_conf             8899987665------415623520789----89877999997369963884----------259999999994099999
Q gi|254780438|r  180 NKLAITAQLA------QKMDLQINAGHD----LTIQNIPNLINAIPYISEIS----------VGHAFAATALECGVKEAV  239 (261)
Q Consensus       180 ~~i~~aa~~A------~~lgL~VnAGHg----Ln~~Nl~~~i~~Ip~I~Evs----------IGHaiIseAl~~GL~~aI  239 (261)
                      +++.++...+      ..+=|+--||-|    -+++.++.++..++.=+-|-          =|.-|.     -|+++++
T Consensus       124 ~~i~~~l~~~l~~~~~~~ilLEn~AGqG~~lG~~~eeL~~ii~~v~~~~rvGvClDTcH~faAGydi~-----~~~~~~~  198 (281)
T PRK01060        124 DRIAESLNEALDKTQGVTIVLENTAGQGSELGRRFEELARIIDGVEDKSRVGVCLDTCHAFAAGYDLR-----EDFEGVL  198 (281)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHCCCCCCEEEEEECHHHHHCCCCHH-----HHHHHHH
T ss_conf             99999999998158986799972489998268789999999996268464488741143443345378-----8999999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999997410
Q gi|254780438|r  240 FCFRRACGQHL  250 (261)
Q Consensus       240 ~~~~~ii~~~~  250 (261)
                      .++-+.+.-.+
T Consensus       199 ~~fd~~iGl~~  209 (281)
T PRK01060        199 NEFDKIVGLDY  209 (281)
T ss_pred             HHHHHHCCHHH
T ss_conf             99998507655


No 209
>PRK06806 fructose-bisphosphate aldolase; Provisional
Probab=40.54  E-value=31  Score=16.17  Aligned_cols=192  Identities=16%  Similarity=0.137  Sum_probs=110.9

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHC----CCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEECC
Q ss_conf             8999999997499899982478833488899999887400----013674158883485689999985072128971016
Q gi|254780438|r   26 LVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLID----EQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDD  101 (261)
Q Consensus        26 ~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~----~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~  101 (261)
                      ...+..-|++.++.-|--.-..-.+|.   .+..+..++.    ...-.+-+++-=..+-+.+.-+++.-=+.|-+  |.
T Consensus        31 ~~avi~AAee~~sPvIiq~s~~~~~~~---~~~~~~~~~~~~a~~~~VPV~lHLDHg~~~e~i~~ai~~GfsSVM~--Dg  105 (281)
T PRK06806         31 VMGAIKAAEELSSPLILQIAEVRLNHS---PLHMIGPLMVAAAKKATVPVAVHFDHGMTFEKIKEALEIGFTSVMF--DG  105 (281)
T ss_pred             HHHHHHHHHHHCCCEEEECCHHHHCCC---CHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEEEE--EC
T ss_conf             999999999969998999564333246---0999999999999747998899738989999999999829987996--09


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEE------------------EEEECCCCCCHHHHHHHHCCCCEEEECCC
Q ss_conf             555333578221333788999998620269638------------------99725444414799997406614651121
Q gi|254780438|r  102 PHQLTSDHGWDFLQNQALLTKTVARLHNLGSRI------------------SLFADGNGNEHSLQAAKLTGADCIELYTG  163 (261)
Q Consensus       102 r~elTTegGldv~~~~~~L~~~i~~l~~~girv------------------SLFIDpd~~q~~i~~a~~~Gad~VElhTG  163 (261)
                             --+++..|-..-+++++..+..|+-|                  +.|-  +|++ ..+...++|+|+.-+=-|
T Consensus       106 -------S~l~~eeNi~~Tkevve~Ah~~gv~VEaElG~igg~ed~~~~~~~~~T--~pee-a~~Fv~~TgvD~LAvaiG  175 (281)
T PRK06806        106 -------SHYPLEENIQKTKEIVELAKQYGATVEAEIGRVGGSEDGSEDIEMLLT--STEE-AKRFAEETDVDALAVAIG  175 (281)
T ss_pred             -------CCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCC--CHHH-HHHHHHHHCCCEEEEECC
T ss_conf             -------989999999999999999988598699973333774677666675668--9899-999999859989987437


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHH
Q ss_conf             1102444356433666889998766541562352078989877999997369963884259999999994099999999
Q gi|254780438|r  164 PYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF  242 (261)
Q Consensus       164 ~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~  242 (261)
                      .-=-.|...  .+.-++++++..+ +....|-.|-|-|+.-+.+...++  -+|.-+||+-.+     ...+.++++++
T Consensus       176 t~HG~yk~~--p~L~~d~L~~I~~-~~~iPLVLHGgSG~~~e~i~~ai~--~Gi~KiNi~T~l-----~~a~~~~~r~~  244 (281)
T PRK06806        176 NAHGMYNGD--PNLRLDRLQEIND-NVHIPLVLHGGSGISPEDFKQCIQ--HGIRKINVATAT-----FNNVITAVNNL  244 (281)
T ss_pred             CCCCCCCCC--CCCCHHHHHHHHH-HCCCCEEEECCCCCCHHHHHHHHH--CCCEEEEECHHH-----HHHHHHHHHHH
T ss_conf             554565899--8669999999997-289998964999999999999998--698389867578-----99999999999


No 210
>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E; InterPro: IPR011843    This entry describes coenzyme PQQ biosynthesis protein E, a gene required for the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ). PQQ is required for some glucose dehydrogenases and alcohol dehydrogenases.; GO: 0051539 4 iron 4 sulfur cluster binding, 0018189 pyrroloquinoline quinone biosynthetic process.
Probab=40.49  E-value=20  Score=17.49  Aligned_cols=42  Identities=26%  Similarity=0.262  Sum_probs=27.1

Q ss_pred             HHHHHHCCCCCEEEEE-------ECCCCCCHHHHHHHHCCCCEEEECCCCC
Q ss_conf             9998620269638997-------2544441479999740661465112111
Q gi|254780438|r  122 KTVARLHNLGSRISLF-------ADGNGNEHSLQAAKLTGADCIELYTGPY  165 (261)
Q Consensus       122 ~~i~~l~~~girvSLF-------IDpd~~q~~i~~a~~~Gad~VElhTG~Y  165 (261)
                      .+-+..++.|+..-|=       ||- .+ .+|++|.++|||+||+=|=-|
T Consensus       136 ~~A~~v~~~g~PltLN~V~HR~Ni~~-i~-~~i~La~~L~AdrvE~A~~Qy  184 (363)
T TIGR02109       136 AVARAVKAAGLPLTLNFVLHRHNIDQ-IP-EIIELAIELGADRVELATTQY  184 (363)
T ss_pred             HHHHHHHHCCCCEEEEHCCCCCHHHH-HH-HHHHHHHHCCCCEEEEEEECC
T ss_conf             99999996189817602002420213-67-899999863898488874020


No 211
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase; InterPro: IPR006268   These sequences are one of at least three types of phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase). This enzyme catalyzes the first of 7 steps in the biosynthesis of chorismate, that last common precursor of all three aromatic amino acids and of PABA, ubiquinone and menaquinone. Some members of this family, including an experimentally characterised member from Bacillus subtilis, are bifunctional, with a chorismate mutase domain N-terminal to this region. The member of this family from Synechocystis PCC 6803, CcmA, was shown to be essential for carboxysome formation. However, no other candidate for this enzyme is present in that species, chorismate biosynthesis does occur, other species having this protein lack carboxysomes but appear to make chorismate, and a requirement of CcmA for carboxysome formation does not prohibit a role in chorismate biosynthesis.; GO: 0016832 aldehyde-lyase activity, 0009073 aromatic amino acid family biosynthetic process.
Probab=40.38  E-value=26  Score=16.68  Aligned_cols=21  Identities=48%  Similarity=0.915  Sum_probs=10.4

Q ss_pred             HHHHHHHHCCCCEE--EEECCCC
Q ss_conf             99999997499899--9824788
Q gi|254780438|r   28 HIGKIALQSGASGL--TVHPRPD   48 (261)
Q Consensus        28 ~~a~~~~~~GadgI--TvH~R~D   48 (261)
                      -.|+-++-+|||||  =|||-|+
T Consensus       214 plA~AA~A~GADgl~iEVHp~Pe  236 (262)
T TIGR01361       214 PLAKAAIAAGADGLMIEVHPDPE  236 (262)
T ss_pred             HHHHHHHHHCCCEEEEEECCCHH
T ss_conf             99999897574736898667833


No 212
>PRK08493 NADH dehydrogenase subunit G; Validated
Probab=40.29  E-value=29  Score=16.38  Aligned_cols=31  Identities=35%  Similarity=0.296  Sum_probs=25.8

Q ss_pred             CCCCCCHHHHHHHHHH-CCCCEEEEECCCCCC
Q ss_conf             8868998999999997-499899982478833
Q gi|254780438|r   20 NLPWPNLVHIGKIALQ-SGASGLTVHPRPDQR   50 (261)
Q Consensus        20 g~~~P~~~~~a~~~~~-~GadgITvH~R~DrR   50 (261)
                      -.++|-+-...+.|.+ .|+..|.+|||.|.|
T Consensus       382 te~hPV~~~~ik~A~k~~GakLIv~dP~~~~~  413 (819)
T PRK08493        382 KTDNPLLRYAINNALKMNKASGLYFHPIKDNV  413 (819)
T ss_pred             CCCCCHHHHHHHHHHHHCCCEEEEECCCCCHH
T ss_conf             43473899999999984697279976765278


No 213
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional
Probab=40.12  E-value=32  Score=16.12  Aligned_cols=17  Identities=47%  Similarity=0.516  Sum_probs=6.6

Q ss_pred             HHHHCCCC--EEEECCCCC
Q ss_conf             99740661--465112111
Q gi|254780438|r  149 AAKLTGAD--CIELYTGPY  165 (261)
Q Consensus       149 ~a~~~Gad--~VElhTG~Y  165 (261)
                      +|..+|+|  .+|.|--|=
T Consensus       219 aAva~G~dGlfiE~Hp~P~  237 (266)
T PRK13398        219 AAIAAGADGLMIEVHPEPE  237 (266)
T ss_pred             HHHHCCCCEEEEEECCCCC
T ss_conf             9998399889998269802


No 214
>pfam00563 EAL EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues. The EAL domain is a good candidate for a diguanylate phosphodiesterase function. The domain contains many conserved acidic residues that could participate in metal binding and might form the phosphodiesterase active site.
Probab=39.85  E-value=32  Score=16.09  Aligned_cols=121  Identities=19%  Similarity=0.236  Sum_probs=68.5

Q ss_pred             EEEE--EECCCHHHHHHHHH-----HCCCEEEE-EECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCC
Q ss_conf             1588--83485689999985-----07212897-1016555333578221333788999998620269638997254444
Q gi|254780438|r   72 ELNI--EGYPNETFLNLCER-----YKPEQITL-VPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGN  143 (261)
Q Consensus        72 elNi--Eg~p~~e~i~ia~~-----ikP~qvtL-VPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~  143 (261)
                      -+|+  +.-..++|+.....     ..|.++++ ++|.        .+  . +...+...++.|++.|+++++==- ...
T Consensus        88 ~iNl~~~~l~~~~~~~~l~~~~~~~~~~~~l~~Ei~E~--------~~--~-~~~~~~~~i~~lk~~G~~iaiDdf-G~~  155 (233)
T pfam00563        88 SVNLSPASLLDPSFLEALLALKQGGLPPSRLVLEITES--------AL--D-EDLRLLEALARLRSLGFRLALDDF-GTG  155 (233)
T ss_pred             EEECCHHHCCCHHHHHHHHHHHHHCCCHHHEEEEEECH--------HH--C-CCHHHHHHHHHHHHCCCCEEECCC-CCC
T ss_conf             99739787338279999999997598835679997343--------42--2-819999999999977995896178-999


Q ss_pred             CHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHH
Q ss_conf             147999974066146511211102444356433666889998766541562352078989877999
Q gi|254780438|r  144 EHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPN  209 (261)
Q Consensus       144 q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~  209 (261)
                      ..++.....+.+|.|-|.-. +-....++. .   ..-++....+|+++|+.|=|-.==|.+-+..
T Consensus       156 ~~~~~~l~~l~~d~iKid~~-~~~~~~~~~-~---~~~~~~l~~~a~~~~~~viaeGVE~~~~~~~  216 (233)
T pfam00563       156 YSSLSYLSRLPPDYIKIDRS-FIKDLSDPE-S---RALLRALIALARELGIKVVAEGVETEEQLEL  216 (233)
T ss_pred             CCCHHHHHHCCCCEEEECHH-HHHHCCCCC-H---HHHHHHHHHHHHHCCCEEEEEECCCHHHHHH
T ss_conf             76778997488878999899-984077721-8---9999999999998799899970863999999


No 215
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase. This family is a subset of the pfam03102 and is believed to include only authentic NeuB N-acetylneuraminate (sialic acid) synthase enzymes. The majority of the genes identified by this model are observed adjacent to both the NeuA and NeuC genes which together effect the biosynthesis of CMP-N-acetylneuraminate from UDP-N-acetylglucosamine.
Probab=39.56  E-value=32  Score=16.06  Aligned_cols=32  Identities=13%  Similarity=0.035  Sum_probs=20.3

Q ss_pred             HHHCCCCCCCCHHHHHHHHHHCCCCEEEEECC
Q ss_conf             32207886899899999999749989998247
Q gi|254780438|r   15 LRNRRNLPWPNLVHIGKIALQSGASGLTVHPR   46 (261)
Q Consensus        15 LRnaRg~~~P~~~~~a~~~~~~GadgITvH~R   46 (261)
                      +-+.-+|+.=--.+....|.++|||.+-...+
T Consensus         7 Ig~NH~Gdl~~Ak~LI~~A~~sGadaVKFQ~~   38 (329)
T TIGR03569         7 AGVNHNGSLELAKKLVDAAAEAGADAVKFQTF   38 (329)
T ss_pred             ECCCCCCCHHHHHHHHHHHHHHCCCEEEEECC
T ss_conf             67876780999999999999949699993078


No 216
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2.  This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).
Probab=39.48  E-value=23  Score=17.04  Aligned_cols=101  Identities=18%  Similarity=0.137  Sum_probs=56.3

Q ss_pred             HHHHHHHCCCCEEEE--CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCC--HHHHHHHHHHCCCCEEEE
Q ss_conf             799997406614651--1211102444356433666889998766541562352078989--877999997369963884
Q gi|254780438|r  146 SLQAAKLTGADCIEL--YTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLT--IQNIPNLINAIPYISEIS  221 (261)
Q Consensus       146 ~i~~a~~~Gad~VEl--hTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn--~~Nl~~~i~~Ip~I~Evs  221 (261)
                      +-..|.+.|+|.|=+  |-|.--+.  .+.-.. -|..|.++    ..-.+.|-.-=|.-  .+=+ +.++ +. -+-|-
T Consensus       234 DA~~A~~~G~dgIvVSNHGGRQLD~--~p~~i~-~LpeI~~a----v~~~~~V~~DgGIR~G~DV~-KALA-LG-A~aV~  303 (351)
T cd04737         234 DADVAINAGADGIWVSNHGGRQLDG--GPASFD-SLPEIAEA----VNHRVPIIFDSGVRRGEHVF-KALA-SG-ADAVA  303 (351)
T ss_pred             HHHHHHHCCCCEEEECCCCCCCCCC--CHHHHH-HHHHHHHH----HCCCCEEEECCCCCCHHHHH-HHHH-CC-CCEEE
T ss_conf             9999987499889977875123567--604788-99999998----66896499769867468999-9997-69-98897


Q ss_pred             EHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             259999999994099999999999974105655403
Q gi|254780438|r  222 VGHAFAATALECGVKEAVFCFRRACGQHLDNTMRLT  257 (261)
Q Consensus       222 IGHaiIseAl~~GL~~aI~~~~~ii~~~~~~~~~~~  257 (261)
                      ||-..+- ++..|=++-|.+++++++.-...+|.++
T Consensus       304 iGRp~l~-glaa~G~~GV~~~l~iL~~El~~~M~l~  338 (351)
T cd04737         304 VGRPVLY-GLALGGAQGVASVLEHLNKELKIVMQLA  338 (351)
T ss_pred             ECHHHHH-HHHHCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             5789999-8871338999999999999999999986


No 217
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS). NPD is part of the nitroalkaneoxidizing enzyme family, that catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDPs are members of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative  electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.
Probab=39.35  E-value=33  Score=16.04  Aligned_cols=111  Identities=17%  Similarity=0.149  Sum_probs=66.4

Q ss_pred             HHHHHHHHCCCCEEE--EECCCCCCCCCHHHHHHHHHHHCCCCCCCE--EEEE-ECCC---HHHHHHHHHHCCCEEEEEE
Q ss_conf             999999974998999--824788334888999998874000136741--5888-3485---6899999850721289710
Q gi|254780438|r   28 HIGKIALQSGASGLT--VHPRPDQRHIRYTDLPEIRRLIDEQFPKAE--LNIE-GYPN---ETFLNLCERYKPEQITLVP   99 (261)
Q Consensus        28 ~~a~~~~~~GadgIT--vH~R~DrRHI~~~Dv~~l~~~~~~~~~~~e--lNiE-g~p~---~e~i~ia~~ikP~qvtLVP   99 (261)
                      ++|.-+-++|.-||.  -...+|.   -.+-+...++.+.    +.|  .||= +.|.   ++.++++.+.+|..++.  
T Consensus        18 ~LAAAVSnAGGLGiIa~~~~~~e~---lr~eI~k~r~~lt----dkPFGVNi~~~~p~~~~~~~~~vi~e~kv~vv~~--   88 (320)
T cd04743          18 EFAVAVAEGGGLPFIALALMRGEQ---VKALLEETAELLG----DKPWGVGILGFVDTELRAAQLAVVRAIKPTFALI--   88 (320)
T ss_pred             HHHHHHHCCCCHHHHCCCCCCHHH---HHHHHHHHHHHHC----CCCCEEEEEEECCCCCHHHHHHHHHCCCCCEEEE--
T ss_conf             899999818747774337899899---9999999999825----9984455751388722578888886169989995--


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEE-------CCCCCHH
Q ss_conf             1655533357822133378899999862026963899725444414799997406614651-------1211102
Q gi|254780438|r  100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIEL-------YTGPYGA  167 (261)
Q Consensus       100 e~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VEl-------hTG~Ya~  167 (261)
                              -+|--     ..    +..|++.||+|-..+- .+.  ..+.+.+.|+|.|=.       |+|+-+.
T Consensus        89 --------agG~P-----~~----~~~Lk~aGikvi~~V~-Sv~--lAk~~~~~GaDavIaEG~EaGGHiG~~~T  143 (320)
T cd04743          89 --------AGGRP-----DQ----ARALEAIGISTYLHVP-SPG--LLKQFLENGARKFIFEGRECGGHVGPRSS  143 (320)
T ss_pred             --------CCCCC-----HH----HHHHHHCCCEEEEECC-CHH--HHHHHHHCCCCEEEEECCCCCCCCCCCCH
T ss_conf             --------68890-----78----7999986997999779-999--99999984999999957457677675301


No 218
>PRK11197 lldD L-lactate dehydrogenase; Provisional
Probab=39.17  E-value=19  Score=17.69  Aligned_cols=98  Identities=19%  Similarity=0.146  Sum_probs=54.4

Q ss_pred             HHHHHHHCCCCEEEE--CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHH-HHHHHHHCCCCEEEEE
Q ss_conf             799997406614651--1211102444356433666889998766541562352078989877-9999973699638842
Q gi|254780438|r  146 SLQAAKLTGADCIEL--YTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQN-IPNLINAIPYISEISV  222 (261)
Q Consensus       146 ~i~~a~~~Gad~VEl--hTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~N-l~~~i~~Ip~I~EvsI  222 (261)
                      +-..|.+.|+|.|=+  |-|---+.-  +... ..|-.|.++    ..-.+.|-.-=|.-.-. +-+-++ +. -+-|-|
T Consensus       258 DA~~A~~~G~dgIiVSNHGGRQLD~a--pa~i-~~LpeI~~a----V~~~~~V~~DgGiRrG~DV~KALA-LG-A~aV~v  328 (381)
T PRK11197        258 DARDAVRFGADGIVVSNHGGRQLDGV--LSSA-RALPAIADA----VKGDIAILADSGIRNGLDVVRMIA-LG-ADTVLL  328 (381)
T ss_pred             HHHHHHHCCCCEEEEECCCCCCCCCC--CCHH-HHHHHHHHH----HCCCCEEEEECCCCCHHHHHHHHH-CC-CCEEEE
T ss_conf             99999966998899957763215678--4489-999999998----678973999689786689999997-69-988976


Q ss_pred             HHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             5999999999409----9999999999974105655403
Q gi|254780438|r  223 GHAFAATALECGV----KEAVFCFRRACGQHLDNTMRLT  257 (261)
Q Consensus       223 GHaiIseAl~~GL----~~aI~~~~~ii~~~~~~~~~~~  257 (261)
                      |-     +..|||    ++-|..+++++++-...+|.++
T Consensus       329 GR-----p~lygLaa~G~~GV~~~l~iL~~El~~~M~l~  362 (381)
T PRK11197        329 GR-----AFVYALAAAGQAGVANLLDLIEKEMRVAMTLT  362 (381)
T ss_pred             CH-----HHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             75-----99998771338899999999999999999985


No 219
>TIGR02173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR011892    Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by IPR003136 from INTERPRO.; GO: 0004127 cytidylate kinase activity, 0005524 ATP binding, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process.
Probab=39.16  E-value=22  Score=17.17  Aligned_cols=34  Identities=29%  Similarity=0.436  Sum_probs=26.6

Q ss_pred             HHHHHHHCCCE-EEECC--------CCCHHHHHHHHHHCCCCEE
Q ss_conf             87665415623-52078--------9898779999973699638
Q gi|254780438|r  185 TAQLAQKMDLQ-INAGH--------DLTIQNIPNLINAIPYISE  219 (261)
Q Consensus       185 aa~~A~~lgL~-VnAGH--------gLn~~Nl~~~i~~Ip~I~E  219 (261)
                      |...|..|||+ |-|||        ||++.+..+ ...=|+|++
T Consensus        17 A~~lA~~Lsl~~iSaG~iRelA~~~Gldl~E~~~-aee~~eIDk   59 (173)
T TIGR02173        17 AKILAEKLSLKLISAGDIRELAEKMGLDLAESKY-AEENPEIDK   59 (173)
T ss_pred             HHHHHHHCCCCEECCCHHHHHHHHCCCCHHHHHH-HCCCCCCCH
T ss_conf             9999986398312020078898642988777344-305863116


No 220
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed
Probab=38.92  E-value=33  Score=16.00  Aligned_cols=88  Identities=22%  Similarity=0.284  Sum_probs=55.5

Q ss_pred             CEEEEEECCCHHHHHHHHHHC----CCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CCEEEEEECCCCCC-
Q ss_conf             415888348568999998507----212897101655533357822133378899999862026-96389972544441-
Q gi|254780438|r   71 AELNIEGYPNETFLNLCERYK----PEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNL-GSRISLFADGNGNE-  144 (261)
Q Consensus        71 ~elNiEg~p~~e~i~ia~~ik----P~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~-girvSLFIDpd~~q-  144 (261)
                      +=.||-+...+++.+++..+.    .+.++|===-|+  |..+|..+..+.+.+.++++.+++. .+.+.+=+-||.+. 
T Consensus        94 vi~si~~~~~~d~~~~~~~l~~~~~ad~ielNiScPn--~~~~g~~~~~~~~~l~~i~~~v~~~~~~Pv~vKlsP~~~~i  171 (301)
T PRK07259         94 IIANIAGSTPEEYVEVAEKLSKAPNVDAIELNISCPN--VKHGGMAFGTDPELAYEVVKAVKSVSKVPVIVKLTPNVTDI  171 (301)
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCC--CCCHHHHCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHH
T ss_conf             7997376776899999998645568888999654788--88526660879999999999998734897799807871219


Q ss_pred             -HHHHHHHHCCCCEEEE
Q ss_conf             -4799997406614651
Q gi|254780438|r  145 -HSLQAAKLTGADCIEL  160 (261)
Q Consensus       145 -~~i~~a~~~Gad~VEl  160 (261)
                       ...+++.+.|+|.|=+
T Consensus       172 ~~ia~~~~~~gadgvv~  188 (301)
T PRK07259        172 VEIAKAAEEAGADGLSL  188 (301)
T ss_pred             HHHHHHHHHCCCCEEEE
T ss_conf             99999999759988999


No 221
>TIGR00018 panC pantoate--beta-alanine ligase; InterPro: IPR003721 D-Pantothenate is synthesized via four enzymes from ketoisovalerate, which is an intermediate of branched-chain amino acid synthesis . Pantoate-beta-alanine ligase, also know as pantothenate synthase, (6.3.2.1 from EC) catalyzes the formation of pantothenate from pantoate and alanine in the pantothenate biosynthesis pathway .; GO: 0004592 pantoate-beta-alanine ligase activity, 0015940 pantothenate biosynthetic process.
Probab=38.71  E-value=33  Score=16.06  Aligned_cols=53  Identities=17%  Similarity=0.279  Sum_probs=30.8

Q ss_pred             CEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CCEEEEEECCCCCC---------------HHHHHHHHCCCC
Q ss_conf             12897101655533357822133378899999862026-96389972544441---------------479999740661
Q gi|254780438|r   93 EQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNL-GSRISLFADGNGNE---------------HSLQAAKLTGAD  156 (261)
Q Consensus        93 ~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~-girvSLFIDpd~~q---------------~~i~~a~~~Gad  156 (261)
                      +.|-|||       |=|-|- .+|...+...+   +++ -+-||+||.  |.|               ++++++-++|+|
T Consensus        25 k~vGfVP-------TMG~LH-~GH~sL~~~a~---~End~vvvSIFVN--P~QFgp~EDl~~YPR~l~~D~~l~E~lgVd   91 (310)
T TIGR00018        25 KTVGFVP-------TMGALH-EGHLSLIDRAV---KENDLVVVSIFVN--PLQFGPNEDLEAYPRDLEEDLALLEKLGVD   91 (310)
T ss_pred             EEEECCC-------CCCCHH-HHHHHHHHHHH---HHCCEEEEEEEEC--CCCCCCCCCHHHCCCCHHHHHHHHHHCCCC
T ss_conf             2331226-------731015-67899999998---6688589999757--878888754544579858999999838965


Q ss_pred             EE
Q ss_conf             46
Q gi|254780438|r  157 CI  158 (261)
Q Consensus       157 ~V  158 (261)
                      .|
T Consensus        92 ~~   93 (310)
T TIGR00018        92 VV   93 (310)
T ss_pred             EE
T ss_conf             88


No 222
>PRK07379 coproporphyrinogen III oxidase; Provisional
Probab=38.69  E-value=33  Score=15.97  Aligned_cols=109  Identities=23%  Similarity=0.261  Sum_probs=66.0

Q ss_pred             CCCHHHHHHHHHHHCCCC---CCCEEEEEECCC---HHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCH---HHHHHHHH
Q ss_conf             488899999887400013---674158883485---689999985072128971016555333578221---33378899
Q gi|254780438|r   51 HIRYTDLPEIRRLIDEQF---PKAELNIEGYPN---ETFLNLCERYKPEQITLVPDDPHQLTSDHGWDF---LQNQALLT  121 (261)
Q Consensus        51 HI~~~Dv~~l~~~~~~~~---~~~elNiEg~p~---~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv---~~~~~~L~  121 (261)
                      ...++++..|-..+...+   ++.|+-+|++|.   .+.+....+.-=+.+-+=-    |-..+.-+..   ....+...
T Consensus        79 lL~~~~l~~ll~~l~~~f~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvNRiSiGv----QSf~~~~L~~lgR~h~~~~~~  154 (399)
T PRK07379         79 LLPVEQLERILLTLDQRFGIAPDAEISLEIDPGTFDLEQLQGYRSLGVNRVSLGV----QAFQDELLALCGRSHRVKDIY  154 (399)
T ss_pred             HCCHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEEE----CCCCHHHHHHHCCCCCHHHHH
T ss_conf             4899999999999998689998857999845898999999999856988588970----238688999848999999999


Q ss_pred             HHHHHHCCCCCE-EEE-EECCCCC------CHHHHHHHHCCCCEEEECCC
Q ss_conf             999862026963-899-7254444------14799997406614651121
Q gi|254780438|r  122 KTVARLHNLGSR-ISL-FADGNGN------EHSLQAAKLTGADCIELYTG  163 (261)
Q Consensus       122 ~~i~~l~~~gir-vSL-FIDpd~~------q~~i~~a~~~Gad~VElhTG  163 (261)
                      ..++.+++.|.. +|+ +|---|.      +.+|+.+.+++++.|-+|-=
T Consensus       155 ~ai~~~~~~gf~niniDLIyGlPgQt~~~~~~~l~~~~~l~p~hiS~Y~L  204 (399)
T PRK07379        155 QAVADIHQAGIENFSLDLISGLPHQTLEDWQASLEAAIAINPTHLSCYDL  204 (399)
T ss_pred             HHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             99999997699755455330789988999999999997338880788888


No 223
>cd01018 ZntC Metal binding protein ZntC.  These proteins are predicted to function as initial receptors in ABC transport of metal ions.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  They are comprised of two globular subdomains connected by a long alpha helix and bind their specific ligands in the cleft between these domains.  In addition, many of these proteins possess a metal-binding histidine-rich motif (repetitive HDH sequence).
Probab=38.58  E-value=34  Score=15.96  Aligned_cols=36  Identities=14%  Similarity=0.241  Sum_probs=18.8

Q ss_pred             CCCHHHHHHHHHHHCCCCCCCEEEEEECCCH-HHHHHHHHHCCC
Q ss_conf             4888999998874000136741588834856-899999850721
Q gi|254780438|r   51 HIRYTDLPEIRRLIDEQFPKAELNIEGYPNE-TFLNLCERYKPE   93 (261)
Q Consensus        51 HI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~-e~i~ia~~ikP~   93 (261)
                      .-+++|+..|.+-      ++=|=. |...+ .+++...+..|.
T Consensus        40 e~~psd~~~l~~A------Dlvv~~-G~~lE~~~~~~l~~~~~~   76 (266)
T cd01018          40 EPKPQQMKKLSEA------DLYFRI-GLGFEEVWLERFRSNNPK   76 (266)
T ss_pred             CCCHHHHHHHHCC------CEEEEE-CCCHHHHHHHHHHHCCCC
T ss_conf             6999999999669------899995-873458899999960899


No 224
>PRK06582 coproporphyrinogen III oxidase; Provisional
Probab=38.19  E-value=34  Score=15.92  Aligned_cols=18  Identities=17%  Similarity=0.087  Sum_probs=8.2

Q ss_pred             HHHHHHHHCCCEEEEEEC
Q ss_conf             999998507212897101
Q gi|254780438|r   83 FLNLCERYKPEQITLVPD  100 (261)
Q Consensus        83 ~i~ia~~ikP~qvtLVPe  100 (261)
                      -++.+.+.+|+.+++-+=
T Consensus       182 ~L~~~~~l~p~hiS~Y~L  199 (390)
T PRK06582        182 ELKQAMQLATSHISLYQL  199 (390)
T ss_pred             HHHHHHHCCCCCEEEEEE
T ss_conf             999998338985178988


No 225
>PRK03363 fixB putative electron transfer flavoprotein FixB; Provisional
Probab=38.18  E-value=34  Score=15.92  Aligned_cols=40  Identities=15%  Similarity=0.040  Sum_probs=19.3

Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             9999974998999824788334888999998874000136
Q gi|254780438|r   30 GKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFP   69 (261)
Q Consensus        30 a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~   69 (261)
                      +..+..+|||.+-+=.-+..-...+.-...+.+++.++.+
T Consensus        41 ~~~~~~~GAd~V~~v~~~~~~~~~~~ya~~~~~~i~~~~~   80 (313)
T PRK03363         41 GAQAIQLGANHVWKLSGKPDDRMIEDYAGVMADTIRQHGA   80 (313)
T ss_pred             HHHHHHHCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             8899970898999945762233346899999999997599


No 226
>PRK05628 coproporphyrinogen III oxidase; Validated
Probab=38.00  E-value=34  Score=15.90  Aligned_cols=105  Identities=21%  Similarity=0.302  Sum_probs=62.6

Q ss_pred             CHHHHHHHHHHHCCCC---CCCEEEEEECCC---HHHHHHHHHHCCCEEEE-----EECCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             8899999887400013---674158883485---68999998507212897-----101655533357822133378899
Q gi|254780438|r   53 RYTDLPEIRRLIDEQF---PKAELNIEGYPN---ETFLNLCERYKPEQITL-----VPDDPHQLTSDHGWDFLQNQALLT  121 (261)
Q Consensus        53 ~~~Dv~~l~~~~~~~~---~~~elNiEg~p~---~e~i~ia~~ikP~qvtL-----VPe~r~elTTegGldv~~~~~~L~  121 (261)
                      .++.+..|-..+...|   ++.|+-+|++|.   ++.++...+..-+.+.|     .|+....+--.      ...+...
T Consensus        74 ~~~~l~~l~~~i~~~f~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvnRiSlGvQsf~~~~l~~lgR~------h~~~~~~  147 (376)
T PRK05628         74 GAEGLARVLDAVRDTFGLAPDAEVTTEANPESTSPEFFAALRAAGYTRVSLGMQSAAPHVLAVLDRT------HTPGRAV  147 (376)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCC------CCHHHHH
T ss_conf             9999999999999758999885699983426589999999997498759995155899999974999------9989999


Q ss_pred             HHHHHHCCCCCE-EEE-EECCCCCC------HHHHHHHHCCCCEEEECCC
Q ss_conf             999862026963-899-72544441------4799997406614651121
Q gi|254780438|r  122 KTVARLHNLGSR-ISL-FADGNGNE------HSLQAAKLTGADCIELYTG  163 (261)
Q Consensus       122 ~~i~~l~~~gir-vSL-FIDpd~~q------~~i~~a~~~Gad~VElhTG  163 (261)
                      ..+..+++.|+. ||+ +|---|.|      .+++.+.++++|.|-+|.=
T Consensus       148 ~~~~~~~~~gf~~in~DLIyGlP~Qt~~~~~~~l~~~~~l~p~his~Y~l  197 (376)
T PRK05628        148 AAAREARAAGFEHVNLDLIYGTPGETDDDLRRSLDAALEAGVDHVSAYAL  197 (376)
T ss_pred             HHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             99999987599725555442799999999999999997328981566555


