HHsearch alignment of GI: 254780438 and MMDB domain: 3c6c_A_

>3c6c_A (A:) 3-keto-5-aminohexanoate cleavage enzyme; YP_293392.1, prokaryotic protein of unknown function (DUF849), structural genomics; HET: MSE; 1.72A {Ralstonia eutropha JMP134}
Probab=96.69  E-value=0.025  Score=37.11  Aligned_cols=141  Identities=18%  Similarity=0.150  Sum_probs=97.4

Q ss_pred             CHHHHHHHHHHCCCCEEEEECCC--CCCCCCHHHHHH-HHHHHCCCCCCCEEEEEE----------------------CC
Q ss_conf             98999999997499899982478--833488899999-887400013674158883----------------------48
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTVHPRP--DQRHIRYTDLPE-IRRLIDEQFPKAELNIEG----------------------YP   79 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITvH~R~--DrRHI~~~Dv~~-l~~~~~~~~~~~elNiEg----------------------~p   79 (261)
                      .+++.|..|.++||.-+-+|+|.  |-||-.|-|.+. +-.-+....+++-+|+--                      -+
T Consensus        49 EIa~~A~~c~~AGAaivHlH~Rd~~dG~~s~d~~~y~eii~~IR~~~pd~ii~~TTg~~g~~~~~~~~~~~~~~~~~~~~  128 (316)
T 3c6c_A           49 QIADACVEAAKAGASVAHIHVRDPKTGGGSRDPVLFKEVVDRVRSSGTDIVLNLTCGLGAFLLPDPEDESKALPESDVVP  128 (316)
T ss_dssp             HHHHHHHHHHHHTCSEEEECEECTTTCCEECCHHHHHHHHHHHHTTTCCCEEEEECCCSEEECEETTEEEEECTTCEECC
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHCCCCCCCCC
T ss_conf             99999999998187389987558888996789999999999999873880798468756566777011110247767788


Q ss_pred             CHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHC------
Q ss_conf             56899999850721289710165553335782213337889999986202696389972544441479999740------
Q gi|254780438|r   80 NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLT------  153 (261)
Q Consensus        80 ~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~------  153 (261)
                      .++=+......+|+.++|=.-..+.......--+......+..+...+++.||++++=+. |+..  +..+..+      
T Consensus       129 ~~~r~~~~~~~~Pd~asl~~g~~n~~~~~~~~v~~n~~~~~~~~~~~~~e~gi~pe~evf-d~g~--l~~~~~l~~~Gll  205 (316)
T 3c6c_A          129 VAERVKHLEDCLPEIASLDITTGNQVEGKLEFVYLNTTRTLRAXARRFQELGIKPELEVF-SPGD--ILFGKQLIEEGLI  205 (316)
T ss_dssp             HHHHTHHHHHHCCSEEEEECCCEEEEETTEEEEECCCHHHHHHHHHHHHHHTCEEEEEES-SHHH--HHHHHHHHHTTCS
T ss_pred             HHHHHHCHHHCCCCCCCCCCCCCCCCCCCCCCEECCCHHHHHHHHHHHHHCCCEEEEEEE-CHHH--HHHHHHHHHCCCC
T ss_conf             999861512058660024666554223554403428878878999999973984699996-6499--9999999865887


Q ss_pred             -CCCEEEECCCCCHHH
Q ss_conf             -661465112111024
Q gi|254780438|r  154 -GADCIELYTGPYGAC  168 (261)
Q Consensus       154 -Gad~VElhTG~Ya~a  168 (261)
                       +.-.+.|.-|.|.-.
T Consensus       206 ~~p~~~~~vlG~~~g~  221 (316)
T 3c6c_A          206 DGVPLFQXVLGVLWGA  221 (316)
T ss_dssp             CSSCEEEEECSCTTSC
T ss_pred             CCCCEEEEECCCCCCC
T ss_conf             8973688731446667