HHsearch alignment for GI: 254780438 and conserved domain: pfam03932

>pfam03932 CutC CutC family. Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF. A mutation in one or more of these genes results in an increased copper sensitivity. Members of this family are between 200 and 300 amino acids in length are found in both eukaryotes and bacteria.
Probab=93.43  E-value=0.85  Score=26.98  Aligned_cols=172  Identities=19%  Similarity=0.181  Sum_probs=103.9

Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCH-----------HHH---HHHHHHCC
Q ss_conf             9999999974998999824788334888999998874000136741588834856-----------899---99985072
Q gi|254780438|r   27 VHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNE-----------TFL---NLCERYKP   92 (261)
Q Consensus        27 ~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~-----------e~i---~ia~~ikP   92 (261)
T Consensus        10 ~~~a~~A~~~GAdRIELCs~L~~GGlTP-s~~~i~~~~~~--~~ipv~vMIRPR~G~F~Ys~~E~~~M~~dI~~~~~~G~   86 (202)
T pfam03932        10 IESLLAAQAGGADRVELCANLAVGGLTP-SYGVIKSAAQR--AKIPVYVMIRPRGGDFVYSDHELKAMLEDILKAVELGA   86 (202)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCCC-CHHHHHHHHHH--CCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             9999999984999998626766689798-99999999986--59974999842799886498999999999999998698


Q ss_pred             CEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEC--CCCCCHHHHHHHHCCCCEEEECCCCCHHHHH
Q ss_conf             12897101655533357822133378899999862026963899725--4444147999974066146511211102444
Q gi|254780438|r   93 EQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFAD--GNGNEHSLQAAKLTGADCIELYTGPYGACYN  170 (261)
Q Consensus        93 ~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFID--pd~~q~~i~~a~~~Gad~VElhTG~Ya~a~~  170 (261)
T Consensus        87 ~GvV~-----G~L~~d~~iD~~----~~~~li~~a~~l~~TFHRAfD~~~d~~-~al~~L~~lG~~rILTSGg~-~~a~~  155 (202)
T pfam03932        87 PGVVL-----GALTADGEIDTK----RMEKLIEAAGGLGVTFHRAFDMCPDPE-EALEQLIELGCERVLTSGGP-LSALE  155 (202)
T ss_pred             CEEEE-----EEECCCCCCCHH----HHHHHHHHHCCCCEEEECHHHCCCCHH-HHHHHHHHCCCCEEECCCCC-CCHHH
T ss_conf             97899-----888899982999----999999974688559862043059999-99999997599878757997-87667


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEE
Q ss_conf             356433666889998766541562352078989877999997369963884
Q gi|254780438|r  171 NPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEIS  221 (261)
Q Consensus       171 ~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~Evs  221 (261)
T Consensus       156 g-------~~~L~~l~~~a~~-~i~Im~GgGI~~~N~~~l~~-~~g~~~~H  197 (202)
T pfam03932       156 G-------LEKLASLVAQAGG-RISIMAGAGVNAENIAELRQ-LTGVAEVH  197 (202)
T ss_pred             H-------HHHHHHHHHHCCC-CEEEEECCCCCHHHHHHHHH-HHCCCEEE
T ss_conf             4-------9999999996599-84999579989999999999-71994885