No 227
>COG2200 Rtn c-di-GMP phosphodiesterase class I (EAL domain) [Signal    transduction mechanisms]
Probab=37.63  E-value=35  Score=15.86  Aligned_cols=169  Identities=18%  Similarity=0.174  Sum_probs=97.4

Q ss_pred             HHHHHCCCC-CCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCC--CCCC-CEEEEEECCC------HH
Q ss_conf             223220788-689989999999974998999824788334888999998874000--1367-4158883485------68
Q gi|254780438|r   13 AVLRNRRNL-PWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDE--QFPK-AELNIEGYPN------ET   82 (261)
Q Consensus        13 AtLRnaRg~-~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~--~~~~-~elNiEg~p~------~e   82 (261)
                      |++|=...+ ..-.|..|-..+++.|-             |..=|-..+.+.+..  .++. ..+-+=.|.+      +.
T Consensus        37 aL~R~~~~~~g~i~p~~Fi~~ae~~gl-------------i~~l~~~v~~~a~~~~~~~~~~~~~~l~iNis~~~l~~~~  103 (256)
T COG2200          37 ALLRWRHPDGGLISPGEFIPLAEETGL-------------IVELGRWVLEEACRQLRTWPRAGPLRLAVNLSPVQLRSPG  103 (256)
T ss_pred             EEEEEECCCCCCCCHHHHHHHHHHCCC-------------HHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHCCCH
T ss_conf             999874699886798999999988498-------------9999999999999999853213880799984888828656


Q ss_pred             HHHHH----HH--HCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCC
Q ss_conf             99999----85--0721289710165553335782213337889999986202696389972544441479999740661
Q gi|254780438|r   83 FLNLC----ER--YKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGAD  156 (261)
Q Consensus        83 ~i~ia----~~--ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad  156 (261)
                      |+..+    .+  +.|.++++      |+|-.. .  ..+.+.+..++..|++.|++++|==. ..--.++.+.+++.+|
T Consensus       104 ~~~~l~~~l~~~~~~~~~l~~------EitE~~-~--~~~~~~~~~~l~~Lr~~G~~ialDDF-GtG~ssl~~L~~l~~d  173 (256)
T COG2200         104 LVDLLLRLLARLGLPPHRLVL------EITESA-L--IDDLDTALALLRQLRELGVRIALDDF-GTGYSSLSYLKRLPPD  173 (256)
T ss_pred             HHHHHHHHHHHCCCCCCEEEE------EECCCH-H--HCCHHHHHHHHHHHHHCCCCEEEECC-CCCHHHHHHHHHCCCC
T ss_conf             999999999973999120799------974871-2--24989999999999977998999789-9971659999857997


Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHH
Q ss_conf             4651121110244435643366688999876654156235207898987799
Q gi|254780438|r  157 CIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIP  208 (261)
Q Consensus       157 ~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~  208 (261)
                      .|-|.-.-..+...+. ...   .-+......|+++|+.|=|-===+.+-+.
T Consensus       174 ~iKID~~fv~~i~~~~-~~~---~iv~~iv~la~~l~~~vvaEGVEt~~ql~  221 (256)
T COG2200         174 ILKIDRSFVRDLETDA-RDQ---AIVRAIVALAHKLGLTVVAEGVETEEQLD  221 (256)
T ss_pred             EEEECHHHHHHHCCCC-HHH---HHHHHHHHHHHHCCCEEEEEECCCHHHHH
T ss_conf             4999699998630383-117---99999999999749989997069699999


No 228
>COG0414 PanC Panthothenate synthetase [Coenzyme metabolism]
Probab=37.44  E-value=16  Score=18.23  Aligned_cols=103  Identities=11%  Similarity=0.149  Sum_probs=56.7

Q ss_pred             HHHHHHHHCCCCC-------CCCHH----------------HHHHHHHHCCCCEEEEEC-------CCCCCCCCHHHHHH
Q ss_conf             4432232207886-------89989----------------999999974998999824-------78833488899999
Q gi|254780438|r   10 NAVAVLRNRRNLP-------WPNLV----------------HIGKIALQSGASGLTVHP-------RPDQRHIRYTDLPE   59 (261)
Q Consensus        10 dhiAtLRnaRg~~-------~P~~~----------------~~a~~~~~~GadgITvH~-------R~DrRHI~~~Dv~~   59 (261)
                      -|.+++|.||..+       +=||.                +-+.+|++.|+|-+ .+|       ++-+ +.+.-++. 
T Consensus        36 GHlsLVr~A~~~~d~VVVSIFVNP~QFg~~EDl~~YPR~l~~D~~~l~~~gvd~v-F~P~~~emYP~g~~-~~~~~~v~-  112 (285)
T COG0414          36 GHLSLVRRAKKENDVVVVSIFVNPLQFGPNEDLDRYPRTLERDLELLEKEGVDIV-FAPTVEEMYPHGIE-RVTVVPVP-  112 (285)
T ss_pred             HHHHHHHHHHHCCCEEEEEEEECHHHCCCCHHHHHCCCCHHHHHHHHHHCCCCEE-ECCCHHHCCCCCCC-CEEEECCC-
T ss_conf             7999999986409939999986713149852455479888999999986698689-68876641889886-24661477-


Q ss_pred             HHHHHCCCCCCCEEEEEECCCHH--------HHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             88740001367415888348568--------9999985072128971016555333578221333788999998620269
Q gi|254780438|r   60 IRRLIDEQFPKAELNIEGYPNET--------FLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLG  131 (261)
Q Consensus        60 l~~~~~~~~~~~elNiEg~p~~e--------~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~g  131 (261)
                                ..---+||++.++        ..++-.-++|+.+|+=               .++...|.-+=....+.+
T Consensus       113 ----------~ls~~LeGa~RPGHF~GV~TVV~KLFniv~Pd~AyFG---------------eKD~QQl~vIr~mV~DL~  167 (285)
T COG0414         113 ----------GLSDELEGASRPGHFRGVATVVTKLFNIVQPDRAYFG---------------EKDYQQLAVIRRMVADLN  167 (285)
T ss_pred             ----------CCCCCCCCCCCCCCCCEEEEHHHHHHCCCCCCEEEEC---------------CCHHHHHHHHHHHHHHCC
T ss_conf             ----------7552005798887645165677755462488833555---------------306999999999999718


Q ss_pred             CEEEEEECC
Q ss_conf             638997254
Q gi|254780438|r  132 SRISLFADG  140 (261)
Q Consensus       132 irvSLFIDp  140 (261)
                      +.|-+.--|
T Consensus       168 ~~VeIv~vp  176 (285)
T COG0414         168 LPVEIVGVP  176 (285)
T ss_pred             CCEEEEECC
T ss_conf             970797126


No 229
>PRK12857 putative aldolase; Reviewed
Probab=37.03  E-value=35  Score=15.80  Aligned_cols=183  Identities=15%  Similarity=0.183  Sum_probs=107.4

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHH-HHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEECCCCCC
Q ss_conf             999999997499899982478833488899999887-4000136741588834856899999850721289710165553
Q gi|254780438|r   27 VHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR-LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQL  105 (261)
Q Consensus        27 ~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~-~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~r~el  105 (261)
                      ..+..-|++.++..|--.-.....|...+-+..+.. ......-.+-+++-=..+-+.+.-+++.-=+.|-+  |-    
T Consensus        32 ~avi~AAee~~sPvIlq~s~~~~~~~g~~~~~~~~~~~a~~~~VpV~lHLDH~~~~e~i~~ai~~Gf~SVM~--Dg----  105 (284)
T PRK12857         32 QAIVAAAEAERSPVIIQASQGAIKYAGIEYISAMVRTAAEKASVPVALHLDHGTDFEQVMKCIRNGFTSVMI--DG----  105 (284)
T ss_pred             HHHHHHHHHHCCCEEEECCCCHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEEEE--EC----
T ss_conf             999999999789989991714776579999999999999976998999679889999999999809987997--28----


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCCCEE--------------------EEEECCCCCCHHHHHHHHCCCCEEEECCCCC
Q ss_conf             33578221333788999998620269638--------------------9972544441479999740661465112111
Q gi|254780438|r  106 TSDHGWDFLQNQALLTKTVARLHNLGSRI--------------------SLFADGNGNEHSLQAAKLTGADCIELYTGPY  165 (261)
Q Consensus       106 TTegGldv~~~~~~L~~~i~~l~~~girv--------------------SLFIDpd~~q~~i~~a~~~Gad~VElhTG~Y  165 (261)
                         .-|++..|-..-+++++..+..|+-|                    ++|-||  ++ ..+...++|+|+.=+=-|.-
T Consensus       106 ---S~l~~eeNi~~Tk~vv~~ah~~gv~VEaElG~igg~ed~~~~~~~~~~~T~p--ee-a~~Fv~~TgvD~LAvaiGn~  179 (284)
T PRK12857        106 ---SKLPLEENIALTKKVVEIAHAVGVSVEAELGKIGGTEDDITVDEREAFFTDP--EE-ARRFVEETGVDALAIAIGTA  179 (284)
T ss_pred             ---CCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCCCCCCH--HH-HHHHHHHHCCCEEEHHHCCC
T ss_conf             ---9899999999999999999870891588530136767777766300025899--99-99999987978770120566


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHH
Q ss_conf             0244435643366688999876654156235207898987799999736996388425999
Q gi|254780438|r  166 GACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAF  226 (261)
Q Consensus       166 a~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHai  226 (261)
                      =-.|...  .+.-++++++.. -+....|-.|-|-|+.-+.+...++  -+|.-+|||--+
T Consensus       180 HG~yk~~--p~L~~~~L~~I~-~~~~vPLVLHGgSGi~~e~i~~ai~--~Gi~KiNi~T~l  235 (284)
T PRK12857        180 HGPYKGV--PKLDFDRLAKIR-ELVNIPLVLHGSSGVPDEAIRKAIS--LGVRKVNIDTNI  235 (284)
T ss_pred             CCCCCCC--CCCCHHHHHHHH-HHCCCCEEEECCCCCCHHHHHHHHH--HCCEEEEECHHH
T ss_conf             6776898--856999999998-6169998976899999999999998--097599748799


No 230
>pfam03009 GDPD Glycerophosphoryl diester phosphodiesterase family. E. coli has two sequence related isozymes of glycerophosphoryl diester phosphodiesterase (GDPD) - periplasmic and cytosolic. This family also includes agrocinopine synthase, the similarity to GDPD has been noted. This family appears to have weak but not significant matches to mammalian phospholipase C pfam00388, which suggests that this family may adopt a TIM barrel fold.
Probab=37.01  E-value=35  Score=15.80  Aligned_cols=34  Identities=21%  Similarity=0.067  Sum_probs=22.3

Q ss_pred             HHCCCCCCCCHHHHHHHHHHCCCCEE--EEECCCCC
Q ss_conf             22078868998999999997499899--98247883
Q gi|254780438|r   16 RNRRNLPWPNLVHIGKIALQSGASGL--TVHPRPDQ   49 (261)
Q Consensus        16 RnaRg~~~P~~~~~a~~~~~~GadgI--TvH~R~Dr   49 (261)
                      |-+++..--|=+.+-..|.+.|||+|  -|++=-|.
T Consensus         2 RG~~~~~pENTl~Af~~A~~~G~d~iE~DV~~TkDg   37 (238)
T pfam03009         2 RGASGDYPENTLLAFRKAAEAGADYIEFDVQLTKDG   37 (238)
T ss_pred             CCCCCCCCCCHHHHHHHHHHCCCCEEEEEEEECCCC
T ss_conf             898989973349999999986989999877584699


No 231
>PRK05904 coproporphyrinogen III oxidase; Provisional
Probab=36.07  E-value=37  Score=15.70  Aligned_cols=92  Identities=20%  Similarity=0.181  Sum_probs=52.3

Q ss_pred             CCEEEEEECCC---HHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCH---HHHHHHHHHHHHHHCCCCC-EEEE-EECCC
Q ss_conf             74158883485---689999985072128971016555333578221---3337889999986202696-3899-72544
Q gi|254780438|r   70 KAELNIEGYPN---ETFLNLCERYKPEQITLVPDDPHQLTSDHGWDF---LQNQALLTKTVARLHNLGS-RISL-FADGN  141 (261)
Q Consensus        70 ~~elNiEg~p~---~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv---~~~~~~L~~~i~~l~~~gi-rvSL-FIDpd  141 (261)
                      +.|+-+|++|.   ++.+....+.--+.+.|=-    |-..+.-|..   ....+.....++.+++.|+ .+|+ +|-.-
T Consensus        89 ~~EiTiEaNP~~~~~ekL~~lk~~GVNRiSlGV----QSf~d~~Lk~LGR~H~~~~~~~ai~~~r~~Gf~nIsiDLIyGl  164 (353)
T PRK05904         89 NCEFTIECNPELITQSQINLLKKNKVNRISLGV----QSMNNNILKQLNRTHTIQDSKEAINLLHKNGIYNISCDFLYCL  164 (353)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHCCCCEEEEEC----CCCCHHHHHHHCCCCCHHHHHHHHHHHHHHCCCEEEECEEECC
T ss_conf             835999865144878999999964987688874----5599899998389998999999999999819973600426359


Q ss_pred             CC------CHHHHHHHHCCCCEEEECCCCC
Q ss_conf             44------1479999740661465112111
Q gi|254780438|r  142 GN------EHSLQAAKLTGADCIELYTGPY  165 (261)
Q Consensus       142 ~~------q~~i~~a~~~Gad~VElhTG~Y  165 (261)
                      |.      +.+++.+.+++++-|-+|-=.+
T Consensus       165 PgQT~~~~~~~L~~~l~l~p~HiS~Y~Lti  194 (353)
T PRK05904        165 PILKLKDLDEVFNFILKHKINHISFYSLEI  194 (353)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCEEEEEEEE
T ss_conf             999999999999999965999178888898


No 232
>PRK10060 RNase II stability modulator; Provisional
Probab=36.07  E-value=37  Score=15.70  Aligned_cols=46  Identities=13%  Similarity=0.260  Sum_probs=27.5

Q ss_pred             HHHHHHCCCEEEECC-CCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHH
Q ss_conf             766541562352078-989877999997369963884259999999994
Q gi|254780438|r  186 AQLAQKMDLQINAGH-DLTIQNIPNLINAIPYISEISVGHAFAATALEC  233 (261)
Q Consensus       186 a~~A~~lgL~VnAGH-gLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~  233 (261)
                      ....+++|.++.--. |--|.++.+ +..+| ++.+-|-.++|.+....
T Consensus       547 l~~Lr~lGv~iALDDFGTGySSLsy-L~~lP-vd~lKIDrsFV~~i~~d  593 (663)
T PRK10060        547 IQQFSQLGAQVHLDDFGTGYSSLSQ-LARFP-IDAIKLDQSFVRDIHKQ  593 (663)
T ss_pred             HHHHHHCCCEEEEECCCCCHHHHHH-HHHCC-CCEEEECHHHHHCCCCC
T ss_conf             9999978998999899997336999-84289-99899998997160489


No 233
>cd03413 CbiK_C Anaerobic cobalamin biosynthetic cobalt chelatase (CbiK), C-terminal domain. CbiK is part of the cobalt-early path for cobalamin biosynthesis. It catalyzes the insertion of cobalt into the oxidized form of precorrin-2, factor II (sirohydrochlorin), the second step of the anaerobic branch of vitamin B12 biosynthesis. CbiK belongs to the class II family of chelatases, and is a homomeric enzyme that does not require ATP for its enzymatic activity.
Probab=35.90  E-value=36  Score=15.76  Aligned_cols=61  Identities=18%  Similarity=0.170  Sum_probs=33.1

Q ss_pred             EEEEECCCH-HHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHH--HHHHHHHHHHCCCCCEEEEEE
Q ss_conf             588834856-899999850721289710165553335782213337--889999986202696389972
Q gi|254780438|r   73 LNIEGYPNE-TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQ--ALLTKTVARLHNLGSRISLFA  138 (261)
Q Consensus        73 lNiEg~p~~-e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~--~~L~~~i~~l~~~girvSLFI  138 (261)
                      --+||+|+- ..++-..+-.+..|+|+|=     -.=.|--...+.  +.=...-..|.+.|++|...+
T Consensus        36 gtvEg~P~~e~vl~~L~~~g~k~V~L~Pl-----m~VAGdHa~nDmaGde~dSWks~L~~~G~~v~~~l   99 (103)
T cd03413          36 GTVEGYPGLDDVLAKLKKAGIKKVTLMPL-----MLVAGDHAHNDMAGDEPDSWKSILEAAGIKVETVL   99 (103)
T ss_pred             EEECCCCCHHHHHHHHHHCCCCEEEEECH-----HHHHHHHHHHHHCCCCCHHHHHHHHHCCCEEEEEE
T ss_conf             99578589999999999769986999610-----64401757763048982269999997798757997


No 234
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882    N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2.7.7.23 from EC) is a trimeric bifunctional enzyme that catalyzes the last two sequential reactions in the de novo biosynthetic pathway for UDP-GlcNAc.    The X-ray crystal structure of Escherichia coli GlmU in complex with UDP-GlcNAc and CoA has been determined to 2.1 A resolution and reveals a two-domain architecture that is responsible for these two reactions . The C-terminal domain is responsible for the CoA-dependent acetylation of Glc-1-PO(4) to GlcNAc-1-PO(4) and displays the longest left-handed parallel beta-helix observed to date. The acetyltransferase active site defined by the binding site for CoA makes use of residues from all three subunits and is positioned beneath an open cavity large enough to accommodate the Glc-1-PO(4) acetyl acceptor. The N-terminal domain catalyzes uridyl transfer from UTP to GlcNAc-1-PO(4) to form the final products UDP-GlcNAc and pyrophosphate. This domain is composed of a central seven-stranded beta-sheet surrounded by six alpha-helices in a Rossmann fold-like topology. ; GO: 0003977 UDP-N-acetylglucosamine diphosphorylase activity, 0009103 lipopolysaccharide biosynthetic process.
Probab=35.81  E-value=22  Score=17.24  Aligned_cols=60  Identities=17%  Similarity=0.067  Sum_probs=36.2

Q ss_pred             CCCCCCHHHHHHHHCCCCEEEECCCCCHHHHH---------HHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHH
Q ss_conf             54444147999974066146511211102444---------356433666889998766541562352078989877999
Q gi|254780438|r  139 DGNGNEHSLQAAKLTGADCIELYTGPYGACYN---------NPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPN  209 (261)
Q Consensus       139 Dpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~---------~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~  209 (261)
                      |++++|+.|          =|++||-||--..         ++.+.+.|+ .+-+...+|+.-|..|+|=|=.++.=+..
T Consensus       163 DA~~eqk~I----------~eiNtG~y~~~~~~L~~~L~~l~n~NaqgEY-YLTD~ia~a~~~g~~v~~~~~~d~~E~~G  231 (461)
T TIGR01173       163 DANEEQKAI----------KEINTGVYVFDGAALKRWLPKLSNNNAQGEY-YLTDVIALAVADGEEVRAVQVDDSEEVLG  231 (461)
T ss_pred             CCCHHHHCC----------CEEEEEEEEECHHHHHHHHHHHCCCCCCCCC-CHHHHHHHHHCCCCEEEEEEECCHHHHCC
T ss_conf             988698035----------2788879998328999888762877044431-47899999850894789998087598336


No 235
>pfam01903 CbiX CbiX. The function of CbiX is uncertain, however it is found in cobalamin biosynthesis operons and so may have a related function. Some CbiX proteins contain a striking histidine-rich region at their C-terminus, which suggests that it might be involved in metal chelation.
Probab=35.79  E-value=37  Score=15.67  Aligned_cols=49  Identities=22%  Similarity=0.247  Sum_probs=20.7

Q ss_pred             CCCCHHHHHHHHHHCCCCEEEEECC--CCCCCCCHHHHHHHHHHHCCCCCCC
Q ss_conf             6899899999999749989998247--8833488899999887400013674
Q gi|254780438|r   22 PWPNLVHIGKIALQSGASGLTVHPR--PDQRHIRYTDLPEIRRLIDEQFPKA   71 (261)
Q Consensus        22 ~~P~~~~~a~~~~~~GadgITvH~R--~DrRHI~~~Dv~~l~~~~~~~~~~~   71 (261)
                      ..|++-++...+...|++-|+|-|=  -.-+|+ .+|+...-+.....++++
T Consensus        36 ~~P~l~~~~~~l~~~G~~~ivvvP~fL~~G~H~-~~DIp~~l~~~~~~~p~i   86 (106)
T pfam01903        36 AEPSLPEALRELVAQGARRIVVVPLFLFAGGHV-KRDIPEELAEAKAAHPGI   86 (106)
T ss_pred             CCCCHHHHHHHHHHCCCCEEEEEEEEEECCCCH-HHHHHHHHHHHHHHCCCC
T ss_conf             789899999999966996499987574056201-768999999999888996


No 236
>KOG2463 consensus
Probab=35.75  E-value=12  Score=19.16  Aligned_cols=22  Identities=23%  Similarity=0.243  Sum_probs=11.9

Q ss_pred             EEEHHHHHHHHHHHHHHHHHHH
Q ss_conf             8425999999999409999999
Q gi|254780438|r  220 ISVGHAFAATALECGVKEAVFC  241 (261)
Q Consensus       220 vsIGHaiIseAl~~GL~~aI~~  241 (261)
                      ..-+|-++++|-..|+..-++-
T Consensus       341 pf~~~d~~s~~a~~~v~~~~~~  362 (376)
T KOG2463         341 PFSGHDVTSRSAILGVRQHVRI  362 (376)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHH
T ss_conf             7335565550001155554203


No 237
>PRK06801 hypothetical protein; Provisional
Probab=35.52  E-value=37  Score=15.64  Aligned_cols=184  Identities=16%  Similarity=0.154  Sum_probs=107.2

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHH-CCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEECCCCC
Q ss_conf             899999999749989998247883348889999988740-0013674158883485689999985072128971016555
Q gi|254780438|r   26 LVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI-DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQ  104 (261)
Q Consensus        26 ~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~-~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~r~e  104 (261)
                      +..+..-+++.++..|--.-....++...+-+...-.-. ....-.+-+++-=..+-+.+.-+++.-=+.|-+  |.   
T Consensus        31 ~~avi~AAee~~sPvIlq~s~~~~~~~~~~~~~~~~~~~a~~~~VPV~lHLDHg~~~e~i~~ai~~Gf~SVM~--Dg---  105 (286)
T PRK06801         31 LRALFAAAKQERSPFIINIAEVHFKYISLESLVEAVKFEAAHHDIPVVLNLDHGLHFEAVVRALRLGFSSVMF--DG---  105 (286)
T ss_pred             HHHHHHHHHHHCCCEEEECCHHHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEEEE--EC---
T ss_conf             9999999999787989980675775669999999999999877998999899999999999999829987997--49---


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHCCCCCEE---------------------EEEECCCCCCHHHHHHHHCCCCEEEECCC
Q ss_conf             333578221333788999998620269638---------------------99725444414799997406614651121
Q gi|254780438|r  105 LTSDHGWDFLQNQALLTKTVARLHNLGSRI---------------------SLFADGNGNEHSLQAAKLTGADCIELYTG  163 (261)
Q Consensus       105 lTTegGldv~~~~~~L~~~i~~l~~~girv---------------------SLFIDpd~~q~~i~~a~~~Gad~VElhTG  163 (261)
                          --|++..|-..-+++++..+..|+-|                     ++|-||  ++ ..+...++|+|+.-.=-|
T Consensus       106 ----S~l~~eeNi~~Tk~vve~ah~~gv~VEaElG~vgg~ed~~~~~~~~~~~~T~p--ee-a~~Fv~~TgvD~LAvaiG  178 (286)
T PRK06801        106 ----STLEYEENVRQTREVVKMCHAVGVSVEAELGAVGGDEGGALYGEADSNLFTDP--AI-ARDFVDRTGIDALAVAIG  178 (286)
T ss_pred             ----CCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCH--HH-HHHHHHHHCCCEEEEECC
T ss_conf             ----98999999999999999998849859999631057667765576530026899--99-999999869989975225


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHH
Q ss_conf             110244435643366688999876654156235207898987799999736996388425999
Q gi|254780438|r  164 PYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAF  226 (261)
Q Consensus       164 ~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHai  226 (261)
                      .-=-.|...  .+.-++++++..+ +...-|-.|-|-|+.-+.+...++  -+|.-+|||-.+
T Consensus       179 n~HG~yk~~--p~L~~~~L~~I~~-~~~vPLVLHGgSGi~~e~i~~ai~--~Gv~KiNi~T~l  236 (286)
T PRK06801        179 NAHGKYKGE--PKLDFARLAAIHQ-QTGLPLVLHGGSGISDTDFRRAIS--LGIHKINFYTGM  236 (286)
T ss_pred             CCCCCCCCC--CCCCHHHHHHHHH-HCCCCEEEECCCCCCHHHHHHHHH--CCCEEEEECHHH
T ss_conf             455676898--8679999999998-529998977999999999999997--797699828689


No 238
>pfam01373 Glyco_hydro_14 Glycosyl hydrolase family 14. This family are beta amylases.
Probab=35.39  E-value=38  Score=15.63  Aligned_cols=24  Identities=17%  Similarity=0.353  Sum_probs=9.8

Q ss_pred             EECCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             101655533357822133378899
Q gi|254780438|r   98 VPDDPHQLTSDHGWDFLQNQALLT  121 (261)
Q Consensus        98 VPe~r~elTTegGldv~~~~~~L~  121 (261)
                      -|+.-+-.-.+|+|+-.--+.+|.
T Consensus       216 ~P~~t~fF~~~G~~~s~YG~FFL~  239 (399)
T pfam01373       216 PPTDGDGFYTNGGYNSTYGKDFLE  239 (399)
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             999986402289866433547899


No 239
>TIGR01072 murA UDP-N-acetylglucosamine 1-carboxyvinyltransferase; InterPro: IPR005750    The bacterial enzyme UDP-N-acetylglucosamine (UDP-GlcNAc) enolpyruvyltransferase (MurA) catalyzes the transfer of enolpyruvate from phosphoenolpyruvate to uridine diphospho-N-acetylglucosamine, which is the first committed step of bacterial cell wall biosynthesis. Experimental evidence suggests that binding of substrates to the enzyme does not exclusively follow an ordered mechanism with UDP-GlcNAc binding first, although binding of UDP-GlcNAc to free enzyme is preferred and possibly influenced by pyruvate-P. The reaction thus appears to follow an induced-fit mechanism, in which the binding site for fosfomycin, and presumably also for pyruvate-P, is created by the interaction of free enzyme with the sugar nucleotide. ; GO: 0016740 transferase activity, 0019277 UDP-N-acetylgalactosamine biosynthetic process.
Probab=35.00  E-value=16  Score=18.26  Aligned_cols=91  Identities=20%  Similarity=0.280  Sum_probs=58.6

Q ss_pred             EEEECCCHHH-HHHHHH-HCCCEEEEEECCCCCCC-------CCCCCCHH-HHHHHHHHHHHHHCCCCCEE-----EEEE
Q ss_conf             8883485689-999985-07212897101655533-------35782213-33788999998620269638-----9972
Q gi|254780438|r   74 NIEGYPNETF-LNLCER-YKPEQITLVPDDPHQLT-------SDHGWDFL-QNQALLTKTVARLHNLGSRI-----SLFA  138 (261)
Q Consensus        74 NiEg~p~~e~-i~ia~~-ikP~qvtLVPe~r~elT-------TegGldv~-~~~~~L~~~i~~l~~~girv-----SLFI  138 (261)
                      .|+|+-|+.+ |+=+.+ .....-+++||+=|.=|       |.|=.-+. -+.+.|..++.+|++.|..+     ++-|
T Consensus       209 ~I~G~G~~~i~I~GV~~~L~g~~h~iiPDRIEAGTf~~AAA~T~G~~~~~~v~p~hL~~~~~KL~e~G~~~~~~~~~~~v  288 (443)
T TIGR01072       209 KIEGAGSSTITIEGVEKDLHGTEHSIIPDRIEAGTFLVAAAITRGEVLVKNVDPDHLRAVLAKLREIGAEVEVDENSIRV  288 (443)
T ss_pred             EEEEECCCEEEEEEECCCCCCEEEEECCCHHHHHHHHEEEEEECCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCEEEE
T ss_conf             89653587889985405577531788386567866530023365817994578789999999998649679997788999


Q ss_pred             CCCCCCHHHHHHHHCCCCEEEECCCCCHH
Q ss_conf             54444147999974066146511211102
Q gi|254780438|r  139 DGNGNEHSLQAAKLTGADCIELYTGPYGA  167 (261)
Q Consensus       139 Dpd~~q~~i~~a~~~Gad~VElhTG~Ya~  167 (261)
                      ++..+. -+++-+++  ..|++-|.||=-
T Consensus       289 ~~~~~L-~V~~D~~~--k~v~i~T~pyPG  314 (443)
T TIGR01072       289 DMRQDL-KVKLDKRL--KAVDIETLPYPG  314 (443)
T ss_pred             EECCCE-EEEECCCC--CCEEECCCCCCC
T ss_conf             855862-79755888--880423788898


No 240
>COG2222 AgaS Predicted phosphosugar isomerases [Cell envelope biogenesis, outer membrane]
Probab=34.50  E-value=37  Score=15.70  Aligned_cols=37  Identities=19%  Similarity=0.224  Sum_probs=32.1

Q ss_pred             HHHHCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             2322078868998999999997499899982478833
Q gi|254780438|r   14 VLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQR   50 (261)
Q Consensus        14 tLRnaRg~~~P~~~~~a~~~~~~GadgITvH~R~DrR   50 (261)
                      .+==||-|+.|+.+.+++.|-..||-.|++--.+|-.
T Consensus        91 vi~~S~SG~TpE~vaa~~~a~~~ga~~i~lT~~~dSp  127 (340)
T COG2222          91 VIAFSQSGNTPESVAAAELAKEGGALTIALTNEEDSP  127 (340)
T ss_pred             EEEEECCCCCHHHHHHHHHHCCCCCEEEEEECCCCCH
T ss_conf             9998378998799999998521797699996378984


No 241
>PRK08446 coproporphyrinogen III oxidase; Provisional
Probab=34.11  E-value=39  Score=15.49  Aligned_cols=105  Identities=18%  Similarity=0.220  Sum_probs=62.2

Q ss_pred             HHHHHHHHHHHCCCC-CCCEEEEEECCC---HHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHH---HHHHHHHHHHHH
Q ss_conf             899999887400013-674158883485---6899999850721289710165553335782213---337889999986
Q gi|254780438|r   54 YTDLPEIRRLIDEQF-PKAELNIEGYPN---ETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFL---QNQALLTKTVAR  126 (261)
Q Consensus        54 ~~Dv~~l~~~~~~~~-~~~elNiEg~p~---~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~---~~~~~L~~~i~~  126 (261)
                      ++++..|-+.+...+ .+.|+-+|++|.   ++.+....+..-+.+-+=-    |-..+.-|...   ...+.....++.
T Consensus        68 ~~~l~~ll~~l~~~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvNRiSiGV----QSf~d~~Lk~lgR~H~~~~~~~ai~~  143 (351)
T PRK08446         68 AKLYEPIFEIIYPYLSKDCEITTEANPNSATLAWLKGMKNLGVNRISFGV----QSFHEDKLKFLGRIHSKNQIIKAIEN  143 (351)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEEE----CCCCHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             99999999999976698835999767686899999999864987699973----13768999981899889999999999


Q ss_pred             HCCCCCE-EEE-EECCCCC------CHHHHHHHHCCCCEEEECC
Q ss_conf             2026963-899-7254444------1479999740661465112
Q gi|254780438|r  127 LHNLGSR-ISL-FADGNGN------EHSLQAAKLTGADCIELYT  162 (261)
Q Consensus       127 l~~~gir-vSL-FIDpd~~------q~~i~~a~~~Gad~VElhT  162 (261)
                      +++.|+. +|+ +|---|.      +.+++.+.+++++.|=+|.
T Consensus       144 ~r~~gf~niniDLIyGlP~Qt~e~~~~~l~~~~~l~p~HiS~Y~  187 (351)
T PRK08446        144 AKKAGFKNISIDLIYNTKLDNKKLLKEELKLAKELPITHLSAYA  187 (351)
T ss_pred             HHHCCCCEECHHHHCCCCCCCHHHHHHHHHHHHCCCCCEEECCC
T ss_conf             99849963422553179999999999999999748969797423


No 242
>cd00861 ProRS_anticodon_short ProRS Prolyl-anticodon binding domain, short version found predominantly in bacteria. ProRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only.
Probab=33.98  E-value=39  Score=15.48  Aligned_cols=56  Identities=21%  Similarity=0.258  Sum_probs=32.2

Q ss_pred             CCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCC
Q ss_conf             21289710165553335782213337889999986202696389972544441479999740661
Q gi|254780438|r   92 PEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGAD  156 (261)
Q Consensus        92 P~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad  156 (261)
                      |.||+++|=...   +      ....++-.++-..|++.|++|-+-=-...--+-+.-|-.+|..
T Consensus         1 P~qv~Iipi~~~---~------~~~~~~a~~l~~~L~~~gi~v~~Ddr~~~~G~K~~~ael~GiP   56 (94)
T cd00861           1 PFDVVIIPMNMK---D------EVQQELAEKLYAELQAAGVDVLLDDRNERPGVKFADADLIGIP   56 (94)
T ss_pred             CEEEEEEECCCC---C------HHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCCC
T ss_conf             949999974899---8------8999999999999988798999987997277999999974998


No 243
>PRK13119 consensus
Probab=33.98  E-value=39  Score=15.48  Aligned_cols=202  Identities=15%  Similarity=0.192  Sum_probs=120.4

Q ss_pred             CCCCCHHHHHHH---HHHCCCCEEEEE-----CCCCCCCCCH------------HHHHHHHHHHCCCCCCCEEEEEECCC
Q ss_conf             868998999999---997499899982-----4788334888------------99999887400013674158883485
Q gi|254780438|r   21 LPWPNLVHIGKI---ALQSGASGLTVH-----PRPDQRHIRY------------TDLPEIRRLIDEQFPKAELNIEGYPN   80 (261)
Q Consensus        21 ~~~P~~~~~a~~---~~~~GadgITvH-----~R~DrRHI~~------------~Dv~~l~~~~~~~~~~~elNiEg~p~   80 (261)
                      ..|||+-....+   ..++|||-|-+-     |--|---||.            +|+.++.+-+.....++++=+=+|-+
T Consensus        23 aG~P~~e~s~~~l~~l~~~GadiiElGiPFSDP~ADGPvIq~A~~rAL~~G~~~~~~~~~~~~ir~~~~~~pivlMtY~N  102 (261)
T PRK13119         23 VGDPDIRTTLALMHGMVANGADILELGVPFSDPMADGPVIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLN  102 (261)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCEEEEECHH
T ss_conf             83899899999999999669999997898888666589999999999977997889999999865148998989984037


Q ss_pred             H-------HHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHC
Q ss_conf             6-------899999850721289710165553335782213337889999986202696389972544441479999740
Q gi|254780438|r   81 E-------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLT  153 (261)
Q Consensus        81 ~-------e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~  153 (261)
                      +       +|++-+.+.-=+- .++||-|-|-              -.++.+.+++.|+..-.|+-|..+..-++...+.
T Consensus       103 ~i~~yG~e~F~~~~~~~GvdG-vIipDLP~ee--------------~~~~~~~~~~~gl~~I~lvaPtt~~~Ri~~i~~~  167 (261)
T PRK13119        103 PVHKMGYREFAQEAAKAGVDG-VLTVDSPVET--------------IDPLYRELKDNGVDCIFLIAPTTTEDRIKTIAEL  167 (261)
T ss_pred             HHHHHHHHHHHHHHHHCCCCE-EEECCCCHHH--------------HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             898862999999999759857-9836899788--------------7999999997599764430799989999999972


Q ss_pred             CCCEEEE--C---CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCH-HHHHHHHHHCCCCEEEEEHHHHH
Q ss_conf             6614651--1---2111024443564336668899987665415623520789898-77999997369963884259999
Q gi|254780438|r  154 GADCIEL--Y---TGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTI-QNIPNLINAIPYISEISVGHAFA  227 (261)
Q Consensus       154 Gad~VEl--h---TG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~-~Nl~~~i~~Ip~I~EvsIGHaiI  227 (261)
                      ....|=.  .   ||.=. .  ........++++++.      ..+-|-+|-|..- +-+.. ++  ..-+=+-||-+||
T Consensus       168 a~gFiY~vs~~GvTG~~~-~--~~~~~~~~i~~ik~~------t~~Pv~vGFGIs~~e~v~~-~~--~~aDGvIVGSaiV  235 (261)
T PRK13119        168 AGGFVYYVSLKGVTGAAS-L--DTDEVSRKIEYLHQY------IDIPIGVGFGISNAESARK-IG--RVADAVIVGSRIV  235 (261)
T ss_pred             CCCEEEEEECCCCCCCCC-C--CHHHHHHHHHHHHHC------CCCCEEEEECCCCHHHHHH-HH--CCCCEEEECHHHH
T ss_conf             898199973666668775-5--548899999999863------6998799836599999999-87--3499999828999


Q ss_pred             HHHHHHHH--HHHHHHHHHHHHHH
Q ss_conf             99999409--99999999999741
Q gi|254780438|r  228 ATALECGV--KEAVFCFRRACGQH  249 (261)
Q Consensus       228 seAl~~GL--~~aI~~~~~ii~~~  249 (261)
                      -.=--.|-  ...|.+|-+-++++
T Consensus       236 ~~i~~~~~~~~~~v~~~vk~lk~a  259 (261)
T PRK13119        236 KEIENNAGNEAAAVGALVKELKDA  259 (261)
T ss_pred             HHHHHCCCCHHHHHHHHHHHHHHH
T ss_conf             999866887689999999999986


No 244
>PRK08574 cystathionine gamma-synthase; Provisional
Probab=33.96  E-value=40  Score=15.48  Aligned_cols=15  Identities=27%  Similarity=0.450  Sum_probs=6.8

Q ss_pred             HCCCCCEEEEEECCCC
Q ss_conf             2026963899725444
Q gi|254780438|r  127 LHNLGSRISLFADGNG  142 (261)
Q Consensus       127 l~~~girvSLFIDpd~  142 (261)
                      |.+.||.++ |+||+.
T Consensus       112 l~~~Gi~v~-~~~~~~  126 (384)
T PRK08574        112 LEKFGVRVR-LAYPST  126 (384)
T ss_pred             HHHHCCEEE-EECCCC
T ss_conf             986085799-948997


No 245
>pfam08915 tRNA-Thr_ED Archaea-specific editing domain of threonyl-tRNA synthetase. Archaea-specific editing domain of threonyl-tRNA synthetase, with marked structural similarity to D-amino acids deacylases found in eubacteria and eukaryotes. This domain can bind D-amino acids, and ensures high fidelity during translation. It is especially responsible for removing incorrectly attached serine from tRNA-Thr. The domain forms a fold that can be be defined as two layers of beta-sheets (a three-stranded sheet and a five-stranded sheet), with two alpha-helices located adjacent to the five-stranded sheet.
Probab=33.88  E-value=40  Score=15.47  Aligned_cols=49  Identities=16%  Similarity=0.202  Sum_probs=29.6

Q ss_pred             HHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEE
Q ss_conf             999974066146511211102444356433666889998766541562352
Q gi|254780438|r  147 LQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQIN  197 (261)
Q Consensus       147 i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~Vn  197 (261)
                      .+.|.++|+.+|=||  |||++-.+-..-...++-++..-..-.+-|++|.
T Consensus        63 ~~~a~kv~~~~ivlY--PyAHLSs~La~P~~A~~vL~~le~~L~~~g~eV~  111 (137)
T pfam08915        63 LKVASKVKATRVVLY--PYAHLSSDLASPGTAVEVLKGLEERLKEEGFEVY  111 (137)
T ss_pred             HHHHHHCCCCEEEEE--CHHHHCCCCCCCHHHHHHHHHHHHHHHHCCCEEE
T ss_conf             999984498679994--5033126558907999999999999975896599


No 246
>PRK08610 fructose-bisphosphate aldolase; Reviewed
Probab=33.69  E-value=40  Score=15.45  Aligned_cols=139  Identities=16%  Similarity=0.191  Sum_probs=84.2

Q ss_pred             CEEEEEECCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEE----------------
Q ss_conf             4158883485689999985072128971016555333578221333788999998620269638----------------
Q gi|254780438|r   71 AELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRI----------------  134 (261)
Q Consensus        71 ~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girv----------------  134 (261)
                      +-+++-=..+-+.+.-+++.-=+.|-+  |-       --|.+..|-..-+++++..+..|+-|                
T Consensus        80 V~lHLDH~~~~e~~~~ai~~GFtSVM~--Dg-------S~l~~eeNi~~Tk~vv~~Ah~~gv~VEaElG~vgg~ed~~~~  150 (286)
T PRK08610         80 VAIHLDHGSSFEKCKEAIDAGFTSVMI--DA-------SHSPFEENVATTKKVVEYAHEKGVSVEAELGTVGGQEDDVVA  150 (286)
T ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEE--CC-------CCCCHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCC
T ss_conf             899898999999999999719998998--19-------989899999999999999987088269975213675677667


Q ss_pred             --EEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHH
Q ss_conf             --997254444147999974066146511211102444356433666889998766541562352078989877999997
Q gi|254780438|r  135 --SLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLIN  212 (261)
Q Consensus       135 --SLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~  212 (261)
                        .+|-|  |++ ..+...++|+|+.=.=-|.-=-.|...  .+..++++++..+ +...-|-.|-|-|+.-+.+...++
T Consensus       151 ~~~~~T~--pee-a~~Fv~~TgvD~LAvaiGt~HG~yk~~--p~l~~~~L~~I~~-~~~vPLVLHGgSGi~~e~i~~ai~  224 (286)
T PRK08610        151 DGIIYAD--PKE-CQELVEKTGIDALAPALGSVHGPYKGE--PKLGFKEMEEIGL-STGLPLVLHGGTGIPTKDIQKAIP  224 (286)
T ss_pred             CCCCCCC--HHH-HHHHHHHHCCCEEEEECCCCCCCCCCC--CCCCHHHHHHHHH-HCCCCEEEECCCCCCHHHHHHHHH
T ss_conf             5430379--999-999999739866731115544655899--8778999999985-249997965899999999999998


Q ss_pred             HCCCCEEEEEHHHH
Q ss_conf             36996388425999
Q gi|254780438|r  213 AIPYISEISVGHAF  226 (261)
Q Consensus       213 ~Ip~I~EvsIGHai  226 (261)
                        -+|.-+|||--+
T Consensus       225 --~Gi~KvNi~T~l  236 (286)
T PRK08610        225 --FGTAKINVNTEN  236 (286)
T ss_pred             --CCCEEEEECCHH
T ss_conf             --598489967188


No 247
>TIGR02491 NrdG anaerobic ribonucleoside-triphosphate reductase activating protein; InterPro: IPR012837    This enzyme  is a member of the radical-SAM protein and utilises S-adenosyl methionine, an iron-sulphur cluster and a reductant (dihydroflavodoxin ) to produce a glycine-centred radical in the class III (anaerobic) ribonucleotide triphosphate reductase (NrdD, IPR009161 from INTERPRO). The two components form an alpha-2/beta-2 heterodimer.; GO: 0043365 [formate-C-acetyltransferase]-activating enzyme activity, 0051539 4 iron 4 sulfur cluster binding, 0005737 cytoplasm.
Probab=33.42  E-value=20  Score=17.57  Aligned_cols=20  Identities=30%  Similarity=0.438  Sum_probs=11.3

Q ss_pred             CCCEEEECCCCCHHHHHHHH
Q ss_conf             56235207898987799999
Q gi|254780438|r  192 MDLQINAGHDLTIQNIPNLI  211 (261)
Q Consensus       192 lgL~VnAGHgLn~~Nl~~~i  211 (261)
                      .||..-=|==|.=.|+..|+
T Consensus        66 ~G~tlsGGDPL~~~N~~~~~   85 (158)
T TIGR02491        66 DGLTLSGGDPLYPANVEELI   85 (158)
T ss_pred             EEEEECCCCCCCCCCHHHHH
T ss_conf             30143188888724436899


No 248
>PRK09454 ugpQ cytoplasmic glycerophosphodiester phosphodiesterase; Provisional
Probab=33.41  E-value=40  Score=15.42  Aligned_cols=34  Identities=15%  Similarity=0.108  Sum_probs=24.7

Q ss_pred             HHCCCCCCCCHHHHHHHHHHCCCCEE--EEECCCCC
Q ss_conf             22078868998999999997499899--98247883
Q gi|254780438|r   16 RNRRNLPWPNLVHIGKIALQSGASGL--TVHPRPDQ   49 (261)
Q Consensus        16 RnaRg~~~P~~~~~a~~~~~~GadgI--TvH~R~Dr   49 (261)
                      |-+++..-.|=+.+-..|.+.|||+|  =||+--|-
T Consensus        14 RG~~~~~PENTl~Af~~A~~~G~d~iE~DV~lTkDg   49 (249)
T PRK09454         14 RGGGKLAPENTLAAIDVGARYGHKMIEFDAKLSADG   49 (249)
T ss_pred             CCCCCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCC
T ss_conf             998989972049999999984999999985696899


No 249
>PRK09939 putative oxidoreductase; Provisional
Probab=33.39  E-value=36  Score=15.79  Aligned_cols=77  Identities=9%  Similarity=0.131  Sum_probs=50.7

Q ss_pred             HHHHHCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCC---CCCCHHHHHHHHHH----HCCCCCCCEEEEEECCCHHHHH
Q ss_conf             2232207886899899999999749989998247883---34888999998874----0001367415888348568999
Q gi|254780438|r   13 AVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQ---RHIRYTDLPEIRRL----IDEQFPKAELNIEGYPNETFLN   85 (261)
Q Consensus        13 AtLRnaRg~~~P~~~~~a~~~~~~GadgITvH~R~Dr---RHI~~~Dv~~l~~~----~~~~~~~~elNiEg~p~~e~i~   85 (261)
                      -.+-+-=|.++|-.+...+.|.+-||.=|++-|++-+   |+..+++....---    +...|-++..+=-++....|++
T Consensus       213 ~viG~Np~tnHPrml~~L~~a~~rGakII~iNPl~E~gL~rf~~Pq~p~~~l~~~~t~iad~~~qvr~GgD~All~gi~k  292 (759)
T PRK09939        213 ICIGHNPGTNHPRMLTSLRALVKRGAKMIAINPLQERGLERFTAPQNPFEMLTNSETQLASAYYNVRIGGDMALLKGMMR  292 (759)
T ss_pred             EEECCCCCCCCHHHHHHHHHHHHCCCCEEEECCCCHHHHHHCCCCCCCHHHCCCCCCHHHHHCCCCCCCCHHHHHHHHHH
T ss_conf             99845857458899999999998799589989975144554047554122215665334330258788837999999999


Q ss_pred             HHHH
Q ss_conf             9985
Q gi|254780438|r   86 LCER   89 (261)
Q Consensus        86 ia~~   89 (261)
                      .+++
T Consensus       293 ~lie  296 (759)
T PRK09939        293 LLIE  296 (759)
T ss_pred             HHHH
T ss_conf             9996


No 250
>PRK12653 fructose-6-phosphate aldolase; Reviewed
Probab=33.01  E-value=41  Score=15.37  Aligned_cols=195  Identities=15%  Similarity=0.103  Sum_probs=119.3

Q ss_pred             CCHHHHHHHHHHCCCCEEEEECCCCCCC-CCHHH-HHHHHHHHCCCCCCCEEEEEE--CCCHHHHHHHH---HHCCCEEE
Q ss_conf             9989999999974998999824788334-88899-999887400013674158883--48568999998---50721289
Q gi|254780438|r   24 PNLVHIGKIALQSGASGLTVHPRPDQRH-IRYTD-LPEIRRLIDEQFPKAELNIEG--YPNETFLNLCE---RYKPEQIT   96 (261)
Q Consensus        24 P~~~~~a~~~~~~GadgITvH~R~DrRH-I~~~D-v~~l~~~~~~~~~~~elNiEg--~p~~e~i~ia~---~ikP~qvt   96 (261)
                      -|+-+.-......-.+|+|--|-==+|- +.+.| +..+++.+.   +..++-+|-  .-.++|++-+.   +..|+-+-
T Consensus         8 Ad~~eIk~~~~~~~i~GvTTNPsll~k~g~~~~~~~~~i~~~~~---~~~~l~~qv~~~~~e~M~~~a~~l~~~~~nvvV   84 (220)
T PRK12653          8 SDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLEVVLPQLHEAMG---GQGRLFAQVMATTAEGMVNDARKLRSIIADIVV   84 (220)
T ss_pred             CCHHHHHHHHCCCCCCEECCCHHHHHHCCCCHHHHHHHHHHHHC---CCCCEEEEEEECCHHHHHHHHHHHHHHCCCEEE
T ss_conf             89999999970699375858899998559898999999999808---998589998758899999999999873578089


Q ss_pred             EEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             71016555333578221333788999998620269638997254444147999974066146511211102444356433
Q gi|254780438|r   97 LVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER  176 (261)
Q Consensus        97 LVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~  176 (261)
                      =||-     |.+|           -+.++.|++.||+|.+=.==.+.|  .-.|...||+.|-.|-|...+.-.++... 
T Consensus        85 KIP~-----t~~G-----------l~ai~~L~~~Gi~vn~Tavys~~Q--a~~Aa~aGA~yvsPyvgR~~d~g~Dg~~~-  145 (220)
T PRK12653         85 KVPV-----TAEG-----------LAAIKMLKAEGIPTLGTAVYGAAQ--GLLSALAGAEYVAPYVNRIDAQGGSGIQT-  145 (220)
T ss_pred             EECC-----CHHH-----------HHHHHHHHHCCCCEEEEECCCHHH--HHHHHHCCCCEEEEEEEEHHHCCCCHHHH-
T ss_conf             9488-----5789-----------999999988298778521067999--99999859988844425064338982668-


Q ss_pred             HHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHH-HHHHHHHHH
Q ss_conf             666889998766541562352078989877999997369963884259999999994099-999999999
Q gi|254780438|r  177 IFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVK-EAVFCFRRA  245 (261)
Q Consensus       177 ~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~-~aI~~~~~i  245 (261)
                        +..+++..+ .+..+-+|-|.-==|-+++.... . -+.+-+-|+..+..+.+.+-+. +++++|.+-
T Consensus       146 --i~~i~~~~~-~~~~~tkILaASiR~~~~v~~a~-~-~Gad~iTip~~v~~~l~~hplT~~~~~~F~~D  210 (220)
T PRK12653        146 --VTDLHQLLK-MHAPQAKVLAASFKTPRQALDCL-L-AGCESITLPLDVAQQMISYPAVDAAVAKFEQD  210 (220)
T ss_pred             --HHHHHHHHH-HCCCCCEEEEEECCCHHHHHHHH-H-CCCCEEECCHHHHHHHHCCHHHHHHHHHHHHH
T ss_conf             --999999999-76999889998389999999999-8-69999983999999997791279999999999


No 251
>PRK09456 phosphatase; Provisional
Probab=31.84  E-value=35  Score=15.88  Aligned_cols=41  Identities=15%  Similarity=0.244  Sum_probs=24.9

Q ss_pred             HHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEE
Q ss_conf             37889999986202696389972544441479999740661465
Q gi|254780438|r  116 NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIE  159 (261)
Q Consensus       116 ~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VE  159 (261)
                      +......+++++. ..-.-++|||-.+  ..+++|+++|...|-
T Consensus       143 d~~IY~~~l~~~~-l~P~e~lFiDD~~--eNv~aA~~lGi~~i~  183 (199)
T PRK09456        143 EARIYQHVLQAEG-FSAADAVFFDDNA--DNIEGANQLGITSIL  183 (199)
T ss_pred             CHHHHHHHHHHCC-CCHHHEEEECCCH--HHHHHHHHCCCEEEE
T ss_conf             7999999999829-7966868865998--889999986997999


No 252
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed
Probab=31.69  E-value=43  Score=15.23  Aligned_cols=194  Identities=15%  Similarity=0.153  Sum_probs=106.1

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHH-HHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEECCCCCC
Q ss_conf             9999999974998999824788334888999998-874000136741588834856899999850721289710165553
Q gi|254780438|r   27 VHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI-RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQL  105 (261)
Q Consensus        27 ~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l-~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~r~el  105 (261)
                      ..+..-|++.+..-|--.--...++...+-+..+ +.......-.+-+++-=..+.+.+.-+++.-=+.|-+  |     
T Consensus        32 ~Avi~AAee~~sPvIlq~s~~~~~~~g~~~~~~~~~~~a~~~~VPV~lHLDH~~~~e~i~~ai~~GftSVM~--D-----  104 (283)
T PRK07998         32 ISILNAIERSGLPNFIQIAPTNAQLSGYDYIYEIVKRHADKMDVPVSLHLDHGKTFEDVKQAVRAGFTSVMI--D-----  104 (283)
T ss_pred             HHHHHHHHHHCCCEEEECCHHHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEEEE--E-----
T ss_conf             999999999786989997750675559999999999999986998999758889999999999739988986--0-----


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCCCEE------------------EEEECCCCCCHHHHHHHHCCCCEEEECCCCCHH
Q ss_conf             33578221333788999998620269638------------------997254444147999974066146511211102
Q gi|254780438|r  106 TSDHGWDFLQNQALLTKTVARLHNLGSRI------------------SLFADGNGNEHSLQAAKLTGADCIELYTGPYGA  167 (261)
Q Consensus       106 TTegGldv~~~~~~L~~~i~~l~~~girv------------------SLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~  167 (261)
                        ---|.+..|-..-+.+++..+..|+-|                  .++-  +|++ ..+...++|+|+.=.--|.-=-
T Consensus       105 --gS~l~~eeNi~~Tk~vv~~Ah~~gv~VEaElG~i~G~ed~~~~~~~~~T--~Pee-a~~Fv~~TgvD~LAvaiGt~HG  179 (283)
T PRK07998        105 --GAALPFEENIAFTQEAVDFCKSYGVPVEAELGAILGKEDDHVSEADCKT--EPEK-VKTFVERTGCDMLAVSIGNVHG  179 (283)
T ss_pred             --CCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCCCCCCCCCC--CHHH-HHHHHHHHCCCEEEEECCCCCC
T ss_conf             --9989999999999999999977699799985353575477777520389--9999-9999998688999640466456


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             4443564336668899987665415623520789898779999973699638842599999999940999999999
Q gi|254780438|r  168 CYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR  243 (261)
Q Consensus       168 a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~  243 (261)
                      ....+   ..-++.+++..+ +...-|-.|-|.|+.-+.+...++  -+|.-+|||--+     .+.+.+++++|+
T Consensus       180 ~~~~p---~l~~~~l~~I~~-~~~iPLVLHGgSGi~~e~i~~ai~--~Gi~KiNi~Tel-----~~a~~~~~r~~l  244 (283)
T PRK07998        180 LDDIP---RIDIPLLKRIAE-VSPVPLVIHGGSGIPPDILRSFVN--YRVAKVNIASDL-----RKAFITTVGKAY  244 (283)
T ss_pred             CCCCC---CCCHHHHHHHHH-HCCCCEEEECCCCCCHHHHHHHHH--CCCEEEEECHHH-----HHHHHHHHHHHH
T ss_conf             78788---638999999886-479878986999999999999998--698699958689-----999999999999


No 253
>pfam06713 DUF1200 Protein of unknown function (DUF1200). This family consists of several hypothetical proteins specific to Oceanobacillus and Bacillus species. Members of this family are typically around 130 residues in length. The function of this family is unknown.
Probab=31.33  E-value=20  Score=17.46  Aligned_cols=34  Identities=21%  Similarity=0.369  Sum_probs=24.0

Q ss_pred             HHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             9740661465112111024443564336668899
Q gi|254780438|r  150 AKLTGADCIELYTGPYGACYNNPQQERIFLNKLA  183 (261)
Q Consensus       150 a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~  183 (261)
                      +..+..|++|++.|.|....-.|++.+.+++.++
T Consensus        38 ~~alS~drleI~y~~~~~i~ISPk~~e~Fi~~L~   71 (74)
T pfam06713        38 SPALSLDRLEIKYGKYDTILISPKDKEEFIELLK   71 (74)
T ss_pred             CCCCCCCEEEEEECCCCEEEECCCCHHHHHHHHH
T ss_conf             6411234699997997879995499999999998


No 254
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional
Probab=31.33  E-value=40  Score=15.40  Aligned_cols=21  Identities=5%  Similarity=0.148  Sum_probs=14.1

Q ss_pred             HHHHHHHCCCCCEEEEEECCC
Q ss_conf             999986202696389972544
Q gi|254780438|r  121 TKTVARLHNLGSRISLFADGN  141 (261)
Q Consensus       121 ~~~i~~l~~~girvSLFIDpd  141 (261)
                      .|.++.+++.|+.|=++.||-
T Consensus       477 SP~lE~~k~kg~EVL~l~dpi  497 (701)
T PTZ00272        477 SPFIEQARRRGLEVLFMTEPI  497 (701)
T ss_pred             CCHHHHHHHCCCCEEECCCCH
T ss_conf             918999997899456137727


No 255
>pfam10188 Oscp1 Organic solute transport protein 1. Oscp1 is a family of proteins conserved from plants to humans. It is called organic solute transport protein or oxido-red- nitro domain-containing protein 1, however no reference could be find to confirm the function of the protein.
Probab=31.16  E-value=44  Score=15.17  Aligned_cols=31  Identities=10%  Similarity=0.149  Sum_probs=20.3

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCEEEEEECC
Q ss_conf             8221333788999998620269638997254
Q gi|254780438|r  110 GWDFLQNQALLTKTVARLHNLGSRISLFADG  140 (261)
Q Consensus       110 Gldv~~~~~~L~~~i~~l~~~girvSLFIDp  140 (261)
                      .+........-...+.-|++.++|||+|+.-
T Consensus       132 ~l~~~~~~~ir~~ll~flqd~~vkVSifL~~  162 (173)
T pfam10188       132 PLGPGDQLMIRNELLNFLQDRNTKVSVFLED  162 (173)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCEEEEEEHHC
T ss_conf             5998899999999999967786388764621


No 256
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional
Probab=31.13  E-value=44  Score=15.17  Aligned_cols=186  Identities=18%  Similarity=0.155  Sum_probs=104.0

Q ss_pred             CCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHH----HHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEE
Q ss_conf             689989999999974998999824788334888999----9988740001367415888348568999998507212897
Q gi|254780438|r   22 PWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDL----PEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITL   97 (261)
Q Consensus        22 ~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv----~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtL   97 (261)
                      ..|++++....+++.|++-|-  +|+-  +..+++.    ..|+++|..+  +.+|=|     ..-+++|+.+.-|-|-|
T Consensus       153 ~~~~l~~~Ve~AL~gGv~ivQ--lR~K--~~~~~~~l~~A~~l~~Lc~~y--~a~fII-----NDrvDlAlav~ADGVHL  221 (345)
T PRK02615        153 PSEDLLEVVEAALKAGVKLVQ--YRDK--TGDDRERLEEAKQLKELCKRY--GALFIV-----NDRVDIALAVDADGVHL  221 (345)
T ss_pred             CCCCHHHHHHHHHHCCCCEEE--EECC--CCCHHHHHHHHHHHHHHHHHH--CCEEEE-----ECCHHHHHHCCCCEEEE
T ss_conf             963499999999975998898--3058--999999999999999999995--994898-----19699999749987755


Q ss_pred             EECCCCCCCCCCCCCHHHHHHHHHHHHHHHCC-CCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHH
Q ss_conf             10165553335782213337889999986202-69638997254444147999974066146511211102444356433
Q gi|254780438|r   98 VPDDPHQLTSDHGWDFLQNQALLTKTVARLHN-LGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER  176 (261)
Q Consensus        98 VPe~r~elTTegGldv~~~~~~L~~~i~~l~~-~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~  176 (261)
                      =.+.                -.+...=+.+.. .=|-+|.  . +++|  +..|...|+|.|=+  ||+-....++....
T Consensus       222 GQ~D----------------lpi~~aR~llG~~~iIG~S~--h-~~ee--~~~A~~~gaDYig~--Gpvf~T~TK~~~~p  278 (345)
T PRK02615        222 GQED----------------LPLAVARQLLGPEKIIGRST--T-NPEE--LAKAIAEGADYIGV--GPVFPTPTKPGKAP  278 (345)
T ss_pred             CCCC----------------CCHHHHHHHCCCCCEEEECC--C-CHHH--HHHHHHCCCCEEEE--CCEEECCCCCCCCC
T ss_conf             8887----------------89999998739991899617--9-9999--99998639997998--87742588888887


Q ss_pred             HHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6668899987665415623520789898779999973699638842599999999940999999999999741
Q gi|254780438|r  177 IFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQH  249 (261)
Q Consensus       177 ~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~~~  249 (261)
                      .-++.++..+   ....+-+-|==|.|.+|+..+++  -+.+-|-+=-+|..-   ---+.+.+.+++.+.+.
T Consensus       279 ~Gl~~l~~~~---~~~~iPvvAIGGI~~~N~~~v~~--aGa~gvAVisAI~~A---~DP~~aa~~ll~~l~~~  343 (345)
T PRK02615        279 AGLEYLKYAR---KEANIPWFAIGGIDKSNISEVLQ--AGADRVAVVRAIMNA---EDPKQATQELLEQLSRE  343 (345)
T ss_pred             CCHHHHHHHH---HHCCCCEEEECCCCHHHHHHHHH--CCCCEEEEEHHHHCC---CCHHHHHHHHHHHHHCC
T ss_conf             8999999999---83799999999969999999998--599999982285579---99999999999997304


No 257
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated
Probab=31.04  E-value=44  Score=15.16  Aligned_cols=112  Identities=15%  Similarity=0.190  Sum_probs=65.0

Q ss_pred             CCHHHHHHHHHHCCCCEEE-EECCC--CCCCCCHHHHHHHHHHHCCCCCCCEEEEEECC---------------------
Q ss_conf             9989999999974998999-82478--83348889999988740001367415888348---------------------
Q gi|254780438|r   24 PNLVHIGKIALQSGASGLT-VHPRP--DQRHIRYTDLPEIRRLIDEQFPKAELNIEGYP---------------------   79 (261)
Q Consensus        24 P~~~~~a~~~~~~GadgIT-vH~R~--DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p---------------------   79 (261)
                      .||+++|+.-.+.||+-|- |-+-.  +-|-++.+=+..+++-+     .+|+-+-|--                     
T Consensus        29 ~dP~~~A~~~~~~Ga~~lhvvDLd~A~~g~~~n~~~I~~i~~~~-----~~pi~vGGGIrs~e~~~~~l~~GadkVvigS  103 (241)
T PRK00748         29 DDPLAQAQAWQDQGAEWLHLVDLDGAFAGRPVNLELIEAIVAAV-----DIPVQLGGGIRDLETVEAYLDAGVARVIIGT  103 (241)
T ss_pred             CCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHC-----CCCEEEECCCCCHHHHHHHHHCCCCEEEECC
T ss_conf             89999999999879998999978542028820799999999867-----9999982770749999999976977588647


Q ss_pred             ----CHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCC
Q ss_conf             ----56899999850721289710165553335782213337889999986202696389972544
Q gi|254780438|r   80 ----NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGN  141 (261)
Q Consensus        80 ----~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd  141 (261)
                          +++|++-+.+.=|+|+++-=|-++..-.-+||.-..+. .+.++++.+.+.|++-=++-|-+
T Consensus       104 ~a~~n~~~i~~~~~~~g~~ivvsiD~k~~~v~~~gw~~~t~~-~~~~~i~~~~~~G~~eii~tdI~  168 (241)
T PRK00748        104 AAVKNPELVKEACKKFPGRIVVGLDARDGKVATRGWQEVSGV-DLEDLAKRFEDAGVAAIIYTDIS  168 (241)
T ss_pred             HHHHCHHHHHHHHHHCCCCEEEEEEECCCEEECCCCCCCCCC-CHHHHHHHHHHCCCCEEEEEEEE
T ss_conf             103396899999862355579999821665401575546797-48999999985587569998870


No 258
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional
Probab=30.94  E-value=44  Score=15.15  Aligned_cols=88  Identities=13%  Similarity=0.133  Sum_probs=58.0

Q ss_pred             HHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCEE
Q ss_conf             89999986202696389972544441479999740661465112111024443564336668899987665415--6235
Q gi|254780438|r  119 LLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKM--DLQI  196 (261)
Q Consensus       119 ~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~l--gL~V  196 (261)
                      .+.+.++.+++.....-+-|+.+- ..+++.|.+.|+|.|=|-      .|. +       +.++++.++....  ...+
T Consensus       184 ~i~~ai~~~r~~~~~~kIeVEv~s-l~q~~ea~~~gaDiImLD------Nms-~-------e~~~~av~~~~~~~~~v~l  248 (288)
T PRK07896        184 SVVAALRAVRAAAPDLPCEVEVDS-LEQLDEVLAEGAELILLD------NFP-V-------WQTQEAVQRRDARAPTVLL  248 (288)
T ss_pred             CHHHHHHHHHHHCCCCEEEEEECC-HHHHHHHHHCCCCEEEEC------CCC-H-------HHHHHHHHHHHCCCCCEEE
T ss_conf             699999999985899619999797-999999874699999977------999-9-------9999999998376987489


Q ss_pred             EECCCCCHHHHHHHHHHCCCCEEEEEH
Q ss_conf             207898987799999736996388425
Q gi|254780438|r  197 NAGHDLTIQNIPNLINAIPYISEISVG  223 (261)
Q Consensus       197 nAGHgLn~~Nl~~~i~~Ip~I~EvsIG  223 (261)
                      -|-=|.|.+|+..+ ++ -+++=+|+|
T Consensus       249 EaSGgI~~~ni~~y-A~-tGVD~IS~G  273 (288)
T PRK07896        249 ESSGGLTLDTAAAY-AA-TGVDYLAVG  273 (288)
T ss_pred             EEECCCCHHHHHHH-HH-CCCCEEECC
T ss_conf             99889999999999-96-599999878


No 259
>pfam01053 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme. This family includes enzymes involved in cysteine and methionine metabolism. The following are members: Cystathionine gamma-lyase, Cystathionine gamma-synthase, Cystathionine beta-lyase, Methionine gamma-lyase, OAH/OAS sulfhydrylase, O-succinylhomoserine sulfhydrylase All of these members participate is slightly different reactions. All these enzymes use PLP (pyridoxal-5'-phosphate) as a cofactor.
Probab=30.91  E-value=43  Score=15.25  Aligned_cols=11  Identities=27%  Similarity=0.676  Sum_probs=4.5

Q ss_pred             CCCCEEEEEECC
Q ss_conf             269638997254
Q gi|254780438|r  129 NLGSRISLFADG  140 (261)
Q Consensus       129 ~~girvSLFIDp  140 (261)
                      +.||.|+ |+||
T Consensus       114 ~~Gi~v~-~~d~  124 (381)
T pfam01053       114 RFGIEVT-FVDP  124 (381)
T ss_pred             HCCCEEE-EECC
T ss_conf             1585067-6266


No 260
>PRK00143 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; Reviewed
Probab=30.83  E-value=25  Score=16.83  Aligned_cols=21  Identities=43%  Similarity=0.409  Sum_probs=17.3

Q ss_pred             HHHHHHHCCCCEEEECCCCCHHH
Q ss_conf             79999740661465112111024
Q gi|254780438|r  146 SLQAAKLTGADCIELYTGPYGAC  168 (261)
Q Consensus       146 ~i~~a~~~Gad~VElhTG~Ya~a  168 (261)
                      -++.|+++|+|.|  =||+||..
T Consensus       110 l~~~A~~lgad~i--ATGHYAri  130 (355)
T PRK00143        110 FLDYALELGADYI--ATGHYARI  130 (355)
T ss_pred             HHHHHHHCCCCEE--CCCCEEEE
T ss_conf             9999987399842--33525999


No 261
>PRK12325 prolyl-tRNA synthetase; Provisional
Probab=30.63  E-value=45  Score=15.11  Aligned_cols=13  Identities=23%  Similarity=0.020  Sum_probs=6.8

Q ss_pred             CCCHHHHHHHHHH
Q ss_conf             4888999998874
Q gi|254780438|r   51 HIRYTDLPEIRRL   63 (261)
Q Consensus        51 HI~~~Dv~~l~~~   63 (261)
                      |+.+.|++.-+.-
T Consensus        73 ~l~~~~Lw~~SGh   85 (438)
T PRK12325         73 TIQPADLWRESGR   85 (438)
T ss_pred             CCCCHHHHHHHCC
T ss_conf             6587789986287


No 262
>PRK06460 hypothetical protein; Provisional
Probab=30.20  E-value=45  Score=15.06  Aligned_cols=16  Identities=19%  Similarity=0.308  Sum_probs=7.1

Q ss_pred             HHHCCCCEEEECCCCC
Q ss_conf             9740661465112111
Q gi|254780438|r  150 AKLTGADCIELYTGPY  165 (261)
Q Consensus       150 a~~~Gad~VElhTG~Y  165 (261)
                      ..+.|||.|=-=+-+|
T Consensus       177 Pl~~GaDivvhS~TKy  192 (375)
T PRK06460        177 PLVQGADIVIHSASKF  192 (375)
T ss_pred             HHHHCCCEEEEECCCC
T ss_conf             1451798899955643


No 263
>PRK09250 fructose-bisphosphate aldolase; Provisional
Probab=29.93  E-value=32  Score=16.15  Aligned_cols=45  Identities=20%  Similarity=0.231  Sum_probs=23.3

Q ss_pred             HHHHHHHHHHHHCCCCCEEEEEECC---------CCCC------HHHHHHHHCCCCEEEE
Q ss_conf             3788999998620269638997254---------4441------4799997406614651
Q gi|254780438|r  116 NQALLTKTVARLHNLGSRISLFADG---------NGNE------HSLQAAKLTGADCIEL  160 (261)
Q Consensus       116 ~~~~L~~~i~~l~~~girvSLFIDp---------d~~q------~~i~~a~~~Gad~VEl  160 (261)
                      ....+..+...-++.|.-|-+..=|         |++-      ..-..|..+|||.|-.
T Consensus       177 mi~E~~~i~~eAh~~GL~tVlW~YpRG~a~kkegD~etA~Dl~ayAAhlAa~LGAdIIKV  236 (348)
T PRK09250        177 QIEEISEAFEEAHELGLATVLWSYLRNSAFKKDGDYHTAADLTGQANHLAATIGADIIKQ  236 (348)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             999999999999976980899972478544557881157888889999999855887983


No 264
>COG0224 AtpG F0F1-type ATP synthase, gamma subunit [Energy production and conversion]
Probab=29.89  E-value=46  Score=15.03  Aligned_cols=61  Identities=25%  Similarity=0.307  Sum_probs=46.2

Q ss_pred             CCCCCCCCCHHHHHHHHH---HHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHH
Q ss_conf             533357822133378899---9998620269638997254444147999974066146511211102
Q gi|254780438|r  104 QLTSDHGWDFLQNQALLT---KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGA  167 (261)
Q Consensus       104 elTTegGldv~~~~~~L~---~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~  167 (261)
                      -+|||-||-=.-|.+.++   ..++.+++.|..+.+++=.   ++..+.-+..|.+.++-++|....
T Consensus        77 viTSDrGLcG~~Nsni~k~~~~~i~~~~~~~~~~~li~iG---~Kg~~~f~~~~~~i~~~~~~l~~~  140 (287)
T COG0224          77 VITSDRGLCGGFNSNIFKKVENLIKELKNKGKEVKLILIG---KKGIDFFKKRGYNILESFTGLGDN  140 (287)
T ss_pred             EEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEC---HHHHHHHHHCCCCHHHHHHCCCCC
T ss_conf             9956853010002999999999997503258824999976---689999986696366687343568


No 265
>PRK07709 fructose-bisphosphate aldolase; Provisional
Probab=29.70  E-value=46  Score=15.01  Aligned_cols=139  Identities=15%  Similarity=0.179  Sum_probs=78.5

Q ss_pred             CEEEEEECCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEE----------------
Q ss_conf             4158883485689999985072128971016555333578221333788999998620269638----------------
Q gi|254780438|r   71 AELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRI----------------  134 (261)
Q Consensus        71 ~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girv----------------  134 (261)
                      +-+++-=..+.+++.-+++.-=+.|-+=         ---|.+..|-..-+++++..+..|+-|                
T Consensus        80 V~lHLDH~~~~e~i~~ai~~Gf~SVM~D---------~S~l~~eeNi~~Tk~vv~~Ah~~gv~VEaElG~igg~ed~~~~  150 (285)
T PRK07709         80 VAIHLDHGSSFEKCKEAIDAGFTSVMID---------ASHHPFEENVETTKKVVEYAHARNVSVEAELGTVGGQEDDVIA  150 (285)
T ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEEC---------CCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCC
T ss_conf             8988999999999999997299779852---------9989999999999999999987498399972323675677677


Q ss_pred             --EEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHH
Q ss_conf             --997254444147999974066146511211102444356433666889998766541562352078989877999997
Q gi|254780438|r  135 --SLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLIN  212 (261)
Q Consensus       135 --SLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~  212 (261)
                        +++-|  |++ ..+...++|+|+.=.=-|.-=-.|..  .....++++++..+ +...-|-.|-|.|+.-+.+...++
T Consensus       151 ~~~~~T~--pe~-a~~Fv~~TgvD~LAvaiGn~HG~yk~--~p~l~~~~l~~i~~-~~~vPLVLHGgSG~~~e~i~~ai~  224 (285)
T PRK07709        151 EGVIYAD--PAE-CKHLVEATGIDCLAPALGSVHGPYKG--EPNLGFAEMEQVRD-FTGVPLVLHGGTGIPTADIEKAIS  224 (285)
T ss_pred             CCCCCCC--HHH-HHHHHHHHCCCEEEHHHCCCCCCCCC--CCCCCHHHHHHHHH-CCCCCEEEECCCCCCHHHHHHHHH
T ss_conf             5551579--999-99999731878884220555577689--88766999999984-059987964999999999999998


Q ss_pred             HCCCCEEEEEHHHH
Q ss_conf             36996388425999
Q gi|254780438|r  213 AIPYISEISVGHAF  226 (261)
Q Consensus       213 ~Ip~I~EvsIGHai  226 (261)
                        -+|.-+|||--+
T Consensus       225 --~Gv~KiNi~T~l  236 (285)
T PRK07709        225 --LGTSKINVNTEN  236 (285)
T ss_pred             --CCCEEEEECHHH
T ss_conf             --598599988288


No 266
>TIGR01919 hisA-trpF bifunctional HisA/TrpF protein; InterPro: IPR010188   This entry represents a bifunctional protein possessing both hisA (1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase) and trpF (N-(5'phosphoribosyl)anthranilate isomerase) activities . Thus, it is involved in both the histidine and tryptophan biosynthetic pathways. Enzymes with this property have been described only in the Actinobacteria (High-GC Gram-positive). The enzyme is closely related to the monofunctional HisA proteins and in Actinobacteria, the classical monofunctional TrpF is generally absent.; GO: 0003949 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity, 0004640 phosphoribosylanthranilate isomerase activity, 0000105 histidine biosynthetic process, 0000162 tryptophan biosynthetic process, 0005737 cytoplasm.
Probab=29.34  E-value=47  Score=14.97  Aligned_cols=49  Identities=29%  Similarity=0.312  Sum_probs=23.4

Q ss_pred             CCHHHHHHHHHHHHHHHCC-CCCEEEEEECCCCCCHHHHHHHHCCCCEEEECC
Q ss_conf             2213337889999986202-696389972544441479999740661465112
Q gi|254780438|r  111 WDFLQNQALLTKTVARLHN-LGSRISLFADGNGNEHSLQAAKLTGADCIELYT  162 (261)
Q Consensus       111 ldv~~~~~~L~~~i~~l~~-~girvSLFIDpd~~q~~i~~a~~~Gad~VElhT  162 (261)
                      ++-.+|++.|.++|.+|-+ -.|..|==|=-|   .++++|.+.|+.||-+=|
T Consensus        58 Fg~G~N~e~l~EiVg~LddrV~vELsGGiRDD---~SL~~AL~tGa~RVNiGT  107 (246)
T TIGR01919        58 FGRGSNHELLAEIVGKLDDRVDVELSGGIRDD---ESLEAALATGAARVNIGT  107 (246)
T ss_pred             CCCCCHHHHHHHHHHHHCCEEEEEEECCCCCH---HHHHHHHHHCCCEEECCH
T ss_conf             37897088999998630787889850685567---899999980773440010


No 267
>cd00862 ProRS_anticodon_zinc ProRS Prolyl-anticodon binding domain, long version found predominantly in eukaryotes and archaea. ProRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only, and an additional C-terminal zinc-binding domain specific to this subfamily of aaRSs.
Probab=29.11  E-value=47  Score=14.94  Aligned_cols=24  Identities=25%  Similarity=0.332  Sum_probs=12.7

Q ss_pred             CCEEEEEECCCHHHHHHHHHHCCCEEEEEECC
Q ss_conf             74158883485689999985072128971016
Q gi|254780438|r   70 KAELNIEGYPNETFLNLCERYKPEQITLVPDD  101 (261)
Q Consensus        70 ~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~  101 (261)
                      .+|+-||.-|.        ++.-.+||++-=.
T Consensus        67 GVPiRIEIGpr--------Dle~~~v~v~rRD   90 (202)
T cd00862          67 GVPLRIEIGPR--------DLEKNTVVIVRRD   90 (202)
T ss_pred             CCCEEEEECHH--------HHHCCCEEEEEEC
T ss_conf             89779998715--------8637918999917


No 268
>pfam00145 DNA_methylase C-5 cytosine-specific DNA methylase.
Probab=29.10  E-value=47  Score=14.94  Aligned_cols=49  Identities=24%  Similarity=0.294  Sum_probs=32.1

Q ss_pred             CHHHHHHHHHHCCCEEEE--EECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEE
Q ss_conf             568999998507212897--10165553335782213337889999986202696389972
Q gi|254780438|r   80 NETFLNLCERYKPEQITL--VPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFA  138 (261)
Q Consensus        80 ~~e~i~ia~~ikP~qvtL--VPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFI  138 (261)
                      +.+|+.++..++|..+-+  ||.    +.+-      ++...+..+++.|.+.|-.++.++
T Consensus        90 ~~~~~~~v~~~~Pk~~v~ENV~g----l~~~------~~~~~~~~i~~~l~~~GY~v~~~v  140 (319)
T pfam00145        90 FFEIIRIIKEKKPKAFLLENVKG----LLSH------DNGNTLNVILETLEELGYSVSWKV  140 (319)
T ss_pred             HHHHHHHHHHHCCCEEEEECCHH----HHCC------CCHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             99999987751986887304087----8644------530589999999986798553210


No 269
>PRK08949 consensus
Probab=29.02  E-value=47  Score=14.93  Aligned_cols=106  Identities=14%  Similarity=0.202  Sum_probs=57.2

Q ss_pred             CHHHHHHHHHHHCCCC---CCCEEEEEECC---CHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCH---HHHHHHHHHH
Q ss_conf             8899999887400013---67415888348---5689999985072128971016555333578221---3337889999
Q gi|254780438|r   53 RYTDLPEIRRLIDEQF---PKAELNIEGYP---NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDF---LQNQALLTKT  123 (261)
Q Consensus        53 ~~~Dv~~l~~~~~~~~---~~~elNiEg~p---~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv---~~~~~~L~~~  123 (261)
                      .++.+..|-+.+...+   ++.|+.+|++|   +.+.+....+..=+.+-+=-..    ..+.-+..   ..........
T Consensus        73 ~~~~l~~ll~~i~~~f~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvNRiSlGvQs----f~~~~L~~lgR~h~~~~~~~a  148 (378)
T PRK08949         73 SAEAMQTLLDGVRARLPFAADAEITMEANPGTVEADRFVGYQRAGVNRISIGVQS----FSEEKLKRLGRIHGPQEAKRA  148 (378)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEEECC----CCHHHHHHHCCCCCHHHHHHH
T ss_conf             9999999999999867987670589955825231889999997198669995034----898999983799999999999


Q ss_pred             HHHHCCCCCE-EEE-EECCCCCC------HHHHHHHHCCCCEEEECC
Q ss_conf             9862026963-899-72544441------479999740661465112
Q gi|254780438|r  124 VARLHNLGSR-ISL-FADGNGNE------HSLQAAKLTGADCIELYT  162 (261)
Q Consensus       124 i~~l~~~gir-vSL-FIDpd~~q------~~i~~a~~~Gad~VElhT  162 (261)
                      +..+++.|+. +|+ ||---|.|      .+++.+.+++++.|-+|.
T Consensus       149 ~~~~~~~gf~~iniDLiyglP~Qt~~~~~~~l~~~~~l~p~hiS~Y~  195 (378)
T PRK08949        149 AKLASGLGLRSFNLDLMHGLPDQSLEEALDDLRQAIALNPPHLSWYQ  195 (378)
T ss_pred             HHHHHHCCCCCEEECCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             99998659962502323689998999999999999666998378874


No 270
>cd01998 tRNA_Me_trans tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs. This family of enzyme only presents in bacteria and eukaryote. The  archaeal counterpart of this enzyme performs same function, but is completely unrelated in sequence.
Probab=28.96  E-value=29  Score=16.40  Aligned_cols=101  Identities=17%  Similarity=0.128  Sum_probs=51.0

Q ss_pred             HHHHHHHHCCC--CEEEEECCCCCCC----CCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEECC
Q ss_conf             99999997499--8999824788334----88899999887400013674158883485689999985072128971016
Q gi|254780438|r   28 HIGKIALQSGA--SGLTVHPRPDQRH----IRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDD  101 (261)
Q Consensus        28 ~~a~~~~~~Ga--dgITvH~R~DrRH----I~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~  101 (261)
                      -+|.+..+.|-  -|+|+.+-++.-.    -..+|+.+.++++..  -++|+- ..+..++|-+                
T Consensus        14 vaA~LL~~~G~~V~gv~m~~w~~~~~~~~C~~~~d~~dA~~va~~--LgIp~~-v~d~~~ef~~----------------   74 (349)
T cd01998          14 VAAALLKEQGYEVIGVFMKNWDEDDGKGGCCSEEDLKDARRVADQ--LGIPHY-VVNFEKEYWE----------------   74 (349)
T ss_pred             HHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHH--CCCCEE-EECHHHHHHH----------------
T ss_conf             999999877995799999967887667898867789999999998--699679-9680998868----------------


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCC-----CCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHH
Q ss_conf             5553335782213337889999986202-----696389972544441479999740661465112111024
Q gi|254780438|r  102 PHQLTSDHGWDFLQNQALLTKTVARLHN-----LGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGAC  168 (261)
Q Consensus       102 r~elTTegGldv~~~~~~L~~~i~~l~~-----~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a  168 (261)
                                      .-+.++++....     -++.+-=+|-  .. .-++.|+++|+|.|  =||+||..
T Consensus        75 ----------------~V~~~f~~~Y~~G~TPNPcv~CN~~IK--F~-~l~~~A~~~g~d~i--ATGHYAri  125 (349)
T cd01998          75 ----------------KVFEPFLEEYKKGRTPNPDILCNKEIK--FG-ALLDYAKKLGADYI--ATGHYARI  125 (349)
T ss_pred             ----------------HHHHHHHHHHHCCCCCCCCHHCCCEEE--HH-HHHHHHHHCCCCEE--CCCCEEEE
T ss_conf             ----------------889999999974899987621187351--99-99999987599864--13514788


No 271
>PRK12376 putative translaldolase; Provisional
Probab=28.93  E-value=48  Score=14.92  Aligned_cols=186  Identities=13%  Similarity=0.121  Sum_probs=101.9

Q ss_pred             CCCCHHHHHHHHHHCCCCEEEEECCCCCCC-CCHHHHHHHHHHHCCCCCCCEEEEEECCC--HHHHHHHH---HHCCCEE
Q ss_conf             689989999999974998999824788334-88899999887400013674158883485--68999998---5072128
Q gi|254780438|r   22 PWPNLVHIGKIALQSGASGLTVHPRPDQRH-IRYTDLPEIRRLIDEQFPKAELNIEGYPN--ETFLNLCE---RYKPEQI   95 (261)
Q Consensus        22 ~~P~~~~~a~~~~~~GadgITvH~R~DrRH-I~~~Dv~~l~~~~~~~~~~~elNiEg~p~--~e~i~ia~---~ikP~qv   95 (261)
                      |..|+-+..+.....-.+|+|--|-==+|- +.+. ...+++++ ...++.++-+|--..  ++|++-+.   ++.|+-+
T Consensus        13 DtAdl~eI~~~~~~g~i~GVTTNPsLl~k~G~~d~-~~~~~~i~-~~i~~~~is~EV~~~~~~~mi~qA~~l~~~~~nv~   90 (238)
T PRK12376         13 DGADLEEMLKAYKNPLVKGFTTNPSLMKKAGITDY-KAFAKEVL-AEIPDYPISFEVFADDLETMEKEAEILASLGENVY   90 (238)
T ss_pred             ECCCHHHHHHHHCCCCCCEEECCHHHHHHCCCCCH-HHHHHHHH-HHCCCCCEEEEEECCCHHHHHHHHHHHHHHCCCEE
T ss_conf             66899999999628991579078899986699978-99999999-63899877999956877889999999997589779


Q ss_pred             EEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCC----EEEECCCCCHHHHHH
Q ss_conf             9710165553335782213337889999986202696389972544441479999740661----465112111024443
Q gi|254780438|r   96 TLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGAD----CIELYTGPYGACYNN  171 (261)
Q Consensus        96 tLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad----~VElhTG~Ya~a~~~  171 (261)
                      -=||     +|+.+|+..       .+.++.|.+.||+|.+=.==.+.|  ..++...+++    .|-.|-|.-.+.=.+
T Consensus        91 VKIP-----~t~~~G~~~-------~~~ik~L~~~Gi~vnvTaifs~~Q--a~~a~~A~a~~~a~yvSpfvGRi~D~G~D  156 (238)
T PRK12376         91 VKIP-----ITNTKGEST-------IPLIKKLSADGIKLNVTAIFTIEQ--VKEVVDALTPGVPSIVSVFAGRIADTGVD  156 (238)
T ss_pred             EEEC-----CCCCCHHHH-------HHHHHHHHHCCCCEEEEEEECHHH--HHHHHHHCCCCCCEEEEEECCHHHHCCCC
T ss_conf             9977-----857551899-------999999988799668999827999--99999852777882775121308655998


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHH
Q ss_conf             56433666889998766541562352078989877999997369963884259999999
Q gi|254780438|r  172 PQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATA  230 (261)
Q Consensus       172 ~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseA  230 (261)
                      +.   ..++.+.+...  ....-+|-|.-==|.+++.... . -+.+=+-|...++..-
T Consensus       157 g~---~~i~~~~~i~~--~~~~tkILaASiR~~~~v~~a~-~-~GadiiTipp~vl~kl  208 (238)
T PRK12376        157 PL---PLMKEALKICH--QKPGVELLWASPRELYNIIQAD-Q-LGCDIITVTADILKKL  208 (238)
T ss_pred             CH---HHHHHHHHHHH--CCCCEEEEEEECCCHHHHHHHH-H-CCCCEEECCHHHHHHH
T ss_conf             27---99999999984--2887499997148889999999-8-6999998499999986


No 272
>KOG0134 consensus
Probab=28.87  E-value=48  Score=14.91  Aligned_cols=16  Identities=31%  Similarity=0.594  Sum_probs=7.6

Q ss_pred             HHHHHHHCCCCEEEEE
Q ss_conf             9999997499899982
Q gi|254780438|r   29 IGKIALQSGASGLTVH   44 (261)
Q Consensus        29 ~a~~~~~~GadgITvH   44 (261)
                      ||+.+-.+|+|||-+|
T Consensus       179 Aak~~~e~GFDGVEIH  194 (400)
T KOG0134         179 AAKAAYECGFDGVEIH  194 (400)
T ss_pred             HHHHHHHCCCCEEEEE
T ss_conf             9998986388758982


No 273
>KOG0103 consensus
Probab=28.81  E-value=44  Score=15.13  Aligned_cols=57  Identities=21%  Similarity=0.327  Sum_probs=32.2

Q ss_pred             HHHHHHHHHCCCCCCCEEEEEECCC----------HHHHHHHHH----HCC------CEEEEEECCCCCCCCCCCCCH
Q ss_conf             9999887400013674158883485----------689999985----072------128971016555333578221
Q gi|254780438|r   56 DLPEIRRLIDEQFPKAELNIEGYPN----------ETFLNLCER----YKP------EQITLVPDDPHQLTSDHGWDF  113 (261)
Q Consensus        56 Dv~~l~~~~~~~~~~~elNiEg~p~----------~e~i~ia~~----ikP------~qvtLVPe~r~elTTegGldv  113 (261)
                      -+..|++++..+ ...+||||+..+          +||-+++..    +.|      .|..|-+|.-..+--.||..-
T Consensus       269 ~~EKlKK~lSAN-~~~plNIEcfM~d~dvs~~i~ReEfEel~~plL~rv~~p~~~~l~d~~l~~edi~~VEiVGg~sr  345 (727)
T KOG0103         269 ECEKLKKVLSAN-TELPLNIECFMNDKDVSSKIKREEFEELSAPLLERVEVPLLKALADAKLKVEDIHAVEIVGGLSR  345 (727)
T ss_pred             HHHHHHHHHHCC-CCCCCCHHHEEECCHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCC
T ss_conf             999999986047-67884440034053044142489999988999986137899999981576146405998558653


No 274
>TIGR00657 asp_kinases aspartate kinase; InterPro: IPR001341   Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway. Additionally, several important metabolic intermediates are produced by these reactions, such as diaminopimelic acid, an essential component of bacterial cell wall biosynthesis, and dipicolinic acid, which is involved in sporulation in Gram-positive bacteria. Members of the animal kingdom do not posses this pathway and must therefore acquire these essential amino acids through their diet. Research into improving the metabolic flux through this pathway has the potential to increase the yield of the essential amino acids in important crops, thus improving their nutritional value. Additionally, since the enzymes are not present in animals, inhibitors of them are promising targets for the development of novel antibiotics and herbicides. For more information see .   Aspartate kinase (2.7.2.4 from EC) (AK) catalyzes the first reaction in the aspartate pathway; the phosphorylation of aspartate. The product of this reaction can then be used in the biosynthesis of lysine or in the pathway leading to homoserine, which participates in the biosynthesis of threonine, isoleucine and methionine .   In bacteria there are three different aspartate kinase isozymes which differ in sensitivity to repression and inhibition by Lys, Met and Thr. AK1 and AK2 are bifunctional enzymes which both consist of an N-terminal AK domain and a C-terminal homoserine dehydrogenase domain. AK1 is involved in threonine biosynthesis and AK2, in that of methionine. The third isozyme, AK3 is monofunctional and involved in lysine synthesis. In archaea and plants there may be a single isozyme of AK which in plants is multifunctional.   This entry represents a region encoding aspartate kinase activity found in both the monofunctional and bifunctional enzymes.   Synonym(s): Aspartokinase; GO: 0004072 aspartate kinase activity, 0008652 amino acid biosynthetic process.
Probab=28.68  E-value=31  Score=16.16  Aligned_cols=83  Identities=19%  Similarity=0.218  Sum_probs=52.2

Q ss_pred             HHHHHHHHCC---CEEEEEECCCCCCCCCCCCCHHH-----HHHHHHHHHHHHCCCC-C--EEEEEECCCCCC-------
Q ss_conf             9999985072---12897101655533357822133-----3788999998620269-6--389972544441-------
Q gi|254780438|r   83 FLNLCERYKP---EQITLVPDDPHQLTSDHGWDFLQ-----NQALLTKTVARLHNLG-S--RISLFADGNGNE-------  144 (261)
Q Consensus        83 ~i~ia~~ikP---~qvtLVPe~r~elTTegGldv~~-----~~~~L~~~i~~l~~~g-i--rvSLFIDpd~~q-------  144 (261)
                      ++..+++-+=   +++.|.=. +..+=|++.+.=..     -.....+-+..+-+.| +  -|.=|+-.+++-       
T Consensus       139 l~~~~l~~~G~K~~~~~l~~~-~~~I~T~~~~~~A~p~~~~~~~~~~~rL~~~L~~g~~ipvvaGF~G~~~~g~~TtLGR  217 (504)
T TIGR00657       139 LLSAALEELGVKAKAVSLTGA-QAGILTDSNFGRARPDLAVIIEILTERLEPLLEEGDIIPVVAGFQGATEKGEITTLGR  217 (504)
T ss_pred             HHHHHHHHCCCCCCCCCCCCC-CCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEEEECCCCCEEEEEEC
T ss_conf             999999745785201221147-4545544766764120246777669999999846987999840041057750798306


Q ss_pred             -----HHHHHHHHCCCCEEEECC---CCCH
Q ss_conf             -----479999740661465112---1110
Q gi|254780438|r  145 -----HSLQAAKLTGADCIELYT---GPYG  166 (261)
Q Consensus       145 -----~~i~~a~~~Gad~VElhT---G~Ya  166 (261)
                           -+.-.|.-++||+|||||   |=|-
T Consensus       218 GGSD~tA~llA~aL~Ad~~~IyTDV~Gi~T  247 (504)
T TIGR00657       218 GGSDYTAALLAAALKADECEIYTDVDGIYT  247 (504)
T ss_pred             CHHHHHHHHHHHHHCCCEEEEEECCCCCEE
T ss_conf             806899999998619968999872795032


No 275
>COG0648 Nfo Endonuclease IV [DNA replication, recombination, and repair]
Probab=28.30  E-value=49  Score=14.85  Aligned_cols=66  Identities=18%  Similarity=0.207  Sum_probs=33.7

Q ss_pred             HHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH-----CCCEEEECCC----CCHHHHHHHHHHCCCC
Q ss_conf             999974066146511211102444356433666889998766541-----5623520789----8987799999736996
Q gi|254780438|r  147 LQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQK-----MDLQINAGHD----LTIQNIPNLINAIPYI  217 (261)
Q Consensus       147 i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~-----lgL~VnAGHg----Ln~~Nl~~~i~~Ip~I  217 (261)
                      ++.+..+|+..|=+|-|.|...-   ++  .-+++++++-..+.+     ..++--||-|    =+++.|..++..+.+.
T Consensus        93 ~~r~~~lG~~~lv~HpG~~~~~~---~e--~~l~~i~~~Ln~~~~~~~v~i~~e~~agegs~~g~~F~~L~eii~~~~~~  167 (280)
T COG0648          93 IDRCEQLGAKLLVFHPGSYLGQG---KE--EGLNRIAEALNELLEEEGVIILLENTAGEGSGKGTQFGELAEIIDLIEEK  167 (280)
T ss_pred             HHHHHHCCCCEEEECCCCCCCCC---HH--HHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHCCC
T ss_conf             99999749968997775014788---89--99999999999985014872898774466676564224199999863365


No 276
>PRK08247 cystathionine gamma-synthase; Reviewed
Probab=28.00  E-value=49  Score=14.81  Aligned_cols=58  Identities=19%  Similarity=0.277  Sum_probs=23.9

Q ss_pred             HCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCE
Q ss_conf             202696389972544441479999740661465112111024443564336668899987665415623
Q gi|254780438|r  127 LHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQ  195 (261)
Q Consensus       127 l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~  195 (261)
                      +.+.||.++ |+||+- ...++.+..-..+.|  |...-+    ++.-   ++-.+...++.|++.|+-
T Consensus       111 l~~~Gi~~~-~~d~~d-~~~~~~~i~~~Tkli--~~Esp~----NP~l---~v~Di~~i~~iA~~~g~~  168 (366)
T PRK08247        111 WKKWGVRFV-YVNTAS-IKAIEQAITPNTKAI--FIETPT----NPLM---QETDIAAIAKIAKKHGLL  168 (366)
T ss_pred             HCCCCEEEE-EECCCC-HHHHHHHCCCCCEEE--EEECCC----CCCC---CCCCHHHHHHHHHHCCCE
T ss_conf             507746999-848889-799997538675499--985599----9853---501599999998646704


No 277
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed
Probab=27.83  E-value=50  Score=14.79  Aligned_cols=175  Identities=15%  Similarity=0.114  Sum_probs=108.9

Q ss_pred             CCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEE-EEEECCCHHHHHHHHHHCCCEEEEEECC
Q ss_conf             899899999999749989998247883348889999988740001367415-8883485689999985072128971016
Q gi|254780438|r   23 WPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAEL-NIEGYPNETFLNLCERYKPEQITLVPDD  101 (261)
Q Consensus        23 ~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~el-NiEg~p~~e~i~ia~~ikP~qvtLVPe~  101 (261)
                      ..||.+.|...+++||..|-|.--|+.=+=..+|+...++.+.     +|+ -=.--.++-.+.-+...--|.|-|.-. 
T Consensus        69 ~~dp~~~A~~Y~~~GA~aiSVLTe~~~F~Gs~~~L~~vr~~~~-----lPiLrKDFIid~~QI~ea~~~GADaiLLI~~-  142 (261)
T PRK00278         69 DFDPVEIAKAYEEGGAACLSVLTDERFFQGSFEYLRAARAAVS-----LPVLRKDFIIDPYQIYEARAAGADAILLIVA-  142 (261)
T ss_pred             CCCHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHCC-----CCEEEEHEECCHHHHHHHHHCCCCCHHHHHH-
T ss_conf             7999999999997799689995130324887999999998669-----9877201017699999999818985789887-


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHH
Q ss_conf             55533357822133378899999862026963899725444414799997406614651121110244435643366688
Q gi|254780438|r  102 PHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK  181 (261)
Q Consensus       102 r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~  181 (261)
                                 +. ..+.|+..+...++.|..+=+=+- +.  ..++.|.+.|++.|=+..-..-..--+.       +.
T Consensus       143 -----------~L-~~~~l~~l~~~a~~lgl~~LvEvh-~~--~El~~a~~~~a~iIGINnRnL~t~~vd~-------~~  200 (261)
T PRK00278        143 -----------AL-DDEQLKELLDLAHELGLDVLVEVH-DE--EELERALKLGAPLIGINNRNLKTFEVDL-------DT  200 (261)
T ss_pred             -----------HC-CHHHHHHHHHHHHHHCCEEEEEEC-CH--HHHHHHHHCCCCEEEEECCCCHHCEECH-------HH
T ss_conf             -----------55-899999999999982990797768-99--9999998479988987467711200378-------99


Q ss_pred             HHHHHHHHHHCCCEEEECCCCC-HHHHHHHHHHCCCCEEEEEHHHHHH
Q ss_conf             9998766541562352078989-8779999973699638842599999
Q gi|254780438|r  182 LAITAQLAQKMDLQINAGHDLT-IQNIPNLINAIPYISEISVGHAFAA  228 (261)
Q Consensus       182 i~~aa~~A~~lgL~VnAGHgLn-~~Nl~~~i~~Ip~I~EvsIGHaiIs  228 (261)
                      ..+.+..... +.-+=|--|+. .+-+.. +.+ -+.+-|=||-+|+.
T Consensus       201 ~~~L~~~ip~-~~~~VsESGI~~~~d~~~-l~~-~G~davLIGeslm~  245 (261)
T PRK00278        201 TERLAPLIPK-DRLLVSESGIFTPEDLKR-LAK-AGADAFLVGESLMR  245 (261)
T ss_pred             HHHHHHHCCC-CCEEEECCCCCCHHHHHH-HHH-CCCCEEEECHHHHC
T ss_conf             9999964899-988997999999999999-997-79999998978767


No 278
>KOG4222 consensus
Probab=27.65  E-value=11  Score=19.37  Aligned_cols=119  Identities=22%  Similarity=0.115  Sum_probs=72.8

Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHH----HHHHHHHCCCEEEEEECCCCCCC
Q ss_conf             99997499899982478833488899999887400013674158883485689----99998507212897101655533
Q gi|254780438|r   31 KIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETF----LNLCERYKPEQITLVPDDPHQLT  106 (261)
Q Consensus        31 ~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~----i~ia~~ikP~qvtLVPe~r~elT  106 (261)
                      -.|...||..++.-+|+|+| ++++|+....        .-++-+|+-|...+    +.-.++=+|...-.+|..   .+
T Consensus       116 g~avSr~a~L~vavlrddfr-v~prd~~~a~--------ge~avlEcgpP~ghpeptvSw~Kdg~pl~~~~~~~~---~l  183 (1281)
T KOG4222         116 GEAVSRGASLIVAVLRDDFR-VSPRDVQAAV--------GEEAVLECGPPRGHPEPTVSWVKDGKPLDHYDVPII---AL  183 (1281)
T ss_pred             CEEEECCCEEEEEEECHHCC-CCCCCCCCCC--------CCEEEEECCCCCCCCCCCCEEECCCCCCCCCCCEEE---EE
T ss_conf             23660585678988311105-5820100136--------612478536887787775203027872212454037---99


Q ss_pred             CCCCCCHHHHHHHHH----HHHHH----HC-CCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECC
Q ss_conf             357822133378899----99986----20-2696389972544441479999740661465112
Q gi|254780438|r  107 SDHGWDFLQNQALLT----KTVAR----LH-NLGSRISLFADGNGNEHSLQAAKLTGADCIELYT  162 (261)
Q Consensus       107 TegGldv~~~~~~L~----~~i~~----l~-~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhT  162 (261)
                      -.||--+..+-.+-.    ..|..    -+ ..--|+|.|..|...+.-...+...|++ +|++-
T Consensus       184 isgG~LlIsnvrksD~GtY~CVatNmvG~ReS~~A~lsv~e~P~f~~rp~~~~v~~g~~-~~f~c  247 (1281)
T KOG4222         184 ISGGNLLISNVRKSDEGTYACVATNMVGERESIPARLSVQEKPWFWKRPKDLAVLVGAA-AEFDC  247 (1281)
T ss_pred             ECCCCEEEECCCCCCCCEEEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCEEECCCC-CCCCC
T ss_conf             51773787324457985035541034354335511124305875001531004511533-45466


No 279
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed
Probab=27.56  E-value=50  Score=14.76  Aligned_cols=185  Identities=13%  Similarity=0.191  Sum_probs=111.0

Q ss_pred             CHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCC-CCCEEEEEECCCHHHHHHHHHHCCCEEEEEECCCC
Q ss_conf             98999999997499899982478833488899999887400013-67415888348568999998507212897101655
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQF-PKAELNIEGYPNETFLNLCERYKPEQITLVPDDPH  103 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~-~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~r~  103 (261)
                      .......-|++..+..|--.--...+|...+.+..+........ -.+-+++-=..+-+.+.-+++.-=+.|-+  |   
T Consensus        30 ~~~Avi~AAee~~sPvIlq~s~~~~~~~~~~~~~~~~~~~a~~~~VPV~lHLDH~~~~e~i~~ai~~GftSVM~--D---  104 (286)
T PRK12738         30 TIQAILEVCSEMRSPVILAGTPGTFKHIALEEIYALCSAYSTTYNMPLALHLDHHESLDDIRRKVHAGVRSAMI--D---  104 (286)
T ss_pred             HHHHHHHHHHHHCCCEEEECCHHHHHHCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHCCCCEEEE--E---
T ss_conf             99999999999789989993753776669999999999999987999999899999999999999779987987--3---


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCCCCEE--------------------EEEECCCCCCHHHHHHHHCCCCEEEECCC
Q ss_conf             5333578221333788999998620269638--------------------99725444414799997406614651121
Q gi|254780438|r  104 QLTSDHGWDFLQNQALLTKTVARLHNLGSRI--------------------SLFADGNGNEHSLQAAKLTGADCIELYTG  163 (261)
Q Consensus       104 elTTegGldv~~~~~~L~~~i~~l~~~girv--------------------SLFIDpd~~q~~i~~a~~~Gad~VElhTG  163 (261)
                          -..|.+..|-..-+++++..+..|+-|                    ++|-  +|++ ..+...++|+|+.=.=-|
T Consensus       105 ----gS~lp~eeNi~~Tk~vv~~Ah~~gv~VEaElG~igg~ed~~~~~~~~~~~T--~pee-a~~Fv~~TgvD~LAvaiG  177 (286)
T PRK12738        105 ----GSHFPFAENVKLVKSVVDFCHSQDCSVEAELGRLGGVEDDMSVDAESAFLT--DPQE-AKRFVELTGVDSLAVAIG  177 (286)
T ss_pred             ----CCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCC--CHHH-HHHHHHHHCCCEEHHHHC
T ss_conf             ----899999999999999999984739978886413466577766665223579--9999-999999879781223323


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHH
Q ss_conf             110244435643366688999876654156235207898987799999736996388425999
Q gi|254780438|r  164 PYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAF  226 (261)
Q Consensus       164 ~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHai  226 (261)
                      .-=-.|...  .+..++++++.. .+....|-.|-|-|+.-+.+...++  -+|.-||||--+
T Consensus       178 n~HG~y~~~--p~l~~~~L~~I~-~~~~iPLVLHGgSG~~~e~i~~ai~--~Gi~KvNi~T~l  235 (286)
T PRK12738        178 TAHGLYSKT--PKIDFQRLAEIR-EVVDVPLVLHGASDVPDEFVRRTIE--LGVTKVNVATEL  235 (286)
T ss_pred             CCCCCCCCC--CCCCHHHHHHHH-HCCCCCEEEECCCCCCHHHHHHHHH--CCEEEEEECHHH
T ss_conf             546777999--947899999997-3079998976999999999999997--690699848589


No 280
>PRK13112 consensus
Probab=27.55  E-value=50  Score=14.76  Aligned_cols=207  Identities=17%  Similarity=0.157  Sum_probs=129.7

Q ss_pred             CCCCHHHH---HHHHHHCCCCEEEEE-----CCCCCCCCCH------------HHHHHHHHHHCCCCCCCEEEEEECCCH
Q ss_conf             68998999---999997499899982-----4788334888------------999998874000136741588834856
Q gi|254780438|r   22 PWPNLVHI---GKIALQSGASGLTVH-----PRPDQRHIRY------------TDLPEIRRLIDEQFPKAELNIEGYPNE   81 (261)
Q Consensus        22 ~~P~~~~~---a~~~~~~GadgITvH-----~R~DrRHI~~------------~Dv~~l~~~~~~~~~~~elNiEg~p~~   81 (261)
                      .|||+-..   .....++|||-|-+-     |=-|---||.            +|+.++-+-+....+.+|+=+=+|-++
T Consensus        27 G~P~~~~s~~~l~~l~~~GaDiiElGiPFSDPvADGPvIQ~A~~rAL~~G~~~~~~~~~~~~ir~~~~~~PivlM~Y~N~  106 (279)
T PRK13112         27 GDPDLETSLKIMKALPKAGADIIELGMPFSDPMADGPAIQAAGLRALKAGQTLAKTLYLAREFRKDDDTTPIVLMGYYNP  106 (279)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCEEEEEECHH
T ss_conf             38997899999999987799989978998986665799999999999769968899999998513489988799851249


Q ss_pred             -------HHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCC
Q ss_conf             -------8999998507212897101655533357822133378899999862026963899725444414799997406
Q gi|254780438|r   82 -------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTG  154 (261)
Q Consensus        82 -------e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~G  154 (261)
                             .|.+-+.+.-=+- .|+||-|-|-              -.++...++++|+..-.|+-|..+++-++...+..
T Consensus       107 i~~~G~e~F~~~~~~aGvdG-vIipDLP~eE--------------~~~~~~~~~~~~i~~I~lvaPtt~~eRi~~i~~~s  171 (279)
T PRK13112        107 IYIYGVERFLTDAKAAGVDG-LIVVDLPPEM--------------DAELCIPAMKAGINFIRLATPTTDDKRLPKVLANT  171 (279)
T ss_pred             HHHHCHHHHHHHHHHCCCCE-EEECCCCHHH--------------HHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCC
T ss_conf             98847999999999739987-9846999788--------------89999999857834699825899899999998527


Q ss_pred             CCEEEE-----CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCC-CHHHHHHHHHHCCCCEEEEEHHHHHH
Q ss_conf             614651-----121110244435643366688999876654156235207898-98779999973699638842599999
Q gi|254780438|r  155 ADCIEL-----YTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDL-TIQNIPNLINAIPYISEISVGHAFAA  228 (261)
Q Consensus       155 ad~VEl-----hTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgL-n~~Nl~~~i~~Ip~I~EvsIGHaiIs  228 (261)
                      ...|=.     =||.-..   ........++++++      ...+-|-+|-|. +.+-+.. ++  ..-+=|-||-+||.
T Consensus       172 ~GFiY~Vs~~GvTG~~~~---~~~~~~~~i~~ik~------~t~~Pv~vGFGIs~~e~~~~-~~--~~aDGvIVGSAiVk  239 (279)
T PRK13112        172 SGFVYYVSMTGITGSALA---DTSAVGEAVARIKR------HTDLPVCVGFGVKTPEQARA-IA--AHADGVVVGTAIVN  239 (279)
T ss_pred             CCCEEEEECCCCCCCCCC---CHHHHHHHHHHHHH------HCCCCCEEEECCCCHHHHHH-HH--CCCCEEEECHHHHH
T ss_conf             880899835666676645---64889999999997------17898767835699999999-97--25999998779999


Q ss_pred             H---HH------HHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9---99------940999999999999741056554
Q gi|254780438|r  229 T---AL------ECGVKEAVFCFRRACGQHLDNTMR  255 (261)
Q Consensus       229 e---Al------~~GL~~aI~~~~~ii~~~~~~~~~  255 (261)
                      .   ++      .-.+.+.|.+|.+-+++..++++-
T Consensus       240 ~Ie~~~~~~~~~~~~~~~~v~~~~~~l~~g~k~ar~  275 (279)
T PRK13112        240 ALAGSLDEDGKATADTVAAVADLVAALAEGVRAARL  275 (279)
T ss_pred             HHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             998546741100457999999999999999999887


No 281
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; InterPro: IPR005990    Synonyms: Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase     IMP dehydrogenase (1.1.1.205 from EC,IMPDH) catalyzes the rate-limiting reaction of de novo GTP biosynthesis, the NAD-dependent reduction of IMP into XMP .  Inosine 5-phosphate + NAD+ + H2O = xanthosine 5-phosphate + NADH     IMP dehydrogenase is associated with cell proliferation and is a possible target for cancer chemotherapy. Mammalian and bacterial IMPDHs are tetramers of identical chains. There are two IMP dehydrogenase isozymes in humans . IMP dehydrogenase nearly always contains a long insertion that has two CBS domains within it and adopts a TIM barrel structure.; GO: 0003938 IMP dehydrogenase activity, 0006177 GMP biosynthetic process.
Probab=27.54  E-value=50  Score=14.76  Aligned_cols=86  Identities=15%  Similarity=0.253  Sum_probs=61.0

Q ss_pred             HHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHH-------HHHHHHHHHHHHHHHHHH
Q ss_conf             3788999998620269638997254444147999974066146511211102444-------356433666889998766
Q gi|254780438|r  116 NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYN-------NPQQERIFLNKLAITAQL  188 (261)
Q Consensus       116 ~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~-------~~~~~~~el~~i~~aa~~  188 (261)
                      |..+--+.|+..|+.-..+-+-.=--.++.+-++..+.|||.|=.=-||=+-+-.       -|+     +.-+..+|++
T Consensus       263 hs~~vl~~ik~~k~~Yp~~~iiaGNVaT~~~a~~LI~AgADg~rVGiGpGSICTTr~V~gVGvPQ-----~TAv~~Va~~  337 (476)
T TIGR01302       263 HSIYVLDSIKKIKKTYPDLDIIAGNVATAEQAKALIDAGADGLRVGIGPGSICTTRIVAGVGVPQ-----ITAVYDVAEY  337 (476)
T ss_pred             CCHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHCCCCEEEECCCCCCCCEEEEEEECCCHH-----HHHHHHHHHH
T ss_conf             53789999999986388057994344117889889852888789836889811001565127626-----8899999999


Q ss_pred             HHHCCCEEEECCCCCHHH
Q ss_conf             541562352078989877
Q gi|254780438|r  189 AQKMDLQINAGHDLTIQN  206 (261)
Q Consensus       189 A~~lgL~VnAGHgLn~~N  206 (261)
                      |++.|+.|=|==|+-|.=
T Consensus       338 A~~~Gi~VIADGGIr~SG  355 (476)
T TIGR01302       338 AAQSGIPVIADGGIRYSG  355 (476)
T ss_pred             HHHCCCEEEECCCCCCHH
T ss_conf             972799099837756255


No 282
>COG5093 Uncharacterized conserved protein [Function unknown]
Probab=27.49  E-value=24  Score=16.93  Aligned_cols=41  Identities=15%  Similarity=0.166  Sum_probs=30.6

Q ss_pred             HHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEE
Q ss_conf             6688999876654156235207898987799999736996388
Q gi|254780438|r  178 FLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEI  220 (261)
Q Consensus       178 el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~Ev  220 (261)
                      .+.+++++-..-.-.||++--|--||++|+.. . .|.+|.++
T Consensus       127 iv~dirEiRq~K~lkGlk~lne~~L~ldNl~l-~-EiNEirp~  167 (185)
T COG5093         127 IVEDIREIRQAKTLKGLKCLNEKALNLDNLTL-F-EINEIRPL  167 (185)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCH-H-HHHHHHHH
T ss_conf             99999999999988627651353337565430-0-24545799


No 283
>PRK10658 alpha-xylosidase YicI; Provisional
Probab=27.39  E-value=47  Score=14.99  Aligned_cols=38  Identities=21%  Similarity=0.270  Sum_probs=25.7

Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHH
Q ss_conf             578221333788999998620269638997254444147
Q gi|254780438|r  108 DHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHS  146 (261)
Q Consensus       108 egGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~  146 (261)
                      +.-||-. .+...+..++.|++.|+++++-|+|-..|.+
T Consensus       317 dFtWD~~-~FPDP~~mv~~Lh~~G~kv~vwI~P~I~~~s  354 (772)
T PRK10658        317 DFEWDPR-TFPDPEGMLKRLKAKGLKICVWINPYIGQKS  354 (772)
T ss_pred             CEEECHH-HCCCHHHHHHHHHHCCCEEEEEECCCCCCCC
T ss_conf             2167731-0899899999999789879999678768886


No 284
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084   Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast). The allophanate hydrolase domain of the yeast enzyme is not included in this entry and is represented by an adjacent gene in Oleomonas sagaranensis. The fusion of urea carboxylase and allophanate hydrolase is designated urea amidolyase. The enzyme from O. sagaranensis was shown to be highly active on acetamide and formamide as well as urea..
Probab=27.24  E-value=51  Score=14.72  Aligned_cols=128  Identities=19%  Similarity=0.291  Sum_probs=79.4

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCC--CCCCHHHHHHHHHHHCCCCCCCEEEEEECCC-------HHHHHHHHHHCCCEEEE
Q ss_conf             99999999749989998247883--3488899999887400013674158883485-------68999998507212897
Q gi|254780438|r   27 VHIGKIALQSGASGLTVHPRPDQ--RHIRYTDLPEIRRLIDEQFPKAELNIEGYPN-------ETFLNLCERYKPEQITL   97 (261)
Q Consensus        27 ~~~a~~~~~~GadgITvH~R~Dr--RHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~-------~e~i~ia~~ikP~qvtL   97 (261)
                      ++..+.+.+.|..++-|+=-+|+  +|+++.|..              .-|.+.+-       +..+++|++.--.-+- 
T Consensus        14 ~RiirTL~~lgi~sVAvYS~aD~~s~HV~~AD~A--------------~~Lg~~~A~esYL~~dkil~~Ak~tGA~AI~-   78 (1226)
T TIGR02712        14 VRIIRTLRKLGIRSVAVYSDADRASQHVLDADEA--------------VCLGGATAAESYLDIDKILAIAKKTGAQAIH-   78 (1226)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCHHHCCCE--------------ECCCCCCHHHHHCCHHHHHHHHHHCCCCEEE-
T ss_conf             9999998771863798632100215782360502--------------6058954132221478999999755893874-


Q ss_pred             EECCCCCCCCCCCCCH-HHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHH---
Q ss_conf             1016555333578221-333788999998620269638997254444147999974066146511211102444356---
Q gi|254780438|r   98 VPDDPHQLTSDHGWDF-LQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ---  173 (261)
Q Consensus        98 VPe~r~elTTegGldv-~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~---  173 (261)
                       |          |.=+ +.|    ..+-+.+-++||.   ||=|-|+|  |   .+.|..    ||   |.+.....   
T Consensus        79 -P----------GYGFLSEN----A~FA~~C~~aGI~---FvGPtpe~--i---r~fGLK----Ht---AR~lA~~aGVP  128 (1226)
T TIGR02712        79 -P----------GYGFLSEN----AAFAEACEAAGIV---FVGPTPEQ--I---RKFGLK----HT---ARELAEAAGVP  128 (1226)
T ss_pred             -C----------CCCCCCCC----HHHHHHHHHCCCE---EECCCHHH--H---HHCCCC----HH---HHHHHHHCCCC
T ss_conf             -5----------88723578----7799899847957---87787066--7---443832----56---89999966889


Q ss_pred             --HHHHHHHHHHHHHHHHHHCC----CEEEEC
Q ss_conf             --43366688999876654156----235207
Q gi|254780438|r  174 --QERIFLNKLAITAQLAQKMD----LQINAG  199 (261)
Q Consensus       174 --~~~~el~~i~~aa~~A~~lg----L~VnAG  199 (261)
                        .-.--|+.+.+|...|+++|    |+--||
T Consensus       129 L~PGTgLL~sl~eA~~~A~~IGYPVMlKSTAG  160 (1226)
T TIGR02712       129 LLPGTGLLESLDEALEAAKEIGYPVMLKSTAG  160 (1226)
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             88851558779999999864699547987078


No 285
>TIGR02104 pulA_typeI pullulanase, type I; InterPro: IPR011840    Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the entries in IPR011838 from INTERPRO and IPR011839 from INTERPRO but having a different domain architecture with shorter sequences. Members are called type I pullulanases ..
Probab=26.98  E-value=50  Score=14.77  Aligned_cols=12  Identities=8%  Similarity=0.185  Sum_probs=4.4

Q ss_pred             HHHHHHHCCCEE
Q ss_conf             876654156235
Q gi|254780438|r  185 TAQLAQKMDLQI  196 (261)
Q Consensus       185 aa~~A~~lgL~V  196 (261)
                      +.+..|+.||+|
T Consensus       254 mi~~lH~~GirV  265 (655)
T TIGR02104       254 MIQALHENGIRV  265 (655)
T ss_pred             HHHHHHHCCCEE
T ss_conf             999998668879


No 286
>cd01965 Nitrogenase_MoFe_beta_like Nitrogenase_MoFe_beta_like: Nitrogenase MoFe protein, beta subunit_like. The nitrogenase enzyme catalyzes the ATP-dependent reduction of dinitrogen (N2) to ammonia.  This group contains the beta subunits of component 1 of the three known genetically distinct types of nitrogenase systems: a molybdenum-dependent  nitrogenase (Mo-nitrogenase), a vanadium-dependent nitrogenase (V-nitrogenase), and an iron-only nitrogenase (Fe-nitrogenase). These nitrogenase systems consist of component 1 (MoFe protein, VFe protein or, FeFe protein respectively) and, component 2 (Fe protein). The most widespread and best characterized of these systems is the Mo-nitrogenase. MoFe is an alpha2beta2 tetramer, the alternative nitrogenases are alpha2beta2delta2 hexamers having  alpha and beta subunits similar to the alpha and beta subunits of MoFe. For MoFe, each alphabeta pair contains one P-cluster (at the alphabeta interface) and, one molecule of iron molybdenum cofactor (Fe
Probab=26.74  E-value=52  Score=14.66  Aligned_cols=213  Identities=15%  Similarity=0.087  Sum_probs=106.6

Q ss_pred             CCHHHHHHHHHHCCCCEEEE---------ECCCCCCCCC--HHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHC-
Q ss_conf             99899999999749989998---------2478833488--89999988740001367415888348568999998507-
Q gi|254780438|r   24 PNLVHIGKIALQSGASGLTV---------HPRPDQRHIR--YTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYK-   91 (261)
Q Consensus        24 P~~~~~a~~~~~~GadgITv---------H~R~DrRHI~--~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ik-   91 (261)
                      .|+-+.-.+....|..-+++         |+..+..-+.  ...+.+|+.+-     +-.+||-..+.. +...+...+ 
T Consensus       169 ~D~~eik~ll~~~Gl~v~~l~d~s~~ld~~~~~~~~~~~~ggt~~~~i~~~~-----~A~~ni~~~~~~-~~~~a~~L~~  242 (428)
T cd01965         169 GDVREIKRILEAFGLEPIILPDLSDSLDGHLTDGYSPLTKGGTTLEEIRDAG-----NAKATIALGEYS-GRKAAKALEE  242 (428)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCHHCCCCCCCCCCCCCCCCCCCHHHHHHHC-----CCCEEEEECHHH-HHHHHHHHHH
T ss_conf             4599999999984991698157121147766676520168998699998656-----599999988889-9999999999


Q ss_pred             ----CCEEEEEECCCC-------CCCCCCCCCH----HHHHHHHHHHHHHH--CCCCCEEEEEECCCCCCHHHHHHHHCC
Q ss_conf             ----212897101655-------5333578221----33378899999862--026963899725444414799997406
Q gi|254780438|r   92 ----PEQITLVPDDPH-------QLTSDHGWDF----LQNQALLTKTVARL--HNLGSRISLFADGNGNEHSLQAAKLTG  154 (261)
Q Consensus        92 ----P~qvtLVPe~r~-------elTTegGldv----~~~~~~L~~~i~~l--~~~girvSLFIDpd~~q~~i~~a~~~G  154 (261)
                          |....--|=--+       ++--=-|.++    .....++.+.....  .-.|-|+.+|-||+..-...+...++|
T Consensus       243 ~~giP~~~~~~P~G~~~T~~~l~~la~~~g~~~~~~~~~er~r~~d~~~d~~~~l~gkrvai~~~~~~~~~l~~~L~elG  322 (428)
T cd01965         243 KFGVPYILFPTPIGLKATDEFLRALSKLSGKPIPEELERERGRLLDAMLDSHFYLGGKRVAIAGDPDLLLGLSRFLLEMG  322 (428)
T ss_pred             HHCCCEEECCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHCC
T ss_conf             85998484377646799999999999984899559999999999999999998607978999888188999999999859


Q ss_pred             CCEEEECCCCCHHHHHHHHHHHHH----------HHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHH
Q ss_conf             614651121110244435643366----------6889998766541562352078989877999997369963884259
Q gi|254780438|r  155 ADCIELYTGPYGACYNNPQQERIF----------LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGH  224 (261)
Q Consensus       155 ad~VElhTG~Ya~a~~~~~~~~~e----------l~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGH  224 (261)
                      ...+-.-||.....+....+....          -..+.+..+.+.+.+-.+=-|+.-...--.. + .||.+.   +|.
T Consensus       323 ~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~v~~~~D~~~le~~i~~~~~dliig~s~~~~~A~~-l-~iP~~~---~g~  397 (428)
T cd01965         323 AEPVAAVTGTDNPPFEKRMELLASLEGIPAEVVFVGDLWDLESLAKEEPVDLLIGNSHGRYLARD-L-GIPLVR---VGF  397 (428)
T ss_pred             CEEEEEEEECCCCHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHCCCCEEEECHHHHHHHHH-C-CCCEEE---ECC
T ss_conf             95679998179924778899876650799639976999999999974799999978578999998-5-998799---417


Q ss_pred             H-----HHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9-----9999999409999999999997
Q gi|254780438|r  225 A-----FAATALECGVKEAVFCFRRACG  247 (261)
Q Consensus       225 a-----iIseAl~~GL~~aI~~~~~ii~  247 (261)
                      -     -..+..+.|++-++.-..++.+
T Consensus       398 Pv~dr~~~~~~~~~GY~G~l~l~~~i~N  425 (428)
T cd01965         398 PIFDRLGLHRRPYVGYRGALNLLEEIAN  425 (428)
T ss_pred             CCEEEECCCCCCEEEHHHHHHHHHHHHH
T ss_conf             7044106667751318889999999999


No 287
>PRK08202 purine nucleoside phosphorylase; Provisional
Probab=26.39  E-value=51  Score=14.72  Aligned_cols=96  Identities=22%  Similarity=0.162  Sum_probs=48.8

Q ss_pred             ECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHH-HHHHHHHHHH------------HHHHHHCCCEEEECCCCCH
Q ss_conf             25444414799997406614651121110244435643-3666889998------------7665415623520789898
Q gi|254780438|r  138 ADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE-RIFLNKLAIT------------AQLAQKMDLQINAGHDLTI  204 (261)
Q Consensus       138 IDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~-~~el~~i~~a------------a~~A~~lgL~VnAGHgLn~  204 (261)
                      -||+..+...+.|+++|.   .+|.|.|+-. ..+.-+ ..|..-++..            +..|+++||.|-+=     
T Consensus       160 yd~~Lr~~~~~~a~~~~~---~~~~GvY~~~-~GP~fET~AE~~~~r~~GaD~VGMStvPEvilAre~g~~v~~i-----  230 (272)
T PRK08202        160 YDPELRALAREVAKELGI---PLQEGVYAGV-SGPSYETPAEIRMLRTLGADAVGMSTVPEVIVARHCGLKVLGI-----  230 (272)
T ss_pred             HHHHHHHHHHHHHHHCCC---CEEEEEEEEC-CCCCCCCHHHHHHHHHCCCCEECCCCCHHHHHHHHCCCCEEEE-----
T ss_conf             669999999999998399---4322289965-6888588999998875599887668768999999879977999-----


Q ss_pred             HHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             779999973699638842599999999940999999999999741
Q gi|254780438|r  205 QNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQH  249 (261)
Q Consensus       205 ~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~~~  249 (261)
                      .-++.+ +  -.+.+-..-|.=|-+    -++++..++++++.+-
T Consensus       231 s~vTN~-a--~g~~~~~~sheeVl~----~~~~~~~~~~~Ll~~~  268 (272)
T PRK08202        231 SCITNL-A--AGISDEPLSHEEVLE----VAELAAEKFGRLVKAI  268 (272)
T ss_pred             EEEEEC-C--CCCCCCCCCHHHHHH----HHHHHHHHHHHHHHHH
T ss_conf             988443-6--578899899999999----9999899999999999


No 288
>PRK09124 pyruvate dehydrogenase; Provisional
Probab=26.29  E-value=29  Score=16.42  Aligned_cols=90  Identities=18%  Similarity=0.168  Sum_probs=43.7

Q ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCC---CHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHH-HHHHHHHHHHHHHHHC
Q ss_conf             788999998620269638997254444---147999974066146511211102444356433-6668899987665415
Q gi|254780438|r  117 QALLTKTVARLHNLGSRISLFADGNGN---EHSLQAAKLTGADCIELYTGPYGACYNNPQQER-IFLNKLAITAQLAQKM  192 (261)
Q Consensus       117 ~~~L~~~i~~l~~~girvSLFIDpd~~---q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~-~el~~i~~aa~~A~~l  192 (261)
                      ...+...++.|+++. |.-+++-....   ..-.++|..+|+..+.-+.|+-.-.++.+-..- .-+.-...+.+...+.
T Consensus       188 ~~~l~~aa~~L~~A~-rPvi~~G~G~~~a~~~l~~lAe~lg~PV~tt~~gkg~i~~~hPl~~G~~G~~g~~~~~~~l~~a  266 (574)
T PRK09124        188 EEELDKLAALLNGSK-AITLLCGSGCAGAHDELVALADTLKAPIVHALRGKEHVEYDNPYDVGMTGLIGFSSGYHAMMNC  266 (574)
T ss_pred             HHHHHHHHHHHHCCC-CCEEEECCCHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCC
T ss_conf             999999999985579-9789979103237999999999859988960567778887685114656667878999998438


Q ss_pred             CCEEEECCCCCHHHH
Q ss_conf             623520789898779
Q gi|254780438|r  193 DLQINAGHDLTIQNI  207 (261)
Q Consensus       193 gL~VnAGHgLn~~Nl  207 (261)
                      .+-+-.|.+++|.+.
T Consensus       267 Dlvl~lGt~~~~~~~  281 (574)
T PRK09124        267 DTLLMLGTDFPYRQF  281 (574)
T ss_pred             CEEEEECCCCCCCCC
T ss_conf             819997367775431


No 289
>cd06594 GH31_glucosidase_YihQ YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
Probab=26.22  E-value=53  Score=14.60  Aligned_cols=65  Identities=12%  Similarity=0.071  Sum_probs=40.0

Q ss_pred             CCCHHHHHHHHHHC----CCEEEEEECCCCCCCCCCCCCH-------HHHHHHHHHHHHHHCCCCCEEEEEECCCC
Q ss_conf             48568999998507----2128971016555333578221-------33378899999862026963899725444
Q gi|254780438|r   78 YPNETFLNLCERYK----PEQITLVPDDPHQLTSDHGWDF-------LQNQALLTKTVARLHNLGSRISLFADGNG  142 (261)
Q Consensus        78 ~p~~e~i~ia~~ik----P~qvtLVPe~r~elTTegGldv-------~~~~~~L~~~i~~l~~~girvSLFIDpd~  142 (261)
                      +.+++..+++.+.+    |--+--+=+-.+..++..|...       ...+-..+..++.|++.|+++.+-|+|-.
T Consensus        20 ~~~~ev~~~~~~~r~~~iP~d~i~lddw~~~~~~~~~~~~~~~~~~d~~~FPdp~~mv~~L~~~G~k~v~~i~P~i   95 (317)
T cd06594          20 GGTDKVLEALEKARAAGVKVAGLWLQDWTGRRETSFGDRLWWNWEWDPERYPGLDELIEELKARGIRVLTYINPYL   95 (317)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCCEECHHHCCCHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             8799999999999973998049997223676555566454145407853496989999999988998999668874


No 290
>COG1242 Predicted Fe-S oxidoreductase [General function prediction only]
Probab=26.00  E-value=51  Score=14.73  Aligned_cols=115  Identities=21%  Similarity=0.258  Sum_probs=70.1

Q ss_pred             HHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCC
Q ss_conf             99974998999824788334888999998874000136741588834856899999850721289710165553335782
Q gi|254780438|r   32 IALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGW  111 (261)
Q Consensus        32 ~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~r~elTTegGl  111 (261)
                      .....|+-||-+--|||-   -++||.+|-.-.+   .+.++=+|.-.-.---+-+..+                 ..|-
T Consensus       109 aL~~~~VVGLsIgTRPDC---lpd~VldlL~e~~---~r~~vWvELGLQT~h~~Tlk~i-----------------NRgH  165 (312)
T COG1242         109 ALSEAGVVGLSIGTRPDC---LPDDVLDLLAEYN---KRYEVWVELGLQTAHDKTLKRI-----------------NRGH  165 (312)
T ss_pred             HHCCCCEEEEEECCCCCC---CCHHHHHHHHHHH---HHEEEEEEECCCHHHHHHHHHH-----------------HCCC
T ss_conf             727588047750589988---8189999999986---4457887745305558999987-----------------6245


Q ss_pred             CHHHHHHHHHHHHHHHCCCCCEEEEEE-CCCCC------CHHHHHHHHCCCCEEEECCC------CCHHHHHHHH
Q ss_conf             213337889999986202696389972-54444------14799997406614651121------1102444356
Q gi|254780438|r  112 DFLQNQALLTKTVARLHNLGSRISLFA-DGNGN------EHSLQAAKLTGADCIELYTG------PYGACYNNPQ  173 (261)
Q Consensus       112 dv~~~~~~L~~~i~~l~~~girvSLFI-Dpd~~------q~~i~~a~~~Gad~VElhTG------~Ya~a~~~~~  173 (261)
                      |    ..-..+.+.++++.||+|.--+ ---|-      ..+++...++|+|.|-||-=      +.++.|.+..
T Consensus       166 d----~~~y~dav~r~rkrgIkvc~HiI~GLPgE~~~~mleTak~v~~~~v~GIKlH~LhvvkgT~m~k~Y~~G~  236 (312)
T COG1242         166 D----FACYVDAVKRLRKRGIKVCTHLINGLPGETRDEMLETAKIVAELGVDGIKLHPLHVVKGTPMEKMYEKGR  236 (312)
T ss_pred             C----HHHHHHHHHHHHHCCCEEEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEEEEEECCCHHHHHHHCCC
T ss_conf             4----4999999999997497498888407988888999999999986687538888788863875999997188


No 291
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated
Probab=25.94  E-value=54  Score=14.57  Aligned_cols=70  Identities=16%  Similarity=0.084  Sum_probs=25.7

Q ss_pred             HHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCC
Q ss_conf             99850721289710165553335782213337889999986202696389972544441479999740661465112111
Q gi|254780438|r   86 LCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY  165 (261)
Q Consensus        86 ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Y  165 (261)
                      +...++|+...+.=|.+.--|    +.+. +   +..+.+..++.|+.+-  ||--..-.-+....+.|||.|=-=+-+|
T Consensus       140 ~~~~~~~~Tkli~~EtpsNP~----l~v~-D---i~~ia~iA~~~gi~~v--VDNTfatP~~~rPl~~GaDiVvhS~TKy  209 (432)
T PRK06702        140 IVALANDKTKLVYAESLGNPA----MNVL-N---FKEFSDAAKELEVPFI--VDNTLATPYLCQAFEHGANIIVHSTTKY  209 (432)
T ss_pred             HHHHCCCCCEEEEEEECCCCC----CEEE-C---HHHHHHHHHHCCCEEE--EECCCCCCCCCCCHHCCCCEEEEECCCC
T ss_conf             997457875089997279997----3202-7---9999999976698189--6357643010462012898999853421


No 292
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed
Probab=25.92  E-value=54  Score=14.56  Aligned_cols=73  Identities=19%  Similarity=0.299  Sum_probs=36.6

Q ss_pred             EECCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEC------CCCCCHHHHH
Q ss_conf             8348568999998507212897101655533357822133378899999862026963899725------4444147999
Q gi|254780438|r   76 EGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFAD------GNGNEHSLQA  149 (261)
Q Consensus        76 Eg~p~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFID------pd~~q~~i~~  149 (261)
                      -..-.++.++++.++.|+.|-+=          =||++-....  .+++..|++.|..  +|.|      |+.-+..++.
T Consensus        10 D~~~~~~~~~l~~~l~~~i~~~K----------ig~~l~~~~G--~~~i~~l~~~g~~--iFlDlKl~DIpnTv~~~~~~   75 (231)
T PRK00230         10 DFPSKEEALAFLDQLDPAVLFVK----------VGMELFTAGG--PQFVRELKQRGFK--VFLDLKLHDIPNTVAKAVRA   75 (231)
T ss_pred             CCCCHHHHHHHHHHHCCCCCEEE----------ECHHHHHHCC--HHHHHHHHHCCCC--EEEEEECCCCCHHHHHHHHH
T ss_conf             48999999999997177552999----------8989986418--9999999977996--89872022654589999999


Q ss_pred             HHHCCCCEEEECC
Q ss_conf             9740661465112
Q gi|254780438|r  150 AKLTGADCIELYT  162 (261)
Q Consensus       150 a~~~Gad~VElhT  162 (261)
                      ..+.|+|.+-+|.
T Consensus        76 i~~~g~d~vtvH~   88 (231)
T PRK00230         76 AAKLGVDMVTVHA   88 (231)
T ss_pred             HHHCCCCEEEEEC
T ss_conf             9857998999825


No 293
>PRK09303 adaptive-response sensory kinase; Validated
Probab=25.83  E-value=54  Score=14.55  Aligned_cols=94  Identities=17%  Similarity=0.163  Sum_probs=53.6

Q ss_pred             EEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHH----HCCCEEEEEECCCCCCCCCCCCCHHH
Q ss_conf             99982478833488899999887400013674158883485689999985----07212897101655533357822133
Q gi|254780438|r   40 GLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCER----YKPEQITLVPDDPHQLTSDHGWDFLQ  115 (261)
Q Consensus        40 gITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~----ikP~qvtLVPe~r~elTTegGldv~~  115 (261)
                      .+.+-|=-|+||--.+|+..|+..+.+...+-++-++...-.+--.++..    .-|.-+-+.|+.|+-++   |=|+. 
T Consensus        14 ~l~lll~~~~r~~~~~~~~~~~~~l~~~~~~~~~~l~~~~~~~qp~l~e~~~lva~p~l~k~~p~p~q~la---g~~~~-   89 (378)
T PRK09303         14 PLQLLLFADRRPLSREDIRRIIAYLESLDCGFPISLQIIDPSEQPELLELHRLVATPALIKISPEPRQVLA---GSNIF-   89 (378)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHCCCHHHHCCCCCHHHCC---CCCHH-
T ss_conf             51799997588776999999999998357899747997472207799998887436135640898343206---88688-


Q ss_pred             HHHHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             378899999862026963899725
Q gi|254780438|r  116 NQALLTKTVARLHNLGSRISLFAD  139 (261)
Q Consensus       116 ~~~~L~~~i~~l~~~girvSLFID  139 (261)
                        ..|+....+-+.......+...
T Consensus        90 --~~l~~w~prw~~~~~~~~~~~~  111 (378)
T PRK09303         90 --QQLKNWWPRWQQEGATSGLGLS  111 (378)
T ss_pred             --HHHHHHHHHHHHHHHHHCCCCC
T ss_conf             --9988762788888876324788


No 294
>TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family; InterPro: IPR012741    This entry describes a subfamily of the B12 binding domain proteins that include corrinoid proteins specific to four different, mutually non-homologous enzymes of the genus Methanosarcina. Three of the four cognate enzymes (trimethylamine, dimethylamine, and monomethylamine methyltransferases) all have the unusual, ribosomally incorporated amino acid pyrrolysine at the active site. All act in systems in which a methyl group is transferred to the corrinoid protein to create methylcobalamin, from which the methyl group is later transferred elsewhere.; GO: 0031419 cobalamin binding, 0050897 cobalt ion binding, 0015948 methanogenesis.
Probab=25.68  E-value=54  Score=14.53  Aligned_cols=67  Identities=21%  Similarity=0.269  Sum_probs=48.8

Q ss_pred             CCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCE--EEEEECCCCCCHHHHHHHHCCCC
Q ss_conf             8568999998507212897101655533357822133378899999862026963--89972544441479999740661
Q gi|254780438|r   79 PNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSR--ISLFADGNGNEHSLQAAKLTGAD  156 (261)
Q Consensus        79 p~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~gir--vSLFIDpd~~q~~i~~a~~~Gad  156 (261)
                      |.++|++-+.+.+|+.|-|+-=         -|- .....-.+++..+|++.|.|  |-.-+=--|-  +=+++-++|+|
T Consensus       125 p~~~vvE~v~~~~~~kv~l~~s---------ALM-TTtM~~qk~i~d~L~E~g~Rd~vk~m~GGApv--~q~w~d~igad  192 (201)
T TIGR02370       125 PIDTVVEKVKKEKPEKVMLTGS---------ALM-TTTMLGQKDIEDKLKEEGLRDRVKVMVGGAPV--TQDWADKIGAD  192 (201)
T ss_pred             CCCCCEEHHEEECCCEEEEEEC---------HHH-HHHHHHHHHHHHHHHHCCCCCCCCEEECCCCC--CHHHHHHHCCC
T ss_conf             5520110121007866788631---------247-88768899999987425886535622568764--55778764257


Q ss_pred             E
Q ss_conf             4
Q gi|254780438|r  157 C  157 (261)
Q Consensus       157 ~  157 (261)
                      +
T Consensus       193 ~  193 (201)
T TIGR02370       193 V  193 (201)
T ss_pred             C
T ss_conf             3


No 295
>PRK10624 L-1,2-propanediol oxidoreductase; Provisional
Probab=25.66  E-value=54  Score=14.53  Aligned_cols=15  Identities=20%  Similarity=0.076  Sum_probs=7.8

Q ss_pred             CCEEEECCCCCHHHH
Q ss_conf             614651121110244
Q gi|254780438|r  155 ADCIELYTGPYGACY  169 (261)
Q Consensus       155 ad~VElhTG~Ya~a~  169 (261)
                      +.++|=|+.+.++.+
T Consensus       197 ~H~iE~y~s~~~~p~  211 (381)
T PRK10624        197 THAIEGYITRGAWAL  211 (381)
T ss_pred             HHHHHHHHCCCCCHH
T ss_conf             999999864798777


No 296
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=25.40  E-value=55  Score=14.50  Aligned_cols=193  Identities=12%  Similarity=0.109  Sum_probs=116.3

Q ss_pred             CCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEE
Q ss_conf             78868998999999997499899982478833488899999887400013674158883485689999985072128971
Q gi|254780438|r   19 RNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLV   98 (261)
Q Consensus        19 Rg~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLV   98 (261)
                      |+.+.-+.+..+..+.+.|..-|-+-+|-+.-.   +-+..+.+....++|++-+-.=--.+.+-.+.+.+.--++    
T Consensus        23 r~~~~e~a~~~a~aL~~gGi~~iEiTlrt~~a~---~~i~~l~~~~~~~~p~~~iGaGTVl~~~~~~~a~~aGA~F----   95 (223)
T PRK07114         23 YHSDIEVAKKVVKACYDGGVRAFEFTNRGDFAH---EVFGELVKYAAKECPEMILGVGSIVDAATAALYIQLGANF----   95 (223)
T ss_pred             EECCHHHHHHHHHHHHHCCCCEEEEECCCCCHH---HHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHCCCCE----
T ss_conf             828999999999999988998899958896589---9999999999866898089655188999999999859989----


Q ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             01655533357822133378899999862026963899725444414799997406614651121110244435643366
Q gi|254780438|r   99 PDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF  178 (261)
Q Consensus        99 Pe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~e  178 (261)
                                     .-.-..-.++++..++.++..-==+- .|++  +..|.+.|++.|-|+-+   ... ..+    .
T Consensus        96 ---------------iVSP~~~~~v~~~~~~~~~~~iPGv~-TptE--i~~A~~~G~~~vK~FPa---~~~-G~~----~  149 (223)
T PRK07114         96 ---------------VVGPLFNEDIAKVCNRRKIPYSPGCG-SVSE--IGFAEELGCEIVKIFPG---DVY-GPE----F  149 (223)
T ss_pred             ---------------EECCCCCHHHHHHHHHCCCCCCCCCC-CHHH--HHHHHHCCCCEEEECCC---CCC-CHH----H
T ss_conf             ---------------99999999999999983997537319-9999--99999879997988973---235-999----9


Q ss_pred             HHHHHHHHHHHHHCCCEEEECCCC--CHHHHHHHHHHCCCCEEEEEHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHH
Q ss_conf             688999876654156235207898--98779999973699638842599999999-----94099999999999974105
Q gi|254780438|r  179 LNKLAITAQLAQKMDLQINAGHDL--TIQNIPNLINAIPYISEISVGHAFAATAL-----ECGVKEAVFCFRRACGQHLD  251 (261)
Q Consensus       179 l~~i~~aa~~A~~lgL~VnAGHgL--n~~Nl~~~i~~Ip~I~EvsIGHaiIseAl-----~~GL~~aI~~~~~ii~~~~~  251 (261)
                      ++-++.     ---++.+-+=-|.  |.+|+..+++  ....-|-+|-+++...+     |..+.+..+++.+++++-|+
T Consensus       150 lkal~~-----p~p~~~~~PtGGV~ps~~N~~~~l~--ag~~~vG~GS~l~~~~~i~~~d~~~I~~~a~~~~~~vk~~r~  222 (223)
T PRK07114        150 VKAIKG-----PMPWTSIMPTGGVEPTEENLKSWFK--AGATCVGMGSKLFPKDKLAAKDWAGITKKVKEALDIIKEVRK  222 (223)
T ss_pred             HHHHHC-----CCCCCCEEECCCCCCCHHHHHHHHH--CCCEEEEECHHHCCHHHHHCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             999846-----4999968879998873550999996--899799988463899998658999999999999999999962


No 297
>pfam06787 UPF0254 Uncharacterized protein family (UPF0254).
Probab=25.23  E-value=55  Score=14.48  Aligned_cols=106  Identities=14%  Similarity=0.105  Sum_probs=53.3

Q ss_pred             CCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHH--HHCCCEEEECCCCCHHHHH
Q ss_conf             96389972544441479999740661465112111024443564336668899987665--4156235207898987799
Q gi|254780438|r  131 GSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLA--QKMDLQINAGHDLTIQNIP  208 (261)
Q Consensus       131 girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A--~~lgL~VnAGHgLn~~Nl~  208 (261)
                      .+-.|+||   |+...++....+...- --|+-.|+++|++.+..... ..+.++.+--  ...|++--||=|=-     
T Consensus        43 ~V~a~mFi---Pt~~gi~slL~i~~pe-Pd~~~k~~KaY~ee~D~~vA-~lmA~alk~~~~~dI~IgTTAGIGrG-----  112 (160)
T pfam06787        43 SVVASMFI---PTLSGIRSLLDFEPPE-PDYVIKYIKAYNEENDLKVA-KMMAEAVKEKTNCDIGIGTTAGIGRG-----  112 (160)
T ss_pred             EEEEEECC---CCHHHHHHHHCCCCCC-CCHHHCCCHHHCCCCCHHHH-HHHHHHHHHHHCCCEEEECCCCCCCC-----
T ss_conf             99985214---6288999985788999-72110200121631029999-99999998875888524324454785-----


Q ss_pred             HHHHHCCCCEEEEEHHHHHHH----------HHHHHHHHHHHHHHHHHH
Q ss_conf             999736996388425999999----------999409999999999997
Q gi|254780438|r  209 NLINAIPYISEISVGHAFAAT----------ALECGVKEAVFCFRRACG  247 (261)
Q Consensus       209 ~~i~~Ip~I~EvsIGHaiIse----------Al~~GL~~aI~~~~~ii~  247 (261)
                       -++-+..=.+.++---+-++          --..|++++++.+.++++
T Consensus       113 -aI~I~td~~~~~~tSdvyadL~~~~eni~~RQk~GI~k~l~~f~~iL~  160 (160)
T pfam06787       113 -AICIVTDKNEYLFTSDVYADLRKSDENILKRQKSGIEKALRLFEEILK  160 (160)
T ss_pred             -EEEEEECCCEEEEECCEEHHHCCCHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             -189983784699741010454027388999999789999999999859


No 298
>PRK08661 prolyl-tRNA synthetase; Provisional
Probab=24.91  E-value=56  Score=14.44  Aligned_cols=42  Identities=17%  Similarity=0.312  Sum_probs=28.3

Q ss_pred             HHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             8507212897101655533357822133378899999862026963899
Q gi|254780438|r   88 ERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISL  136 (261)
Q Consensus        88 ~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSL  136 (261)
                      -.+-|.||.+||=.+.+-. +   .+   .+...++-+.|++.|+||-+
T Consensus       284 p~iAP~qVvIvPi~~~~~~-~---~v---~~~~~~i~~~L~~~girv~~  325 (478)
T PRK08661        284 PKIAPIQVVIIPILKKKEE-E---EV---LEYAKELAEELKAAGIRVKL  325 (478)
T ss_pred             HHHCCCCEEEEEECCCCCH-H---HH---HHHHHHHHHHHHHCCEEEEE
T ss_conf             4559830899984578878-9---99---99999999999877907998


No 299
>cd07376 PLPDE_III_DSD_D-TA_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase. This family includes eukaryotic D-serine dehydratases (DSD), cryptic DSDs from bacteria, D-threonine aldolases (D-TA), low specificity D-TAs, and similar uncharacterized proteins. DSD catalyzes the dehydration of D-serine to aminoacrylate, which is rapidly hydrolyzed to pyruvate and ammonia. D-TA reversibly catalyzes the aldol cleavage of D-threonine into glycine and acetaldehyde, and the synthesis of D-threonine from glycine and acetaldehyde. Members of this family are fold type III PLP-dependent enzymes, similar to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on similarity to AR, it is poss
Probab=24.88  E-value=56  Score=14.44  Aligned_cols=195  Identities=16%  Similarity=0.143  Sum_probs=94.9

Q ss_pred             CCHHHHHHHHCCCCC-CC-----CHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCC-
Q ss_conf             214432232207886-89-----98999999997499899982478833488899999887400013674158883485-
Q gi|254780438|r    8 NLNAVAVLRNRRNLP-WP-----NLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPN-   80 (261)
Q Consensus         8 NidhiAtLRnaRg~~-~P-----~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~-   80 (261)
                      ||+..+-.=.++|-. .|     --.+.++.-+++|+.|||+-        +-.-.+.+.+   .-+.++-+=....-- 
T Consensus         5 Ni~~m~~~~~~~g~~lRPH~KThK~~~i~~~ql~~Ga~gi~~a--------tl~EAe~~~~---~G~~dIl~a~pi~~~~   73 (345)
T cd07376           5 NISRMAARARASGVRLRPHVKTHKSPELAQRQLAAGARGVTVA--------TLAEAETFAE---AGVKDILMAYPLVGPA   73 (345)
T ss_pred             HHHHHHHHHHHCCCCEEEEECHHCCHHHHHHHHHCCCCEEEEE--------CHHHHHHHHH---CCCCCEEEECCCCCHH
T ss_conf             9999999999769976677500048999999986799709994--------6999999997---6998389966889989


Q ss_pred             --HHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCC---------CCC-HHHH
Q ss_conf             --6899999850721289710165553335782213337889999986202696389972544---------441-4799
Q gi|254780438|r   81 --ETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGN---------GNE-HSLQ  148 (261)
Q Consensus        81 --~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd---------~~q-~~i~  148 (261)
                        +++.+++.+ .+...|+| |.+               +.+...-+..+..|.+.++|||-|         |++ ..+.
T Consensus        74 ~l~rl~~l~~~-~~~i~~~V-Ds~---------------~~~~~l~~~a~~~~~~~~V~ievD~G~~R~Gv~~~~~~~l~  136 (345)
T cd07376          74 AIARLAGLLRQ-EAEFHVLV-DSP---------------EALAALAAFAAAHGVRLRVMLEVDVGGHRSGVRPEEAAALA  136 (345)
T ss_pred             HHHHHHHHHHC-CCEEEEEE-CCH---------------HHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCHHHHHH
T ss_conf             99999998634-98389997-089---------------99999999998659827899997889985888887799999


Q ss_pred             HHHHC------CCCEEEECCCCCHHHHHHHHHH---HHHHHHHHHHHHHHHHCC---CEEEECCCCCHHHHHHHHHHCCC
Q ss_conf             99740------6614651121110244435643---366688999876654156---23520789898779999973699
Q gi|254780438|r  149 AAKLT------GADCIELYTGPYGACYNNPQQE---RIFLNKLAITAQLAQKMD---LQINAGHDLTIQNIPNLINAIPY  216 (261)
Q Consensus       149 ~a~~~------Gad~VElhTG~Ya~a~~~~~~~---~~el~~i~~aa~~A~~lg---L~VnAGHgLn~~Nl~~~i~~Ip~  216 (261)
                      .+..+      -..-+.-|-|.-...-+.....   ..+...++.+++.+. .|   ..|++|==-+|+-    ..+.+.
T Consensus       137 l~~~i~~~~~l~l~G~~~y~Gh~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~g~~~~~vs~GgTpt~~~----~~~~~~  211 (345)
T cd07376         137 LADAVQASPGLRLAGVMAYEGHIYGAGGAREGAQARDQAVAAVRAAAAAAE-RGLACPTVSGGGTPTYQL----TAGDRA  211 (345)
T ss_pred             HHHHHHCCCCEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH-CCCCCCEEECCCCCCCEE----ECCCCC
T ss_conf             999985399918989997471206999989999999999999999999986-499988895578887410----336887


Q ss_pred             CEEEEEHHHHHHHHHHHHH
Q ss_conf             6388425999999999409
Q gi|254780438|r  217 ISEISVGHAFAATALECGV  235 (261)
Q Consensus       217 I~EvsIGHaiIseAl~~GL  235 (261)
                      +.|+.=|-.+..|.-+..+
T Consensus       212 ~tEl~~G~yvf~D~~~~~~  230 (345)
T cd07376         212 VTELRAGSYVFMDTGFDTL  230 (345)
T ss_pred             CEEECCCEEEECCHHHCCC
T ss_conf             3287463489642132013


No 300
>KOG0207 consensus
Probab=24.85  E-value=56  Score=14.43  Aligned_cols=71  Identities=15%  Similarity=0.246  Sum_probs=39.8

Q ss_pred             HHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             89999986202696389972544441479999740661465112111024443564336668899987665415623520
Q gi|254780438|r  119 LLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINA  198 (261)
Q Consensus       119 ~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnA  198 (261)
                      .-..++..|++.||+|.+.---+ .--.-..|.++|      ++--||++.  |.+....+++|++-      -|--.-.
T Consensus       727 ~a~~av~~Lk~~Gi~v~mLTGDn-~~aA~svA~~VG------i~~V~aev~--P~~K~~~Ik~lq~~------~~~VaMV  791 (951)
T KOG0207         727 DAALAVAELKSMGIKVVMLTGDN-DAAARSVAQQVG------IDNVYAEVL--PEQKAEKIKEIQKN------GGPVAMV  791 (951)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCC-HHHHHHHHHHHC------CCEEEECCC--CHHHHHHHHHHHHC------CCCEEEE
T ss_conf             27999999996583389984787-899999998628------104774358--33368999999854------8837997


Q ss_pred             CCCCCH
Q ss_conf             789898
Q gi|254780438|r  199 GHDLTI  204 (261)
Q Consensus       199 GHgLn~  204 (261)
                      |-|+|=
T Consensus       792 GDGIND  797 (951)
T KOG0207         792 GDGIND  797 (951)
T ss_pred             ECCCCC
T ss_conf             078776


No 301
>pfam09176 Mpt_N Methylene-tetrahydromethanopterin dehydrogenase, N-terminal. Members of this family adopt a alpha-beta structure, with a core comprising three alpha/beta/alpha layers, in which each sheet contains four strands. They are predominantly found in prokaryotic methylene-tetrahydromethanopterin dehydrogenase, which catalyses the dehydrogenation of methylene-tetrahydromethanopterin and the reversible dehydrogenation of methylene-H(4)F.
Probab=24.55  E-value=57  Score=14.39  Aligned_cols=32  Identities=19%  Similarity=0.237  Sum_probs=17.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCC
Q ss_conf             782213337889999986202696389972544
Q gi|254780438|r  109 HGWDFLQNQALLTKTVARLHNLGSRISLFADGN  141 (261)
Q Consensus       109 gGldv~~~~~~L~~~i~~l~~~girvSLFIDpd  141 (261)
                      ||=|+..-.+.|..+-+.+-. --|||.|.||.
T Consensus        50 GG~d~~~a~~ml~~~kk~~~~-Pf~vSV~~DPs   81 (81)
T pfam09176        50 GGRDMALAEDMLEAAKKAFVP-PFEVSVMADPS   81 (81)
T ss_pred             CCCCHHHHHHHHHHHHHHCCC-CEEEEEECCCC
T ss_conf             886599999999999983579-83889850899


No 302
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain. This domain binds to B12 (adenosylcobamide), which initiates the conversion of succinyl CoA and methylmalonyl CoA by forming an adenosyl radical, which then undergoes a rearrangement exchanging a hydrogen atom with a group attached to a neighboring carbon atom. This family is present in both mammals and bacteria. Bacterial members are heterodimers and involved in the fermentation of pyruvate to propionate. Mammalian members are homodimers and responsible for the conversion of odd-chain fatty acids and branched-chain amino acids via propionyl CoA to succinyl CoA for further degradation.
Probab=24.49  E-value=57  Score=14.39  Aligned_cols=72  Identities=19%  Similarity=0.189  Sum_probs=50.3

Q ss_pred             CHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCE-EEEEECCCCCCHHHHHHHHCCCCEE
Q ss_conf             568999998507212897101655533357822133378899999862026963-8997254444147999974066146
Q gi|254780438|r   80 NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSR-ISLFADGNGNEHSLQAAKLTGADCI  158 (261)
Q Consensus        80 ~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~gir-vSLFIDpd~~q~~i~~a~~~Gad~V  158 (261)
                      -+++++.|.+-.++.+++=        |   | ...+...++.+++.|++.|.+ +-+|+--..-....+..+++|+++|
T Consensus        39 ~eeiv~~A~~e~ad~IglS--------s---L-~g~h~~~~~~l~~~L~e~G~~di~v~vGG~Ip~~d~~~l~~~Gv~~v  106 (122)
T cd02071          39 PEEIVEAAIQEDVDVIGLS--------S---L-SGGHMTLFPEVIELLRELGAGDILVVGGGIIPPEDYELLKEMGVAEI  106 (122)
T ss_pred             HHHHHHHHHHCCCCEEEEE--------C---C-CCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHCCCCEE
T ss_conf             9999999997399899996--------4---6-55447899999999997699984699945649899999997799889


Q ss_pred             EECCCC
Q ss_conf             511211
Q gi|254780438|r  159 ELYTGP  164 (261)
Q Consensus       159 ElhTG~  164 (261)
                       |.+|.
T Consensus       107 -f~pgt  111 (122)
T cd02071         107 -FGPGT  111 (122)
T ss_pred             -ECCCC
T ss_conf             -89588


No 303
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea . Na+/H+ exchange proteins eject protons from cells, effectively eliminating excess acid from actively metabolising cells. Na+ /H+ exchange activity is also crucial for the regulation of cell volume, and for the reabsorption of NaCl across renal, intestinal, and other epithelia. These antiports exchange Na+ for H+ in an electroneutral manner, and this activity is carried out by a family of Na+ /H+ exchangers, or NHEs, which are known to be present in both prokaryotic and eukaryotic cells.  These exchangers are highly-regulated (glyco)phosphoproteins, which, based on their primary structure, appear to contain 10-12 membrane-spanning regions (M) at the N-terminus and a large cytoplasmic region at the C-terminus. The transmembrane regions M3-M12 share identity wit h other members of the family. The M6 and M7 regions are highly conserved. Thus, this is thought to be the regio
Probab=24.49  E-value=57  Score=14.39  Aligned_cols=49  Identities=22%  Similarity=0.181  Sum_probs=34.9

Q ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEE--ECCCCCCHHHHHHHHCCCCEEEEC
Q ss_conf             1333788999998620269638997--254444147999974066146511
Q gi|254780438|r  113 FLQNQALLTKTVARLHNLGSRISLF--ADGNGNEHSLQAAKLTGADCIELY  161 (261)
Q Consensus       113 v~~~~~~L~~~i~~l~~~girvSLF--IDpd~~q~~i~~a~~~Gad~VElh  161 (261)
                      ..+..+.+.......+..++.+...  ++.+|.+.-++.|++.++|.|=+=
T Consensus        51 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~I~~~a~e~~~DlIVmG  101 (132)
T cd01988          51 VQRARKLLRQAERIAASLGVPVHTIIRIDHDIASGILRTAKERQADLIIMG  101 (132)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHCCCEEEEC
T ss_conf             999999999999999876995699999779979999999998499999983


No 304
>PRK10517 magnesium-transporting ATPase MgtA; Provisional
Probab=24.47  E-value=57  Score=14.38  Aligned_cols=50  Identities=12%  Similarity=0.161  Sum_probs=37.2

Q ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHH
Q ss_conf             788999998620269638997254444147999974066146511211102
Q gi|254780438|r  117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGA  167 (261)
Q Consensus       117 ~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~  167 (261)
                      +..-++.|+.|+++||+|-+.-- |-..-...-|+++|.+.=+.-||+--+
T Consensus       550 R~e~~~aI~~l~~aGI~V~MITG-D~~~TA~aIA~~lGI~~~~v~tG~el~  599 (900)
T PRK10517        550 KETTAPALKALKASGITVKILTG-DSELVAAKVCHEVGLDAGEVVIGSDIE  599 (900)
T ss_pred             CCHHHHHHHHHHHCCCEEEEECC-CCHHHHHHHHHHHCCCCCCCCCCHHHH
T ss_conf             71099999999977993899899-998999999998199954440225344


No 305
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional
Probab=24.34  E-value=57  Score=14.37  Aligned_cols=87  Identities=16%  Similarity=0.203  Sum_probs=56.5

Q ss_pred             HHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEC
Q ss_conf             99999862026963899725444414799997406614651121110244435643366688999876654156235207
Q gi|254780438|r  120 LTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAG  199 (261)
Q Consensus       120 L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAG  199 (261)
                      +.+.++.+++..-...+-|+.+. ..++..+.+.|+|.|=|-.=+       +       +.++++.+.. .....+-|-
T Consensus       176 i~~~v~~~~~~~~~~kIeVEv~t-l~q~~~a~~~gaDiI~LDnms-------~-------~~lk~av~~~-~~~~~iEaS  239 (277)
T PRK05742        176 IAQAVAAAHRIAPGKPVEVEVES-LDELRQALAAGADIVMLDELS-------L-------DDMREAVRLT-AGRAKLEAS  239 (277)
T ss_pred             HHHHHHHHHHHCCCCCEEEEECC-HHHHHHHHHCCCCEEEECCCC-------H-------HHHHHHHHHH-CCCEEEEEE
T ss_conf             99999999984899726999677-999999874699899986999-------9-------9999999974-797489998


Q ss_pred             CCCCHHHHHHHHHHCCCCEEEEEHH
Q ss_conf             8989877999997369963884259
Q gi|254780438|r  200 HDLTIQNIPNLINAIPYISEISVGH  224 (261)
Q Consensus       200 HgLn~~Nl~~~i~~Ip~I~EvsIGH  224 (261)
                      =|.|.+|+..+ ++ .+++=+|+|-
T Consensus       240 GGI~~~ni~~y-A~-tGvD~IS~ga  262 (277)
T PRK05742        240 GGINETTLRVI-AE-TGVDYISIGA  262 (277)
T ss_pred             CCCCHHHHHHH-HH-CCCCEEECCH
T ss_conf             89999999999-97-4999998880


No 306
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase. Members of this protein family are sulfoacetaldehyde acetyltransferase, an enzyme of taurine utilization. Taurine, or 2-aminoethanesulfonate, can be used by bacteria as a source of carbon, nitrogen, and sulfur.
Probab=24.12  E-value=25  Score=16.81  Aligned_cols=37  Identities=32%  Similarity=0.302  Sum_probs=14.7

Q ss_pred             CHHHHHHHHHHHCCCCCCCEEEEEECC------CHHHHHHHHHHC
Q ss_conf             889999988740001367415888348------568999998507
Q gi|254780438|r   53 RYTDLPEIRRLIDEQFPKAELNIEGYP------NETFLNLCERYK   91 (261)
Q Consensus        53 ~~~Dv~~l~~~~~~~~~~~elNiEg~p------~~e~i~ia~~ik   91 (261)
                      .+.++..+.+++.+.  +.|+=+=|.-      .++..+++.+..
T Consensus       182 ~~~~i~~a~~~L~~A--~rPvIi~G~gv~~~~a~~~l~~Lae~lg  224 (579)
T TIGR03457       182 GATSLAQAARLLAEA--KFPVIISGGGVVMGDAVEECKALAERLG  224 (579)
T ss_pred             CHHHHHHHHHHHHCC--CCCEEEECCCCCCCCHHHHHHHHHHHHC
T ss_conf             999999999999648--9968997974244326999999999739


No 307
>TIGR03586 PseI pseudaminic acid synthase.
Probab=24.09  E-value=58  Score=14.34  Aligned_cols=27  Identities=15%  Similarity=0.167  Sum_probs=16.8

Q ss_pred             CCCCCCHHHHHHHHHHCCCCEEEEECC
Q ss_conf             886899899999999749989998247
Q gi|254780438|r   20 NLPWPNLVHIGKIALQSGASGLTVHPR   46 (261)
Q Consensus        20 g~~~P~~~~~a~~~~~~GadgITvH~R   46 (261)
                      .|+.--..+....|.++|||.+-...+
T Consensus        13 nGdl~~Ak~LI~~A~~sGaDaVKFQ~~   39 (327)
T TIGR03586        13 NGSLERALAMIEAAAAAGADAIKLQTY   39 (327)
T ss_pred             CCHHHHHHHHHHHHHHHCCCEEEECCC
T ss_conf             782999999999999929999993360


No 308
>TIGR00839 aspA aspartate ammonia-lyase; InterPro: IPR004708 A number of enzymes, belonging to the lyase class, for which fumarate is a substrate have been shown ,  to share a short conserved sequence around a methionine which is probably involved in the catalytic activity of this type of enzymes.   Aspartate ammonia-lyase catalyses the conversion of aspartate to fumarate.; GO: 0008797 aspartate ammonia-lyase activity, 0006531 aspartate metabolic process.
Probab=24.08  E-value=48  Score=14.90  Aligned_cols=131  Identities=20%  Similarity=0.194  Sum_probs=79.1

Q ss_pred             ECCCHHHHHHHHHHC----CCEEEEEEC---CCCCCCCCC---CCCHH--HHHHHHHHHHHHHCCCCCEEEEEECCCCCC
Q ss_conf             348568999998507----212897101---655533357---82213--337889999986202696389972544441
Q gi|254780438|r   77 GYPNETFLNLCERYK----PEQITLVPD---DPHQLTSDH---GWDFL--QNQALLTKTVARLHNLGSRISLFADGNGNE  144 (261)
Q Consensus        77 g~p~~e~i~ia~~ik----P~qvtLVPe---~r~elTTeg---Gldv~--~~~~~L~~~i~~l~~~girvSLFIDpd~~q  144 (261)
                      ||.+|=.=++++++.    =+.--|-|-   .+.|-|-|-   |+-+.  +...+|-+.++.||+           .++|
T Consensus       103 MN~NEViaN~ALE~mGH~KGeY~~~~PndHVN~sQStNDayPta~~Ia~y~~L~kL~~~~~~l~~-----------~F~~  171 (469)
T TIGR00839       103 MNTNEVIANLALEIMGHKKGEYQFLNPNDHVNRSQSTNDAYPTALRIAVYKSLEKLVDTMEDLRD-----------AFKQ  171 (469)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH-----------HHHH
T ss_conf             30678999988876255146621208865102246666644017899999999999999999999-----------9988


Q ss_pred             HHHHHHH--HCC----CCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEE-CCCCCHHHHHHHHHHCCCC
Q ss_conf             4799997--406----61465112111024443564336668899987665415623520-7898987799999736996
Q gi|254780438|r  145 HSLQAAK--LTG----ADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINA-GHDLTIQNIPNLINAIPYI  217 (261)
Q Consensus       145 ~~i~~a~--~~G----ad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnA-GHgLn~~Nl~~~i~~Ip~I  217 (261)
                      |+-|.+.  ++|    =|+|=+--|-==++|.-=  -+.+++++++++.+-.+.+|+--| |-|||-.- .+.-.-.+.|
T Consensus       172 KA~EF~~viKMGRTqLQDAVPmtlGQEF~ay~~~--l~~di~~~~~~~~~l~EvNlGaTAiGTGlN~~~-~Y~~lvvK~l  248 (469)
T TIGR00839       172 KAKEFASVIKMGRTQLQDAVPMTLGQEFEAYALL--LERDIKNIKRTRQLLLEVNLGATAIGTGLNTPP-EYIKLVVKKL  248 (469)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHH--HHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCH-HHHHHHHHHH
T ss_conf             8899888862167545453235556048999999--999999999998778776347510215778771-1389998876


Q ss_pred             EEEE
Q ss_conf             3884
Q gi|254780438|r  218 SEIS  221 (261)
Q Consensus       218 ~Evs  221 (261)
                      .||+
T Consensus       249 aevt  252 (469)
T TIGR00839       249 AEVT  252 (469)
T ss_pred             HHCC
T ss_conf             4116


No 309
>TIGR01344 malate_syn_A malate synthase A; InterPro: IPR006252   These sequences represent plant malate synthase and one of two bacterial forms, designated malate synthase A. This enzyme and isocitrate lyase are the two characteristic enzymes of the glyoxylate shunt. The shunt enables the cell to use acetyl-CoA to generate increased levels of TCA cycle intermediates for biosynthetic pathways such as gluconeogenesis.; GO: 0004474 malate synthase activity, 0006097 glyoxylate cycle.
Probab=23.97  E-value=39  Score=15.52  Aligned_cols=46  Identities=9%  Similarity=0.107  Sum_probs=35.9

Q ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCH
Q ss_conf             8999998507212897101655533357822133378899999862026963899725444414
Q gi|254780438|r   82 TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEH  145 (261)
Q Consensus        82 e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~  145 (261)
                      ||-+|.=++|=|.+              ||||... +++-++||+|++.|-+   ||=||-++.
T Consensus       241 eMdEILyeLrEH~~--------------GLNCGRW-DYIFS~IK~L~~~G~~---~VLPDR~~v  286 (522)
T TIGR01344       241 EMDEILYELREHSS--------------GLNCGRW-DYIFSFIKTLRKAGPE---FVLPDRDAV  286 (522)
T ss_pred             HHHHHHHHHHHHHC--------------CCCCCHH-HHHHHHHHHHHHCCCC---CCCCCCCEE
T ss_conf             35789998876320--------------1366246-7888898876416885---146889703


No 310
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed
Probab=23.90  E-value=58  Score=14.31  Aligned_cols=60  Identities=13%  Similarity=0.200  Sum_probs=45.9

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHH
Q ss_conf             335782213337889999986202696389972544441479999740661465112111024
Q gi|254780438|r  106 TSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGAC  168 (261)
Q Consensus       106 TTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a  168 (261)
                      |-|+-...  ..+++.+.|+.++..--+|++=|-|- ++..-+..++.|+|.+-+|-..|-..
T Consensus       128 tGE~~~~~--~~~Yi~~~v~~ik~~f~~v~iev~Pl-~~eeY~~L~~aG~d~~~vyQETY~~~  187 (371)
T PRK09240        128 TGEHEAKV--GVDYIRRALPLAREYFSSVAIEVQPL-SEEEYAELVELGLDGVTVYQETYNPA  187 (371)
T ss_pred             CCCCCCCC--CHHHHHHHHHHHHHHCCCEEEEECCC-CHHHHHHHHHCCCCEEEEEEHHCCHH
T ss_conf             05787769--88999999999997567407995259-98999999985998699960325999


No 311
>TIGR01425 SRP54_euk signal recognition particle protein SRP54; InterPro: IPR006325    The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , . SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor . In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane.    This entry represents the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species.; GO: 0005525 GTP binding, 0008312 7S RNA binding, 0006614 SRP-dependent cotranslational protein targeting to membrane, 0048500 signal recognition particle.
Probab=23.82  E-value=37  Score=15.66  Aligned_cols=109  Identities=19%  Similarity=0.172  Sum_probs=58.8

Q ss_pred             CCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEC-----CCCCCHHHHHHHH
Q ss_conf             48568999998507212897101655533357822133378899999862026963899725-----4444147999974
Q gi|254780438|r   78 YPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFAD-----GNGNEHSLQAAKL  152 (261)
Q Consensus        78 ~p~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFID-----pd~~q~~i~~a~~  152 (261)
                      ..++||..+...++||++-+|=|--           .++..+  .--+.||+.----|+-|-     +.= --+|-|.+.
T Consensus       220 ~LF~Em~qv~~Ai~Pd~iifVMDGs-----------IGQAA~--~QAkAFK~~~~vGSvIiTKLDGHAkG-GGALSAVAA  285 (453)
T TIGR01425       220 ELFEEMVQVAEAIKPDSIIFVMDGS-----------IGQAAF--SQAKAFKDSVEVGSVIITKLDGHAKG-GGALSAVAA  285 (453)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEECCC-----------HHHHHH--HHHHHHHHCCCCEEEEEECCCCCCCC-CHHHHHHHH
T ss_conf             8889987686334998369980661-----------667889--99998630035003887515677676-237889875


Q ss_pred             CCCCEEEECCCCCHHHHHH---HHHHHHHH--HHHHHHHHHHHHCCCEEEECC
Q ss_conf             0661465112111024443---56433666--889998766541562352078
Q gi|254780438|r  153 TGADCIELYTGPYGACYNN---PQQERIFL--NKLAITAQLAQKMDLQINAGH  200 (261)
Q Consensus       153 ~Gad~VElhTG~Ya~a~~~---~~~~~~el--~~i~~aa~~A~~lgL~VnAGH  200 (261)
                      +-...|=|=||---+-+..   ......-|  -.|+-.++.+.++.+.=+-+|
T Consensus       286 TKsPiiFIGTGEhv~d~E~F~~~~FvskLLGmGDl~GL~~~v~~l~~~~~~~h  338 (453)
T TIGR01425       286 TKSPIIFIGTGEHVDDFEIFDAEPFVSKLLGMGDLKGLIDKVQDLKLDDEEKH  338 (453)
T ss_pred             HCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCCCHHHHHHHHHHHCHHCCCHH
T ss_conf             35977981377502760578997147754020218899999975142103107


No 312
>cd02419 Peptidase_C39C A sub-family of peptidase family C39. Peptidase family C39 mostly contains bacteriocin-processing endopeptidases from bacteria. The cysteine peptidases in family C39 cleave the "double-glycine" leader peptides from the precursors of various bacteriocins (mostly non-lantibiotic). The cleavage is mediated by the transporter as part of the secretion process. Bacteriocins are antibiotic proteins secreted by some species of bacteria that inhibit the growth of other bacterial species. The bacteriocin is synthesized as a precursor with an N-terminal leader peptide, and processing involves removal of the leader peptide by cleavage at a Gly-Gly bond, followed by translocation of the mature bacteriocin across the cytoplasmic membrane. Most endopeptidases of family C39 are N-terminal domains in larger proteins (ABC transporters) that serve both functions. The proposed protease active site is conserved in this sub-family.
Probab=23.63  E-value=24  Score=16.94  Aligned_cols=46  Identities=22%  Similarity=0.329  Sum_probs=34.9

Q ss_pred             HHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHH
Q ss_conf             9998766541562352078989877999997369963884259999999
Q gi|254780438|r  182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATA  230 (261)
Q Consensus       182 i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseA  230 (261)
                      +....+.|.++||.+.+-. .+++.+.. + .+|-|-..+.+||+|-+.
T Consensus        46 l~~L~~~a~~~Gl~~~~~~-~~~~~L~~-l-~lP~I~~~~~~HfVVl~~   91 (127)
T cd02419          46 LADLIDIAQQLGLSTRALR-LDLEELGQ-L-KLPCILHWDMNHFVVLKK   91 (127)
T ss_pred             HHHHHHHHHHCCCEEEEEE-CCHHHHHH-C-CCCEEEEECCCEEEEEEE
T ss_conf             9999999998799034887-37999830-7-788999975997999999


No 313
>TIGR01212 TIGR01212 radical SAM protein, TIGR01212 family; InterPro: IPR005911    This uncharacterised protein family shows significant similarity to IPR005910 from INTERPRO, a longer protein that is a histone acetyltransferase at its C-terminus and is a subunit of RNA polymerase II (in yeast). This family lacks the GNAT acetyltransferase domain..
Probab=23.54  E-value=59  Score=14.27  Aligned_cols=124  Identities=16%  Similarity=0.154  Sum_probs=74.6

Q ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH---HHHHHHHHHCCCEEEEEECCCCCCCCCC
Q ss_conf             9974998999824788334888999998874000136741588834856---8999998507212897101655533357
Q gi|254780438|r   33 ALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE---TFLNLCERYKPEQITLVPDDPHQLTSDH  109 (261)
Q Consensus        33 ~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~---e~i~ia~~ikP~qvtLVPe~r~elTTeg  109 (261)
                      ....++-||-|==|||-   -+++|.+|-.-..++  ..++=+|.-.-.   +=++.++                    .
T Consensus       106 L~~~~vVGlsvgTRPDC---~P~~VLDlL~ey~~~--GyevWvELGLQtah~~TL~~IN--------------------R  160 (307)
T TIGR01212       106 LSEDDVVGLSVGTRPDC---VPDEVLDLLAEYKER--GYEVWVELGLQTAHDRTLKKIN--------------------R  160 (307)
T ss_pred             HHHCCEEEEEECCCCCC---CHHHHHHHHHHHHHC--CEEEEEECCCCCHHHHHHHHHC--------------------C
T ss_conf             63278057753688987---747899999999549--7589996053565589999851--------------------4


Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCEEEEEE-CCCC--C----CHHHHHHHHCCCCEEEECC-----CC-CHHHHHHHHHHH
Q ss_conf             82213337889999986202696389972-5444--4----1479999740661465112-----11-102444356433
Q gi|254780438|r  110 GWDFLQNQALLTKTVARLHNLGSRISLFA-DGNG--N----EHSLQAAKLTGADCIELYT-----GP-YGACYNNPQQER  176 (261)
Q Consensus       110 Gldv~~~~~~L~~~i~~l~~~girvSLFI-Dpd~--~----q~~i~~a~~~Gad~VElhT-----G~-Ya~a~~~~~~~~  176 (261)
                          ..+..-..+.+.++|+.||+|.--| =-=|  +    -.+.+...++++|.|=||-     |+ -+++|.+.+-.-
T Consensus       161 ----gHd~~~y~~a~~~~~krGikVC~H~I~GLPgE~~~~~~eTak~~~~l~vdGiKiH~LhvvkGt~m~k~Y~~G~~~~  236 (307)
T TIGR01212       161 ----GHDFACYVDAVKRARKRGIKVCSHVILGLPGEDREEMLETAKIVASLDVDGIKIHPLHVVKGTKMAKQYEKGELKT  236 (307)
T ss_pred             ----CCCHHHHHHHHHHHHHCCCEEEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEEEEEEECCHHHHHHHCCCEEE
T ss_conf             ----3787899999999976598899998742898888899999999983798848872017873575788754574010


Q ss_pred             HHHHHHHHH
Q ss_conf             666889998
Q gi|254780438|r  177 IFLNKLAIT  185 (261)
Q Consensus       177 ~el~~i~~a  185 (261)
                      ..++.|...
T Consensus       237 l~~e~Y~~~  245 (307)
T TIGR01212       237 LSLEEYISL  245 (307)
T ss_pred             CCHHHHHHH
T ss_conf             476779999


No 314
>PRK08564 5'-methylthioadenosine phosphorylase II; Reviewed
Probab=23.45  E-value=59  Score=14.25  Aligned_cols=97  Identities=14%  Similarity=0.095  Sum_probs=49.2

Q ss_pred             ECCCCCCHHHHHHHHCCCCEEEEC-CCCCHHHHHHHHH-HHHHHHHHHHH-------------HHHHHHCCCEEEECCCC
Q ss_conf             254444147999974066146511-2111024443564-33666889998-------------76654156235207898
Q gi|254780438|r  138 ADGNGNEHSLQAAKLTGADCIELY-TGPYGACYNNPQQ-ERIFLNKLAIT-------------AQLAQKMDLQINAGHDL  202 (261)
Q Consensus       138 IDpd~~q~~i~~a~~~Gad~VElh-TG~Ya~a~~~~~~-~~~el~~i~~a-------------a~~A~~lgL~VnAGHgL  202 (261)
                      .||+..+..++.|+++|.   .+| .|.|+-. ..+.. -..|..-++..             +..|+++||.+-+= - 
T Consensus       137 y~~~Lr~~l~~~a~~~g~---~~~~~GvY~~~-~GP~fET~AEir~~r~~~GaD~VGMStvPEvilAre~gl~~~~i-s-  210 (267)
T PRK08564        137 FCPELRKIIIETAKELGI---PVHEKGTYICI-EGPRFSTRAESRMWREVFKADIIGMTLVPEVNLARELGMCYATI-A-  210 (267)
T ss_pred             CCHHHHHHHHHHHHHCCC---CEECCCEEEEE-ECCCCCCHHHHHHHHHHHCCCEECCCCCHHHHHHHHCCCCEEEE-E-
T ss_conf             589999999999998499---66526459996-68987879999999987489872367348999998779956999-9-


Q ss_pred             CHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9877999997369963884259999999994099999999999974105
Q gi|254780438|r  203 TIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQHLD  251 (261)
Q Consensus       203 n~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~~~~~  251 (261)
                         -+..+ +.   +.+-.+-|    +.+..=++++..++++++.+-..
T Consensus       211 ---~vTN~-a~---~~~~~~th----eeV~~~~~~~~~~~~~ll~~~I~  248 (267)
T PRK08564        211 ---MVTDY-DV---WAEKPVTA----EEVEKVMKENTEKVKKLLYEAIP  248 (267)
T ss_pred             ---EEECC-CC---CCCCCCCH----HHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             ---97524-41---46999899----99999999989999999999998


No 315
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional
Probab=23.27  E-value=60  Score=14.23  Aligned_cols=127  Identities=15%  Similarity=0.215  Sum_probs=71.7

Q ss_pred             HHHHHHHHHHCCCEEEEEECCC---------CCCCCCCCCCH----------HHHHH---HHHHHHHHHCCCC--CEEEE
Q ss_conf             6899999850721289710165---------55333578221----------33378---8999998620269--63899
Q gi|254780438|r   81 ETFLNLCERYKPEQITLVPDDP---------HQLTSDHGWDF----------LQNQA---LLTKTVARLHNLG--SRISL  136 (261)
Q Consensus        81 ~e~i~ia~~ikP~qvtLVPe~r---------~elTTegGldv----------~~~~~---~L~~~i~~l~~~g--irvSL  136 (261)
                      .+|++.+..+.|.-..+-.-|.         ..+..-||.+-          ..|+-   .+...+++++...  .++-.
T Consensus       109 ~~~v~~~~~~~~~~~i~~TRKT~PG~R~l~k~AV~~GGg~~HR~~Lsd~iLiKdNHi~~~~~~~av~~~r~~~~~~~IeV  188 (279)
T PRK08385        109 RKLVDLVRAVNPKVRVAGTRKTLPGLRLIDKKAIMIGGGEPHRFSLSDAILIKDNHLALVPLEEAIRRAKEFSVYKVVEV  188 (279)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEECCCHHHHCCHHHHHHHHHHHCCCCEEEE
T ss_conf             99999986139972998547778540799999998738635568876327880106764388999999998489961899


Q ss_pred             EECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHC----CCEEEECCCCCHHHHHHHHH
Q ss_conf             72544441479999740661465112111024443564336668899987665415----62352078989877999997
Q gi|254780438|r  137 FADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKM----DLQINAGHDLTIQNIPNLIN  212 (261)
Q Consensus       137 FIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~l----gL~VnAGHgLn~~Nl~~~i~  212 (261)
                      -+| +.+|  +..+.+.|+|.|=|-.      + .+       +.++++.+..++.    .+.+-|-=|+|.+|+..+ +
T Consensus       189 Ev~-~lee--~~~a~~~g~d~I~LDn------~-s~-------e~~~~~v~~l~~~~~~~~v~ieaSGGI~~~ni~~y-a  250 (279)
T PRK08385        189 EVE-SLED--ALKAAKAGADIIMLDN------M-TP-------EEIREVIEALKELGLREKVKIEVSGGITPETIAEY-A  250 (279)
T ss_pred             EEC-CHHH--HHHHHHCCCCEEEECC------C-CH-------HHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHH-H
T ss_conf             709-8999--9999976999999849------9-99-------99999999987507689789999789989999999-8


Q ss_pred             HCCCCEEEEEHHHH
Q ss_conf             36996388425999
Q gi|254780438|r  213 AIPYISEISVGHAF  226 (261)
Q Consensus       213 ~Ip~I~EvsIGHai  226 (261)
                      + -+++=+|+|--.
T Consensus       251 ~-tGVD~IS~g~lt  263 (279)
T PRK08385        251 K-LDVDVISLGALT  263 (279)
T ss_pred             H-CCCCEEECCHHH
T ss_conf             5-598999849777


No 316
>PRK01122 potassium-transporting ATPase subunit B; Provisional
Probab=23.27  E-value=60  Score=14.23  Aligned_cols=58  Identities=12%  Similarity=0.254  Sum_probs=35.2

Q ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             7889999986202696389972544441479999740661465112111024443564336668899
Q gi|254780438|r  117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA  183 (261)
Q Consensus       117 ~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~  183 (261)
                      +...++.++.|++.||++-+--- |-..-...-|+++|.|-+      ||++  .|++....+++++
T Consensus       452 Rp~a~eaI~~Lr~~GI~vvMITG-Dn~~TA~aIA~elGIDd~------~A~~--tPedKl~iVk~LQ  509 (684)
T PRK01122        452 KPGIKERFAQLRKMGIKTVMITG-DNPLTAAAIAAEAGVDDF------LAEA--TPEDKLALIRQEQ  509 (684)
T ss_pred             CHHHHHHHHHHHHCCCEEEEECC-CCHHHHHHHHHHHCCHHH------HHCC--CHHHHHHHHHHHH
T ss_conf             75499999999987992999989-896999999998495655------6579--9999999999998


No 317
>PRK00507 deoxyribose-phosphate aldolase; Provisional
Probab=23.26  E-value=60  Score=14.23  Aligned_cols=168  Identities=16%  Similarity=0.168  Sum_probs=89.1

Q ss_pred             CCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH----H----HHHHHHHHCCC
Q ss_conf             689989999999974998999824788334888999998874000136741588834856----8----99999850721
Q gi|254780438|r   22 PWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE----T----FLNLCERYKPE   93 (261)
Q Consensus        22 ~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~----e----~i~ia~~ikP~   93 (261)
                      ..-++...+..|.++|...+.|.|+         .|...++.+...-.++ --.=|.|+-    +    -.+.+.+---+
T Consensus        20 T~~~i~~lc~~A~~~~~aaVCV~P~---------~V~~a~~~L~~s~v~v-~tVigFP~G~~~~~~K~~E~~~ai~~GAd   89 (221)
T PRK00507         20 TEEDIDKLCEEAKEYGFASVCVNPS---------YVKLAAELLKGSDVKV-CTVIGFPLGASTTAVKAFEAKDAIANGAD   89 (221)
T ss_pred             CHHHHHHHHHHHHHHCCCEEEECHH---------HHHHHHHHHCCCCCCE-EEEEECCCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             9999999999999879948998989---------9999999844899865-57813699999576899999999985998


Q ss_pred             EEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEE----EEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHH
Q ss_conf             28971016555333578221333788999998620269638----99725444414799997406614651121110244
Q gi|254780438|r   94 QITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRI----SLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY  169 (261)
Q Consensus        94 qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girv----SLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~  169 (261)
                      -+-+|+.-..  =-+|-|+..  .+.++.+++..+..-++|    .++ +.+--.+..+.+.+.|+|.|---||....- 
T Consensus        90 EiD~Vin~~~--~~~g~~~~v--~~ei~~v~~~~~~~~lKVIlEt~~L-t~~ei~~a~~~~~~aGadfvKTSTGf~~~g-  163 (221)
T PRK00507         90 EIDMVINIGA--LKSGDWDAV--EADIRAVVEAAGGKVLKVIIETCLL-TDEEKVKACEICKEAGADFVKTSTGFSTGG-  163 (221)
T ss_pred             EEEEECCHHH--HHCCCHHHH--HHHHHHHHHHHCCCCEEEEEECCCC-CHHHHHHHHHHHHHHCCCEEEECCCCCCCC-
T ss_conf             7774025999--975848899--9999999987276736999744659-999999999999982978786058878899-


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCEEEE-CCCCCHHHHHHHHHH
Q ss_conf             43564336668899987665415623520-789898779999973
Q gi|254780438|r  170 NNPQQERIFLNKLAITAQLAQKMDLQINA-GHDLTIQNIPNLINA  213 (261)
Q Consensus       170 ~~~~~~~~el~~i~~aa~~A~~lgL~VnA-GHgLn~~Nl~~~i~~  213 (261)
                      ......    .-++++.    .-.++|-| |===+++....++..
T Consensus       164 at~e~v----~~m~~~~----~~~~giKasGGIrt~~~a~~~l~a  200 (221)
T PRK00507        164 ATVEDV----KLMRETV----GPRVGVKASGGIRTLEDALAMIEA  200 (221)
T ss_pred             CCHHHH----HHHHHHH----CCCCEEECCCCCCCHHHHHHHHHH
T ss_conf             899999----9999972----878638677898999999999982


No 318
>PRK10076 pyruvate formate lyase II activase; Provisional
Probab=23.22  E-value=60  Score=14.23  Aligned_cols=18  Identities=22%  Similarity=0.314  Sum_probs=8.2

Q ss_pred             HHHHHHHHHHHHCCCCCE
Q ss_conf             378899999862026963
Q gi|254780438|r  116 NQALLTKTVARLHNLGSR  133 (261)
Q Consensus       116 ~~~~L~~~i~~l~~~gir  133 (261)
                      +.+++...++.+|+.||.
T Consensus        52 Q~~F~~ellk~~k~~gih   69 (213)
T PRK10076         52 QAEFATRFLQRLRLWGVS   69 (213)
T ss_pred             CHHHHHHHHHHHHHCCCC
T ss_conf             999999999999866998


No 319
>cd03415 CbiX_CbiC Archaeal sirohydrochlorin cobalt chelatase (CbiX) single domain. Proteins in this subgroup contain a single CbiX domain N-terminal to a precorrin-8X methylmutase (CbiC) domain. CbiX is a cobaltochelatase, responsible for the chelation of Co2+ into sirohydrochlorin, while CbiC catalyzes the conversion of cobalt-precorrin 8 to cobyrinic acid by methyl rearrangement. Both CbiX and CbiC are involved in vitamin B12 biosynthesis.
Probab=23.13  E-value=60  Score=14.21  Aligned_cols=23  Identities=17%  Similarity=0.149  Sum_probs=10.8

Q ss_pred             CCCHHHHHHHHHHCCCCEEEEEC
Q ss_conf             89989999999974998999824
Q gi|254780438|r   23 WPNLVHIGKIALQSGASGLTVHP   45 (261)
Q Consensus        23 ~P~~~~~a~~~~~~GadgITvH~   45 (261)
                      .|++-++...|.+.|++-|+|.|
T Consensus        43 ePsi~e~l~~~v~~G~~~IiVvP   65 (125)
T cd03415          43 EPNWRDLLNELLSEGYGHIIIAL   65 (125)
T ss_pred             CCCHHHHHHHHHHCCCCCEEEEE
T ss_conf             99889999999984998199995


No 320
>pfam00218 IGPS Indole-3-glycerol phosphate synthase.
Probab=23.09  E-value=60  Score=14.21  Aligned_cols=176  Identities=18%  Similarity=0.199  Sum_probs=102.5

Q ss_pred             CCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             89989999999974998999824788334888999998874000136741588834856899999850721289710165
Q gi|254780438|r   23 WPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDP  102 (261)
Q Consensus        23 ~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLVPe~r  102 (261)
                      .-||.+.|+..+++||..|-|.--|+.=+=..+|+...++.+.-..-...|=+    ++-.+.-+..+--|.+-|.-.- 
T Consensus        67 ~~dp~~iA~~Y~~~GA~aiSVLTd~~~F~Gs~~~L~~vr~~v~lPiLrKDFIi----d~yQI~ear~~GADaiLLI~~~-  141 (254)
T pfam00218        67 DFDPAEIARAYEAAGASAISVLTEPKYFQGSLEYLREVREAVSLPVLRKDFII----DEYQIYEARAYGADTVLLIVAV-  141 (254)
T ss_pred             CCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCEECCHHEE----EHHHHHHHHHCCCCEEEHHHHC-
T ss_conf             89999999999977983799842678679879999999986488511141046----5999999998088863144711-


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             55333578221333788999998620269638997254444147999974066146511211102444356433666889
Q gi|254780438|r  103 HQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL  182 (261)
Q Consensus       103 ~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i  182 (261)
                                 . ..+.|...+...++.|..+=+=+- +.  ..++.|.+.|++.|=+..-..-.. .-.      ++.-
T Consensus       142 -----------L-~~~~l~~l~~~a~~lgl~~LvEvh-~~--~El~~al~~~a~iIGINNRnL~tf-~vd------~~~t  199 (254)
T pfam00218       142 -----------L-SDELLEELYEYARSLGMEPLVEVH-NE--EELERALALGAKLIGVNNRNLKTF-EVD------LNTT  199 (254)
T ss_pred             -----------C-CHHHHHHHHHHHHHHCCEEEEEEC-CH--HHHHHHHHCCCCEEEECCCCHHHH-HCC------HHHH
T ss_conf             -----------9-999999999999984886798868-99--999999848997896327884651-005------7999


Q ss_pred             HHHHHHHHHCCCEEEECCCC-CHHHHHHHHHHCCCCEEEEEHHHHHH
Q ss_conf             99876654156235207898-98779999973699638842599999
Q gi|254780438|r  183 AITAQLAQKMDLQINAGHDL-TIQNIPNLINAIPYISEISVGHAFAA  228 (261)
Q Consensus       183 ~~aa~~A~~lgL~VnAGHgL-n~~Nl~~~i~~Ip~I~EvsIGHaiIs  228 (261)
                      .+.+...-. +.-+=|--|+ +.+.+.. +.+ -+++-|=||-+++.
T Consensus       200 ~~L~~~ip~-~~~~VsESGI~~~~di~~-l~~-~G~~~~LIGe~lm~  243 (254)
T pfam00218       200 RRLAPMVPE-DVLLVAESGISTPEDVEK-LAK-HGANAFLVGESLMR  243 (254)
T ss_pred             HHHHHHCCC-CCEEEECCCCCCHHHHHH-HHH-CCCCEEEECHHHHC
T ss_conf             999955898-987998389999999999-998-79999998968757


No 321
>cd01137 PsaA Metal binding protein PsaA.  These proteins have been shown to function as initial receptors in ABC transport of Mn2+ and as surface adhesins in some eubacterial species.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).
Probab=22.61  E-value=62  Score=14.14  Aligned_cols=41  Identities=17%  Similarity=0.227  Sum_probs=21.2

Q ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHH-HHHCCCCEE
Q ss_conf             788999998620269638997254444147999-974066146
Q gi|254780438|r  117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQA-AKLTGADCI  158 (261)
Q Consensus       117 ~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~-a~~~Gad~V  158 (261)
                      ...|..+++.+++.+|++ +|.+|..+.+.++. |+++|+..+
T Consensus       212 ~~~l~~l~~~ik~~~i~~-if~E~~~~~k~a~~ia~e~g~~v~  253 (287)
T cd01137         212 PKQVATLIEQVKKEKVPA-VFVESTVNDRLMKQVAKETGAKIG  253 (287)
T ss_pred             HHHHHHHHHHHHHCCCCE-EEEECCCCCHHHHHHHHHCCCCCC
T ss_conf             999999999998529978-998589990999999997299714


No 322
>COG1533 SplB DNA repair photolyase [DNA replication, recombination, and repair]
Probab=22.47  E-value=62  Score=14.13  Aligned_cols=48  Identities=23%  Similarity=0.159  Sum_probs=33.5

Q ss_pred             HHHHHHHHHHCCCCCEEEEEECCCCC-------CHHHHHHHHCCCCEEEECCCCC
Q ss_conf             88999998620269638997254444-------1479999740661465112111
Q gi|254780438|r  118 ALLTKTVARLHNLGSRISLFADGNGN-------EHSLQAAKLTGADCIELYTGPY  165 (261)
Q Consensus       118 ~~L~~~i~~l~~~girvSLFIDpd~~-------q~~i~~a~~~Gad~VElhTG~Y  165 (261)
                      +.--..++.|.++||+|.+||+|-.-       ...+..+.+.|+..|=..+=.+
T Consensus       169 ~~Ri~al~~l~eaGi~~~v~v~PIiP~~~d~e~e~~l~~~~~ag~~~v~~~~l~~  223 (297)
T COG1533         169 EERLEALKELSEAGIPVGLFVAPIIPGLNDEELERILEAAAEAGARVVVYGTLRL  223 (297)
T ss_pred             HHHHHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEEEEC
T ss_conf             9999999999987984899985530788758899999999975774136313304


No 323
>PRK05660 coproporphyrinogen III oxidase; Provisional
Probab=22.31  E-value=62  Score=14.11  Aligned_cols=105  Identities=14%  Similarity=0.227  Sum_probs=60.8

Q ss_pred             CCHHHHHHHHHHHCCCC---CCCEEEEEECCC---HHHHHHHHHHCCCEEEE-----EECCCCCCCCCCCCCHHHHHHHH
Q ss_conf             88899999887400013---674158883485---68999998507212897-----10165553335782213337889
Q gi|254780438|r   52 IRYTDLPEIRRLIDEQF---PKAELNIEGYPN---ETFLNLCERYKPEQITL-----VPDDPHQLTSDHGWDFLQNQALL  120 (261)
Q Consensus        52 I~~~Dv~~l~~~~~~~~---~~~elNiEg~p~---~e~i~ia~~ikP~qvtL-----VPe~r~elTTegGldv~~~~~~L  120 (261)
                      ..++++..|-+.+...+   ++.|+.+|++|.   .+.+....+.-=+.+-+     .++....+---      ...+..
T Consensus        72 L~~~~l~~l~~~i~~~f~~~~~~EiTiE~nP~~~~~~~l~~l~~~GvnRiSiGVQsf~~~~l~~lgR~------h~~~~~  145 (378)
T PRK05660         72 FSAEAIQRLLDGVRARLPFAPDAEITMEANPGTVEADRFVGYQRAGVNRISIGVQSFSEEKLKRLGRI------HGPDEA  145 (378)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHCCCCEEEEEECCCCHHHHHHHCCC------CCHHHH
T ss_conf             89999999999999857987771489845705330889999998098759996143789999982799------999999


Q ss_pred             HHHHHHHCCCCCE-EEE-EECCCCCC------HHHHHHHHCCCCEEEECC
Q ss_conf             9999862026963-899-72544441------479999740661465112
Q gi|254780438|r  121 TKTVARLHNLGSR-ISL-FADGNGNE------HSLQAAKLTGADCIELYT  162 (261)
Q Consensus       121 ~~~i~~l~~~gir-vSL-FIDpd~~q------~~i~~a~~~Gad~VElhT  162 (261)
                      ...+..+++.|.. +|+ +|---|.|      .+++.+.++++|.|-+|.
T Consensus       146 ~~ai~~~r~~gf~~iniDLiyGlP~Qt~~~~~~~l~~~~~l~p~his~Y~  195 (378)
T PRK05660        146 KRAAKLAQGAGLRSFNLDLMHGLPDQSLEEALDDLRQAIALNPPHLSWYQ  195 (378)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             99999999769960654232689998899999999998644988057888


No 324
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional
Probab=22.04  E-value=63  Score=14.07  Aligned_cols=118  Identities=12%  Similarity=0.135  Sum_probs=73.4

Q ss_pred             HCCCCCCCCHHHHHHHHHHCCCCEEEE-ECC-CCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCC--------------
Q ss_conf             207886899899999999749989998-247-8833488899999887400013674158883485--------------
Q gi|254780438|r   17 NRRNLPWPNLVHIGKIALQSGASGLTV-HPR-PDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPN--------------   80 (261)
Q Consensus        17 naRg~~~P~~~~~a~~~~~~GadgITv-H~R-~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~--------------   80 (261)
                      +.+...+-||+++|+.-.+.||+-|-+ -+- -.-|-.+.+=+.++.+.+     .+|+-+-|--.              
T Consensus        22 ~~~~~~~~dP~~~a~~~~~~Ga~~lhvvDLdaa~g~~~N~~~I~~i~~~~-----~~piqvGGGIrs~e~~~~~l~~Ga~   96 (231)
T PRK13586         22 EGTGLVLGDPLKIAEELYNEGYDSIHVVDLDAAEGKGDNEEYIKRICKIG-----FSWIQVGGGIRDVEKAERLLSYDCS   96 (231)
T ss_pred             CCCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHHC-----CCCEEEECCCCCHHHHHHHHHCCCC
T ss_conf             79887668999999999987999899996715689984399999999745-----9857985671769999999977998


Q ss_pred             -----------H-HHHHHHHHHCCCEEEEEECC-C-CCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCC
Q ss_conf             -----------6-89999985072128971016-5-5533357822133378899999862026963899725444
Q gi|254780438|r   81 -----------E-TFLNLCERYKPEQITLVPDD-P-HQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNG  142 (261)
Q Consensus        81 -----------~-e~i~ia~~ikP~qvtLVPe~-r-~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~  142 (261)
                                 + .+.+++.++-|+++.+-=|- . ..+.+ +||.-.+  -.+.++++.+.+.|++-=++-|-+.
T Consensus        97 kViigS~a~~np~~~~~~~~~~G~~~iv~siD~~~~~~v~~-~Gw~~~~--~~~~~~i~~~~~~g~~~ii~TdI~~  169 (231)
T PRK13586         97 AIVMSTLPFTNPDTFRRIVAGIGENRVLVSVDYDDRKYVLI-KGWKEKS--MKVEDAISHVNSLESLGVIFTYVCN  169 (231)
T ss_pred             EEEECHHHHHCHHHHHHHHHHHCCCCEEEEEEECCCCEEEE-ECCCCCC--CCHHHHHHHHHHCCCCEEEEEEECC
T ss_conf             89976888769599999999849966899999758968998-4872688--6699999999975998899976451


No 325
>KOG0780 consensus
Probab=21.98  E-value=47  Score=14.98  Aligned_cols=30  Identities=23%  Similarity=0.287  Sum_probs=22.5

Q ss_pred             EEEEECCCHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             588834856899999850721289710165
Q gi|254780438|r   73 LNIEGYPNETFLNLCERYKPEQITLVPDDP  102 (261)
Q Consensus        73 lNiEg~p~~e~i~ia~~ikP~qvtLVPe~r  102 (261)
                      .-.|-..++||+++...++|+++-+|=|.-
T Consensus       195 h~qe~sLfeEM~~v~~ai~Pd~vi~VmDas  224 (483)
T KOG0780         195 HKQEASLFEEMKQVSKAIKPDEIIFVMDAS  224 (483)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEECC
T ss_conf             012489999999998515987389998562


No 326
>PRK13135 consensus
Probab=21.87  E-value=64  Score=14.05  Aligned_cols=204  Identities=17%  Similarity=0.192  Sum_probs=121.4

Q ss_pred             CCCCHH---HHHHHHHHCCCCEEEE-----ECCCCCCCCCHHH------------HHHHHHHHCCCCCCCEEEEEECCCH
Q ss_conf             689989---9999999749989998-----2478833488899------------9998874000136741588834856
Q gi|254780438|r   22 PWPNLV---HIGKIALQSGASGLTV-----HPRPDQRHIRYTD------------LPEIRRLIDEQFPKAELNIEGYPNE   81 (261)
Q Consensus        22 ~~P~~~---~~a~~~~~~GadgITv-----H~R~DrRHI~~~D------------v~~l~~~~~~~~~~~elNiEg~p~~   81 (261)
                      .|||+-   ++.+...++|||-|-+     -|--|---||...            +.++-+-+..+ .++|+=+=+|-++
T Consensus        26 G~P~~~~s~~~l~~l~~~GaDiiElGiPfSDP~ADGPvIq~A~~rAL~~G~~~~~~~~~~~~~r~~-~~~PivlM~Y~N~  104 (267)
T PRK13135         26 GDPDLATTEALIPLLAESGADIIELGVPFSDPMADGPTIQLSSERALAAGTTLPRILAMVRSVRRR-CQVPIVLMGYYNP  104 (267)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHCC-CCCCEEEEECCHH
T ss_conf             189989999999999975999999789989866658999999999997698499999999986335-8998899842309


Q ss_pred             -------HHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCC
Q ss_conf             -------8999998507212897101655533357822133378899999862026963899725444414799997406
Q gi|254780438|r   82 -------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTG  154 (261)
Q Consensus        82 -------e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~G  154 (261)
                             .|++-+.+.-= .-.|+||-|-              +.-.++...+++.|+....|+-|..+..-++...+..
T Consensus       105 i~~yG~e~F~~~~~~~Gv-dGlIipDLP~--------------ee~~~~~~~~~~~~l~~I~lvsPtt~~~Ri~~i~~~s  169 (267)
T PRK13135        105 IFAYGLERFAADAAAAGV-DGVLLVDLPP--------------EEAEEFKACADRHGLDVIFLLTPTSDESRIRTVARLG  169 (267)
T ss_pred             HHHHHHHHHHHHHHHCCC-CEEECCCCCH--------------HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCC
T ss_conf             988468999999997499-7476378997--------------8889999999872961899808989579999999618


Q ss_pred             CCEEEE--CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCH-HHHHHHHHHCCCCEEEEEHHHHHHHHH
Q ss_conf             614651--12111024443564336668899987665415623520789898-779999973699638842599999999
Q gi|254780438|r  155 ADCIEL--YTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTI-QNIPNLINAIPYISEISVGHAFAATAL  231 (261)
Q Consensus       155 ad~VEl--hTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~-~Nl~~~i~~Ip~I~EvsIGHaiIseAl  231 (261)
                      -..|=.  .+|.=...-.........+.++++      ...+-|-+|-|..- +-+.. ++  ..-+=|-||-+||-.--
T Consensus       170 ~GFiY~Vs~~GvTG~~~~~~~~~~~~i~~ik~------~t~~Pv~vGFGI~~~e~v~~-i~--~~ADGvIVGSaiVk~ie  240 (267)
T PRK13135        170 RGFVYYVSVTGVTGARSGVEATVGGNVAKIRE------KITVPVVVGFGISTPQQAAD-VA--AMADGVVVGSALVKLFE  240 (267)
T ss_pred             CCEEEEEECCCCCCCCCCCHHHHHHHHHHHHH------HCCCCEEEEECCCCHHHHHH-HH--CCCCEEEECHHHHHHHH
T ss_conf             98189985456667764444889999999986------06898489816799999999-98--05999998789999998


Q ss_pred             HH---HHHHHHHHHHHHHHHHH
Q ss_conf             94---09999999999997410
Q gi|254780438|r  232 EC---GVKEAVFCFRRACGQHL  250 (261)
Q Consensus       232 ~~---GL~~aI~~~~~ii~~~~  250 (261)
                      ..   -+.+.|.+|.+-++++.
T Consensus       241 ~~~~~~~~~~i~~fv~~lk~ai  262 (267)
T PRK13135        241 LHRGEELRQEVATFVASLRQAI  262 (267)
T ss_pred             HCCCHHHHHHHHHHHHHHHHHH
T ss_conf             6081878999999999999997


No 327
>COG4882 Predicted aminopeptidase, Iap family [General function prediction only]
Probab=21.85  E-value=64  Score=14.04  Aligned_cols=39  Identities=21%  Similarity=0.184  Sum_probs=32.8

Q ss_pred             CCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHH
Q ss_conf             886899899999999749989998247883348889999
Q gi|254780438|r   20 NLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLP   58 (261)
Q Consensus        20 g~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~   58 (261)
                      -++--|+-.++..|..+||.+|.+-.|+-||-++.-|.-
T Consensus        98 pq~vdd~k~~~i~Aae~ga~a~~f~~~~~rriV~~Gd~g  136 (486)
T COG4882          98 PQVVDDLKAAAILAAEAGAEALLFESRDPRRIVTGGDWG  136 (486)
T ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEECCCCEEEEECCCCC
T ss_conf             531778889999998768728998358860588626534


No 328
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated
Probab=21.57  E-value=58  Score=14.32  Aligned_cols=74  Identities=15%  Similarity=0.163  Sum_probs=28.0

Q ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEEC
Q ss_conf             89999985072128971016555333578221333788999998620269638997254444147999974066146511
Q gi|254780438|r   82 TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELY  161 (261)
Q Consensus        82 e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElh  161 (261)
                      +.-++...++|+...+-=|.+.--|    +.+. +   +..+.+.-++.|+.+  .||.-..-.-+....+.|||.|=-=
T Consensus       135 d~~~~~~ai~~~T~lv~~EtpsNP~----l~v~-D---i~~i~~iA~~~g~~~--vVDNT~atP~~~~Pl~~GaDivvhS  204 (391)
T PRK08133        135 DLDAWRAAVRPNTKLFFLETPSNPL----TELA-D---IAALAEIAHAAGALL--VVDNCFCTPALQQPLKLGADVVIHS  204 (391)
T ss_pred             CHHHHHHHCCCCCEEEEEECCCCCC----CEEE-C---CHHHHHHHHHCCCEE--EEECCCCCCCCCCHHHHCCCEEEEE
T ss_conf             9999997458784599997899998----6655-5---399999987558759--9878976524446566188379996


Q ss_pred             CCCC
Q ss_conf             2111
Q gi|254780438|r  162 TGPY  165 (261)
Q Consensus       162 TG~Y  165 (261)
                      +-+|
T Consensus       205 ~TKy  208 (391)
T PRK08133        205 ATKY  208 (391)
T ss_pred             CCCE
T ss_conf             6603


No 329
>COG0191 Fba Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism]
Probab=21.45  E-value=65  Score=13.99  Aligned_cols=104  Identities=20%  Similarity=0.345  Sum_probs=66.7

Q ss_pred             HHHHHHHHHHHHHHHCCCCCEEE--------------------EEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHH--
Q ss_conf             13337889999986202696389--------------------97254444147999974066146511211102444--
Q gi|254780438|r  113 FLQNQALLTKTVARLHNLGSRIS--------------------LFADGNGNEHSLQAAKLTGADCIELYTGPYGACYN--  170 (261)
Q Consensus       113 v~~~~~~L~~~i~~l~~~girvS--------------------LFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~--  170 (261)
                      +..|-..-+++++..+..|+-|-                    ++-||+  + .++.....|.|..-.--|.---.|.  
T Consensus       111 ~eENi~~tkevv~~ah~~gvsVEaElG~~GG~Edg~~~~~~~~~~tdp~--e-a~~fv~~tgiD~LA~aiGn~HG~Yk~~  187 (286)
T COG0191         111 FEENIAITKEVVEFAHAYGVSVEAELGTLGGEEDGVVLYTDPADLTDPE--E-ALEFVERTGIDALAAAIGNVHGVYKPG  187 (286)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCHHHHCCHH--H-HHHHHHCCCCCEEEEECCCCCCCCCCC
T ss_conf             8889999999999999829818998513357567753566665507999--9-999986128665611003566678899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHH
Q ss_conf             3564336668899987665415623520789898779999973699638842599
Q gi|254780438|r  171 NPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHA  225 (261)
Q Consensus       171 ~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHa  225 (261)
                      .++-.-..|+++++...    +.|-.|-|-|..-+.+...|+ . ++.-+||.--
T Consensus       188 ~p~L~f~~L~~i~~~~~----~PlVlHGgSGip~eeI~~aI~-~-GV~KvNi~Td  236 (286)
T COG0191         188 NPKLDFDRLKEIQEAVS----LPLVLHGGSGIPDEEIREAIK-L-GVAKVNIDTD  236 (286)
T ss_pred             CCCCCHHHHHHHHHHHC----CCEEEECCCCCCHHHHHHHHH-H-CCEEEEECCH
T ss_conf             99889799999999858----987976799999999999997-2-9558854727


No 330
>PRK00962 hypothetical protein; Provisional
Probab=21.35  E-value=65  Score=13.98  Aligned_cols=128  Identities=13%  Similarity=0.153  Sum_probs=69.8

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             53335782213337889999986202696389972544441479999740661465112111024443564336668899
Q gi|254780438|r  104 QLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA  183 (261)
Q Consensus       104 elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~  183 (261)
                      |+.-+-+|++.            -++..+-.|+||   |+...++....+... =.-|+-.|+++|++.+..... ..+.
T Consensus        28 e~~~~~~~~i~------------~~~v~V~a~mFi---Pt~~gi~slL~i~~P-epd~~~~~~KaY~ee~D~~vA-~lMA   90 (164)
T PRK00962         28 EFPGDYNYSII------------NGNVSVIASMFI---PTLSGIESLLDFEPP-EPDYVFKYSKAYNEENDLLVA-KMMA   90 (164)
T ss_pred             CCCCCCCCCCC------------CCCEEEEEEECC---CCHHHHHHHHCCCCC-CCCHHHCCCHHHCCCCCHHHH-HHHH
T ss_conf             46665565412------------576589986314---628899998578899-973010201021631028999-9999


Q ss_pred             HHHHHH--HHCCCEEEECCCC------CHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             987665--4156235207898------987799999736996388425999999999409999999999997410
Q gi|254780438|r  184 ITAQLA--QKMDLQINAGHDL------TIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQHL  250 (261)
Q Consensus       184 ~aa~~A--~~lgL~VnAGHgL------n~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~~~~  250 (261)
                      ++.+--  ...|++--||=|=      +-+|. .+... .--..+.+.--=|-+--..|.+++++.+..++++..
T Consensus        91 ~avk~~~~~dIaIgTTAGIGrGaI~I~td~~~-~~~tS-Dv~adLr~~~e~i~~RQk~GI~k~l~~f~~iL~~e~  163 (164)
T PRK00962         91 EAVKNKTNCDIAIGTTAGIGRGAICIVTDKNE-YLFTS-DVYADLRIKAENILKRQKNGIEKALRTFEEILKKEY  163 (164)
T ss_pred             HHHHHHHCCCEEEECCCCCCCCEEEEEECCCE-EEEEC-CEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99988658875243244547851899837846-99741-033001467889999999789999999999986403


No 331
>COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion]
Probab=21.34  E-value=65  Score=13.97  Aligned_cols=57  Identities=21%  Similarity=0.204  Sum_probs=30.3

Q ss_pred             HHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEH-----HHHHHHHHHHH--------HHHHHHHHHHHHHHH
Q ss_conf             6654156235207898987799999736996388425-----99999999940--------999999999999741
Q gi|254780438|r  187 QLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVG-----HAFAATALECG--------VKEAVFCFRRACGQH  249 (261)
Q Consensus       187 ~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIG-----HaiIseAl~~G--------L~~aI~~~~~ii~~~  249 (261)
                      ..||.+|=..|-.||+.--=      -+|++-++|-.     .+-|++++-.+        +-++|+++++-+.-.
T Consensus       262 alaH~lG~~~~~pHG~~nAi------llP~V~~fN~~~a~~r~a~iA~~lg~~~~~~~~~~~i~~i~~L~~~lgip  331 (377)
T COG1454         262 ALAHPLGALFHIPHGLANAI------LLPYVIRFNAEAAPERYARIARALGLPGEGDAADALIDALRELLERLGIP  331 (377)
T ss_pred             HHHCCCCCCCCCCHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             86463233556840777667------56999997444228899999998299876525999999999999980999


No 332
>PRK06756 flavodoxin; Provisional
Probab=21.33  E-value=65  Score=13.97  Aligned_cols=74  Identities=9%  Similarity=0.212  Sum_probs=42.0

Q ss_pred             HHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEE---EEEECCCCCCHHHHHHHHCCCCE
Q ss_conf             689999985072128971016555333578221333788999998620269638---99725444414799997406614
Q gi|254780438|r   81 ETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRI---SLFADGNGNEHSLQAAKLTGADC  157 (261)
Q Consensus        81 ~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girv---SLFIDpd~~q~~i~~a~~~Gad~  157 (261)
                      ++|.++...+++-..   .-|+-.+=--|+|.......-...+-++|++.|.++   +|-|+=.|++..++.+.+.|.+.
T Consensus        57 ~~~~~f~~~l~~~~l---~gk~~a~FGsgD~~Yg~~g~av~~~~~~l~~~Ga~~~~~~lki~~~P~~e~~e~c~~fg~~~  133 (138)
T PRK06756         57 DDFLDFYDAMDSIDL---TGKKAAVFGSCDSAYPKYGVAVDILIEKLQERGAAVVLEGLKVELTPEDEDVEKCLQFGAEF  133 (138)
T ss_pred             HHHHHHHHHHHHCCC---CCCEEEEEECCCCCCCCCCHHHHHHHHHHHHCCCEECCCCEEEECCCCHHHHHHHHHHHHHH
T ss_conf             789999999862644---79769999337876665375799999999977996747876995289989999999999999


No 333
>TIGR00642 mmCoA_mut_beta methylmalonyl-CoA mutase, small subunit; InterPro: IPR004608   Methylmalonyl-CoA mutase (5.4.99.2 from EC) catalyses the isomerization of succinyl-CoA to methylmalonyl-CoA during the synthesis of propionate from tricarboxylic acid-cycle intermediates in propionic acid fermentation. The adenosylcobalamin-binding, catalytic chain of methylmalonyl-CoA mutase may form homodimers, as in the mitochondrion and in Escherichia coli, or heterodimers with a shorter, homologous chain that does not bind adenosylcobalamin. This family is this non-catalytic beta chain, as found in the enzyme from Propionibacterium freudenreichii, for which the 3-dimensional structure has been solved .; GO: 0004494 methylmalonyl-CoA mutase activity, 0031419 cobalamin binding, 0019652 lactate fermentation to propionate and acetate.
Probab=20.97  E-value=42  Score=15.28  Aligned_cols=163  Identities=18%  Similarity=0.191  Sum_probs=84.4

Q ss_pred             CHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH-----HHHHHHHHHCCCEEEEEE
Q ss_conf             989999999974998999824788334888999998874000136741588834856-----899999850721289710
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE-----TFLNLCERYKPEQITLVP   99 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~-----e~i~ia~~ikP~qvtLVP   99 (261)
                      +--+++.-.++-|++.+-+  |=|.-||.++-+..|-+=+.  ..-+++|+.+-.+.     -|+.+..+       .+|
T Consensus       104 ~tn~a~L~~L~~GV~sLl~--rv~~~~iapd~L~alL~dv~--L~~~~v~~~~~~d~~aa~~~~~s~y~~-------~d~  172 (642)
T TIGR00642       104 ETNEAVLDALEKGVDSLLL--RVDKSAIAPDRLAALLSDVL--LELVEVELDARIDRAAALEALLSVYVK-------KDG  172 (642)
T ss_pred             HHHHHHHHHHHCCCEEHEE--EECCCCCCHHHHHHHHCCCE--EEEEEEEEECCCCHHHHHHHHHHHHHH-------HCC
T ss_conf             8999999984035120002--63443458757998732100--121345320167712579999999986-------068


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHH-CCCCEEEECCCCCHHH--HHHHH---
Q ss_conf             16555333578221333788999998620269638997254444147999974-0661465112111024--44356---
Q gi|254780438|r  100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKL-TGADCIELYTGPYGAC--YNNPQ---  173 (261)
Q Consensus       100 e~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~-~Gad~VElhTG~Ya~a--~~~~~---  173 (261)
                      -.++.+.-+=|+|-.+.      .+-.=-..=+.+-+=   ++   ..+++++ =+.-.|-+-.--|.++  +...+   
T Consensus       173 ~~~~~l~~~lg~DP~~~------~l~~g~~~Pd~~v~~---~~---vr~aa~~~P~~Ra~tvda~~~hnaGA~~~~ELa~  240 (642)
T TIGR00642       173 ADADKLALDLGLDPLKK------ALLRGVAEPDLVVLA---VA---VRDAAKELPALRAVTVDAVAYHNAGATAVAELAY  240 (642)
T ss_pred             CCHHHEEEECCCCHHHH------HHHCCCCCCCHHHHH---HH---HHHHHHHCCCCEEEECCHHHHHCCCHHHHHHHHH
T ss_conf             86325146327666899------985168985100350---79---9999863887457850604322042478999999


Q ss_pred             ---HHHHHHHHHHH----HHHHHHHCCCEEEECCCCCHHHHHHHH
Q ss_conf             ---43366688999----876654156235207898987799999
Q gi|254780438|r  174 ---QERIFLNKLAI----TAQLAQKMDLQINAGHDLTIQNIPNLI  211 (261)
Q Consensus       174 ---~~~~el~~i~~----aa~~A~~lgL~VnAGHgLn~~Nl~~~i  211 (261)
                         .....+.++.+    ..+.+..+...+-|||| -|-.+++|-
T Consensus       241 alA~gaeylr~Lte~G~~~~ea~~~I~Fr~~a~~d-qFm~iAk~R  284 (642)
T TIGR00642       241 ALAAGAEYLRKLTEAGYKAEEALSRIKFRLAADDD-QFMTIAKLR  284 (642)
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCC-HHHHHHHHH
T ss_conf             99999999999985688378887314211013750-478999999


No 334
>TIGR02050 gshA_cyan_rel uncharacterized enzyme; InterPro: IPR011793    This family represents a division of a larger family, the other branch of which is predicted to act as glutamate--cysteine ligase (the first of two enzymes in glutathione biosynthesis) in the cyanobacteria. Species containing this protein, however, are generally not believed to make glutathione, and the function is unknown..
Probab=20.81  E-value=67  Score=13.90  Aligned_cols=80  Identities=16%  Similarity=0.085  Sum_probs=43.8

Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             57822133378899999862026963899725444414799997406614651121110244435643366688999876
Q gi|254780438|r  108 DHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQ  187 (261)
Q Consensus       108 egGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa~  187 (261)
                      .+|.|+....+.-..++..+++.       +..+|--  -+..+|+-=..||+=||++........+..   .--..+..
T Consensus        13 ~~~~d~~~~~~~~~~~~~~~~~~-------~~~~PGG--y~~~~E~~~~~vE~at~v~~~~~eA~~~~~---~~r~~l~~   80 (297)
T TIGR02050        13 PHTYDLAASSDEAAALVGECREK-------LGEDPGG--YEFKKELFESQVELATPVCTTLAEALAELR---EVRARLVE   80 (297)
T ss_pred             CCCCCCCCCCHHHHHHHHCCCCC-------CCCCCCC--CCCCHHHHHCEEEEECCCCCCHHHHHHHHH---HHHHHHHH
T ss_conf             56788766610489998607741-------1368886--320422221444465684478789999999---99999999


Q ss_pred             HHHHCCCEEEEC
Q ss_conf             654156235207
Q gi|254780438|r  188 LAQKMDLQINAG  199 (261)
Q Consensus       188 ~A~~lgL~VnAG  199 (261)
                      +|.+.||++-++
T Consensus        81 ~A~~~G~~~~~~   92 (297)
T TIGR02050        81 AASDLGLRIAAA   92 (297)
T ss_pred             HHHHCCCEEEEC
T ss_conf             986648636513


No 335
>pfam04481 DUF561 Protein of unknown function (DUF561). Protein of unknown function found in a cyanobacterium, and the chloroplasts of algae.
Probab=20.58  E-value=68  Score=13.87  Aligned_cols=102  Identities=18%  Similarity=0.122  Sum_probs=57.7

Q ss_pred             HHHHH---HCCCCEEEECCCCCHHHHHHHHHHHH--HHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             99997---40661465112111024443564336--66889998766541562352078989877999997369963884
Q gi|254780438|r  147 LQAAK---LTGADCIELYTGPYGACYNNPQQERI--FLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEIS  221 (261)
Q Consensus       147 i~~a~---~~Gad~VElhTG~Ya~a~~~~~~~~~--el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~Evs  221 (261)
                      +++|.   +.|+|.|----|.-+.-+.......+  ...-+..+....+...+-|-.--||+--+.+--++  -+-.-|-
T Consensus       135 v~LA~~L~~~GaDiIQTEGgtss~p~~~g~~glIekaapTLAaay~IS~~v~vPVlcASGlS~vT~PmAia--aGAsGVG  212 (243)
T pfam04481       135 INLAKQLESLGIDLIQTEGKITSISKNHCVNDLIEKSASTLASTYEISKHVQLPVICASGLSDVTVPLAFS--YGASGIG  212 (243)
T ss_pred             HHHHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCHHHHHHHHH--CCCCCCC
T ss_conf             99999999818877872898777888842577798875889999999861787667546764214788997--4877100


Q ss_pred             EHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             25999999999409999999999997410
Q gi|254780438|r  222 VGHAFAATALECGVKEAVFCFRRACGQHL  250 (261)
Q Consensus       222 IGHaiIseAl~~GL~~aI~~~~~ii~~~~  250 (261)
                      ||-++=-=.=...|-..|+..++.++.++
T Consensus       213 VGSavn~Lnd~~aMva~vr~l~~al~~s~  241 (243)
T pfam04481       213 IGSAVSKLNDIEKMVNYISEIKKAISGTR  241 (243)
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             65776500249999999999999973386


No 336
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family. DERA belongs to the class I aldolases and catalyzes a reversible aldol reaction between acetaldehyde and glyceraldehyde 3-phosphate to generate 2-deoxyribose 5-phosphate. DERA is unique in catalyzing the aldol reaction between two aldehydes, and its broad substrate specificity confers considerable utility as a biocatalyst, offering an environmentally benign alternative to chiral transition metal catalysis of the asymmetric aldol reaction.
Probab=20.44  E-value=68  Score=13.85  Aligned_cols=168  Identities=13%  Similarity=0.147  Sum_probs=90.2

Q ss_pred             CCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEE-EEEECCC----HH----HHHHHHHHCC
Q ss_conf             6899899999999749989998247883348889999988740001367415-8883485----68----9999985072
Q gi|254780438|r   22 PWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAEL-NIEGYPN----ET----FLNLCERYKP   92 (261)
Q Consensus        22 ~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~el-NiEg~p~----~e----~i~ia~~ikP   92 (261)
                      ...++.+++..|.++|...+.|.|         ..|...++.+...  ++.. -.=+.|.    .+    -.+.+.+---
T Consensus        15 T~~~i~~l~~~A~~~~~aaVcV~p---------~~v~~a~~~L~~s--~v~v~tvigFP~G~~~~~~K~~E~~~ai~~GA   83 (203)
T cd00959          15 TEEDIRKLCDEAKEYGFAAVCVNP---------CFVPLAREALKGS--GVKVCTVIGFPLGATTTEVKVAEAREAIADGA   83 (203)
T ss_pred             CHHHHHHHHHHHHHHCCEEEEECH---------HHHHHHHHHHCCC--CCCEEEEECCCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             999999999999875983999899---------9999999984489--97267771689998868789999999998299


Q ss_pred             CEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEE---EECCCCCCHHHHHHHHCCCCEEEECCCCCHHHH
Q ss_conf             12897101655533357822133378899999862026963899---725444414799997406614651121110244
Q gi|254780438|r   93 EQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISL---FADGNGNEHSLQAAKLTGADCIELYTGPYGACY  169 (261)
Q Consensus        93 ~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSL---FIDpd~~q~~i~~a~~~Gad~VElhTG~Ya~a~  169 (261)
                      +-+-+|+.-..-+  +|-|+..  .+.++.+.+..+..-.+|=|   .++.+--.+..+.+.+.|+|.|---||.....-
T Consensus        84 dEiD~Vin~~~~~--~g~~~~v--~~ei~~v~~~~~~~~lKVIlEt~~L~~~ei~~a~~~a~~aGadfvKTSTG~~~~ga  159 (203)
T cd00959          84 DEIDMVINIGALK--SGDYEAV--YEEIAAVVEACGGAPLKVILETGLLTDEEIIKACEIAIEAGADFIKTSTGFGPGGA  159 (203)
T ss_pred             CEEEEECCHHHHH--CCHHHHH--HHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEECCCCCCCCC
T ss_conf             8777512399996--0709999--99999998762888269997446599999999999999829788971588688998


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHH
Q ss_conf             4356433666889998766541562352078989877999997
Q gi|254780438|r  170 NNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLIN  212 (261)
Q Consensus       170 ~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~  212 (261)
                       ....  .  .-+.++..  ...|++.--|=- +++....++.
T Consensus       160 -t~e~--v--~~m~~~~~--~~~giKasGGIr-t~~~a~~~l~  194 (203)
T cd00959         160 -TVED--V--KLMKEAVG--GRVGVKAAGGIR-TLEDALAMIE  194 (203)
T ss_pred             -CHHH--H--HHHHHHHC--CCCEEECCCCCC-CHHHHHHHHH
T ss_conf             -9999--9--99999838--786077158979-9999999998


No 337
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional
Probab=20.40  E-value=68  Score=13.84  Aligned_cols=171  Identities=15%  Similarity=0.098  Sum_probs=94.5

Q ss_pred             CHHHHHHHHHHCCCCEEEE----ECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEEE-E
Q ss_conf             9899999999749989998----2478833488899999887400013674158883485689999985072128971-0
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTV----HPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLV-P   99 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITv----H~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtLV-P   99 (261)
                      +-++.+....++|.+-|-+    ||+-=--..-..++.  +. +. ..+++.+ .-..|+..=++.+.+...+.++++ |
T Consensus        27 ~K~~ia~~L~~~Gv~~IEvgsfvspk~vP~~~d~~ev~--~~-i~-~~~~~~~-~~l~~n~~g~~~A~~~g~~~i~i~~~  101 (287)
T PRK05692         27 DKIALIDRLSAAGLSYIEVASFVSPKWVPQMADAAEVM--AG-IQ-RRPGVTY-AALTPNLKGLEAALAAGADEVAVFAS  101 (287)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCHHHCCHHHHH--HH-HH-CCCCCEE-EEECCCHHHHHHHHHCCCCEEEEEEE
T ss_conf             99999999998499999966877823021316799999--87-64-0679678-66436404279999779898999974


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEC------------CCCCCHHHHHHHHCCCCEEEE-CCCCCH
Q ss_conf             1655533357822133378899999862026963899725------------444414799997406614651-121110
Q gi|254780438|r  100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFAD------------GNGNEHSLQAAKLTGADCIEL-YTGPYG  166 (261)
Q Consensus       100 e~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFID------------pd~~q~~i~~a~~~Gad~VEl-hTG~Ya  166 (261)
                      -...-....-+.......+.++++++..++.|+++..++.            |+.-...++.+.+.|+|+|-| =|=-|+
T Consensus       102 ~Sd~h~~~nl~~t~~e~l~~~~~~i~~a~~~g~~v~~~i~~afg~p~~~~~~~~~l~~~~~~~~~~Ga~~I~laDT~G~a  181 (287)
T PRK05692        102 ASEAFSQKNINCSIAESLARFEPVAEAAKQAGVRVRGYVSCVLGCPYEGEVPPEAVADVAERLFALGCDEISLGDTIGVG  181 (287)
T ss_pred             CCHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCCCCCCC
T ss_conf             17999998747999999999999999999769879998740136764686489999999999985799785447655666


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEC--CCCCHHHH
Q ss_conf             244435643366688999876654156235207--89898779
Q gi|254780438|r  167 ACYNNPQQERIFLNKLAITAQLAQKMDLQINAG--HDLTIQNI  207 (261)
Q Consensus       167 ~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAG--HgLn~~Nl  207 (261)
                          .|.+....+..+++..   ....+.+|.=  .||-.-|.
T Consensus       182 ----~P~~v~~~i~~v~~~~---~~~~i~~H~Hnd~Gma~AN~  217 (287)
T PRK05692        182 ----TPGQVRRVLEAVLAEF---PAERLAGHFHDTYGQALANI  217 (287)
T ss_pred             ----CHHHHHHHHHHHHHHC---CCCCEEEEECCCCCHHHHHH
T ss_conf             ----9999999999999866---88723567448730699999


No 338
>PRK09358 adenosine deaminase; Provisional
Probab=20.34  E-value=68  Score=13.84  Aligned_cols=109  Identities=15%  Similarity=0.106  Sum_probs=53.6

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHC-CCCCEEEEEECCCCCC------HHHHHHHHCC---CCEEEECCCCCHHHHHHHHH
Q ss_conf             333578221333788999998620-2696389972544441------4799997406---61465112111024443564
Q gi|254780438|r  105 LTSDHGWDFLQNQALLTKTVARLH-NLGSRISLFADGNGNE------HSLQAAKLTG---ADCIELYTGPYGACYNNPQQ  174 (261)
Q Consensus       105 lTTegGldv~~~~~~L~~~i~~l~-~~girvSLFIDpd~~q------~~i~~a~~~G---ad~VElhTG~Ya~a~~~~~~  174 (261)
                      ..+..|+......+-+...++... +.||.+.+-+..+..+      ..++.|.+.-   +-.|-|.-.+          
T Consensus       102 ~~~~~gl~~~~~~~~i~~~~~~a~~~~~i~~~lI~~~~R~~~~e~a~~~~~~a~~~~~~~vvGidl~G~E----------  171 (333)
T PRK09358        102 LHTERGLPLEEVVEAVLDGLRDAEADFGISARLILCFLRHFGEEAALETLELALRFRDRGVVGFDLAGDE----------  171 (333)
T ss_pred             HHHCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCC----------
T ss_conf             8750588667789999999998786469669999985567999999999999985347877984356876----------


Q ss_pred             HHHHHHHHHHHHHHHHHC--CCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHH
Q ss_conf             336668899987665415--6235207898987799999736996388425999
Q gi|254780438|r  175 ERIFLNKLAITAQLAQKM--DLQINAGHDLTIQNIPNLINAIPYISEISVGHAF  226 (261)
Q Consensus       175 ~~~el~~i~~aa~~A~~l--gL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHai  226 (261)
                      ...-...+..+.++|++.  ++.+|||-.-.-+|+...+.   .+.-==|||.+
T Consensus       172 ~~~~~~~f~~~f~~ar~~gl~~t~HaGE~~~~~~i~~ai~---~l~a~RIGHGv  222 (333)
T PRK09358        172 LGFPPSKFARAFDIARDAGLRLTAHAGEAGGPESIWEALD---ELGADRIGHGV  222 (333)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHH---HCCCCEECCCE
T ss_conf             7898687999999999859923330688898499999998---42876423503


No 339
>pfam04748 Polysacc_deac_2 Divergent polysaccharide deacetylase. This family is divergently related to pfam01522 (personal obs:Yeats C).
Probab=20.23  E-value=69  Score=13.82  Aligned_cols=169  Identities=19%  Similarity=0.219  Sum_probs=101.3

Q ss_pred             CCCCHHHHHHHHHHCCCCEEEEEC-CCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH--HHHHHHHHHCCCEEEEE
Q ss_conf             689989999999974998999824-788334888999998874000136741588834856--89999985072128971
Q gi|254780438|r   22 PWPNLVHIGKIALQSGASGLTVHP-RPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE--TFLNLCERYKPEQITLV   98 (261)
Q Consensus        22 ~~P~~~~~a~~~~~~GadgITvH~-R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~--e~i~ia~~ikP~qvtLV   98 (261)
                      +.|+..+.|..+-++|-.- -+|+ =|-. +  +.|.           ..-.+...|.+.+  ..+.-+++--|..+-+ 
T Consensus        30 ~~~~~~~~a~~a~~~g~Ev-llhlPMe~~-~--~~~~-----------gp~~L~~~~~~~~i~~~l~~~l~~~p~avGv-   93 (213)
T pfam04748        30 YAPHAAELAEAARAAGHEV-LLHLPMEPL-G--YKDP-----------GPGTLTVGMSAEEIEKRLEAALSRVPYAVGV-   93 (213)
T ss_pred             CCCCHHHHHHHHHHCCCEE-EEECCCCCC-C--CCCC-----------CCCCCCCCCCHHHHHHHHHHHHHHCCCCEEE-
T ss_conf             9986699999999879949-997456634-6--8999-----------9775888999999999999999878884899-


Q ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCC--CHHHHHHHHCCCCEEEECCCCCHHHHHHHH-HH
Q ss_conf             016555333578221333788999998620269638997254444--147999974066146511211102444356-43
Q gi|254780438|r   99 PDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGN--EHSLQAAKLTGADCIELYTGPYGACYNNPQ-QE  175 (261)
Q Consensus        99 Pe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~--q~~i~~a~~~Gad~VElhTG~Ya~a~~~~~-~~  175 (261)
                             +.-=|=-+..+...+..+.+.|++.|.   .|+|.-.+  -..-..|++.|..+.+-.      .|-++. ..
T Consensus        94 -------nNhmGS~~t~~~~~m~~vl~~l~~~gl---~fvDS~Tt~~S~a~~~A~~~gvp~~~rd------vfLD~~~~~  157 (213)
T pfam04748        94 -------NNHMGSRFTADRAAMRWVMEELKKRGL---FFVDSRTSGRSVAPKLAKELGVPAAKRD------VFLDNEQTE  157 (213)
T ss_pred             -------ECCCCCCCCCCHHHHHHHHHHHHHCCC---EEEECCCCCCCHHHHHHHHCCCCEEEEE------EECCCCCCH
T ss_conf             -------546675541699999999999987798---8991477766589999998399867610------314799999


Q ss_pred             HHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEH
Q ss_conf             366688999876654156235207898987799999736996388425
Q gi|254780438|r  176 RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVG  223 (261)
Q Consensus       176 ~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIG  223 (261)
                      ..-..++.++++.|+..|--|--||- .-+++..+...+|.+++-.|-
T Consensus       158 ~~I~~ql~~~~~~A~~~G~aI~Igh~-~p~Tl~~L~~~~~~l~~~gi~  204 (213)
T pfam04748       158 AAIRRQLDQAAALARKEGSAIAIGHP-HPETIAALKEWLPELRARGIE  204 (213)
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEECC-CHHHHHHHHHHHHHHHHCCEE
T ss_conf             99999999999999863957999779-989999999986577658879


No 340
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain. LMO is a FMN-containing enzyme that catalyzes the conversion of L-lactate and oxygen to acetate, carbon dioxide, and water. LMO is a member of the family of alpha-hydroxy acid oxidases.  It is thought to be a homooctamer with two- and four- fold axes in the center of the octamer.
Probab=20.06  E-value=69  Score=13.80  Aligned_cols=102  Identities=19%  Similarity=0.135  Sum_probs=56.7

Q ss_pred             HHHHHHHCCCCEEEE--CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHH-HHHHHHHCCCCEEEEE
Q ss_conf             799997406614651--1211102444356433666889998766541562352078989877-9999973699638842
Q gi|254780438|r  146 SLQAAKLTGADCIEL--YTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQN-IPNLINAIPYISEISV  222 (261)
Q Consensus       146 ~i~~a~~~Gad~VEl--hTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~N-l~~~i~~Ip~I~EvsI  222 (261)
                      +-..|.+.|+|.|=+  |-|.--+.  .+.-. ..|..|++    |..-.+.|-.-=|.-.-. +-+.++ +. -+=|-|
T Consensus       266 DA~~A~~~G~dgIiVSNHGGRQLD~--apa~i-~~LpeI~~----aV~~~~~V~~DgGIRrG~DV~KAlA-LG-A~~V~i  336 (383)
T cd03332         266 DARRAVEAGVDGVVVSNHGGRQVDG--SIAAL-DALPEIVE----AVGDRLTVLFDSGVRTGADIMKALA-LG-AKAVLI  336 (383)
T ss_pred             HHHHHHHCCCCEEEEECCCCCCCCC--CCCHH-HHHHHHHH----HHCCCCEEEEECCCCCHHHHHHHHH-CC-CCEEEE
T ss_conf             9999997599889980786344678--83278-99999999----8479984999799786799999997-69-998987


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             59999999994099999999999974105655403
Q gi|254780438|r  223 GHAFAATALECGVKEAVFCFRRACGQHLDNTMRLT  257 (261)
Q Consensus       223 GHaiIseAl~~GL~~aI~~~~~ii~~~~~~~~~~~  257 (261)
                      |-..+ -++-.|=++-|..+++++++-.+.+|+++
T Consensus       337 GRp~l-~glaa~G~~GV~~~l~iL~~El~~~M~l~  370 (383)
T cd03332         337 GRPYA-YGLALGGEDGVEHVLRNLLAELDLTMGLA  370 (383)
T ss_pred             CHHHH-HHHHHCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             78999-98772319999999999999999999985


Done!