HHsearch alignment of GI: 254780438 and MMDB domain: 3e49_A_

>3e49_A (A:) Uncharacterized protein DUF849 with A TIM barrel fold; YP_556190.1; HET: MSE; 1.75A {Burkholderia xenovorans LB400}
Probab=96.61  E-value=0.077  Score=33.70  Aligned_cols=135  Identities=19%  Similarity=0.188  Sum_probs=92.1

Q ss_pred             HHHHHHHHHHCCCCEEEEECCC--CCCCCCHHHHH-----HHHHHHCCCCCCCEEEEE--ECC---CHHHHHHHHHHCCC
Q ss_conf             8999999997499899982478--83348889999-----988740001367415888--348---56899999850721
Q gi|254780438|r   26 LVHIGKIALQSGASGLTVHPRP--DQRHIRYTDLP-----EIRRLIDEQFPKAELNIE--GYP---NETFLNLCERYKPE   93 (261)
Q Consensus        26 ~~~~a~~~~~~GadgITvH~R~--DrRHI~~~Dv~-----~l~~~~~~~~~~~elNiE--g~p---~~e~i~ia~~ikP~   93 (261)
                      +.+.|..|.++||.-+-+|.|.  |.+|-.|-+++     .+++-|     +.-+|+-  +..   .++-+..+...+|+
T Consensus        34 ia~~a~~c~~AGAsivHlH~Rd~~dG~~s~d~~~y~eii~~IR~~~-----d~ii~~TTgg~~~~~~e~r~~~v~~~~Pd  108 (311)
T 3e49_A           34 VAQASIGAAEAGAAVIHLHARDPRDGRPTQDPAAFAEFLPRIKSNT-----DAVINLTTGGSPHXTVEERLRPATHYXPE  108 (311)
T ss_dssp             HHHHHHHHHHHTCSEEEECEECTTTCCEECCHHHHTTHHHHHHHHC-----CCEEEECSCSCTTSCHHHHHHHHHHHCCS
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHC-----CCEEEECCCCCCCCCHHHHHHHHHHHCCC
T ss_conf             9999999998187389977357777990789999999999998608-----96354035788888667777889874202


Q ss_pred             EEEEEECC-----CCCCCCCCCCC---------------HHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHC
Q ss_conf             28971016-----55533357822---------------13337889999986202696389972544441479999740
Q gi|254780438|r   94 QITLVPDD-----PHQLTSDHGWD---------------FLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLT  153 (261)
Q Consensus        94 qvtLVPe~-----r~elTTegGld---------------v~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~  153 (261)
                      ++++=+=.     ..+.....+|.               +......+..+...+++.||++++=+. |+.  .+..+..+
T Consensus       109 ~aS~~~gs~nf~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~n~~~~~~~~~~~~~e~gi~pe~ei~-d~g--~l~~~~~l  185 (311)
T 3e49_A          109 LASLNXGSXNFGLYPXLERFKEFAHGWEREHLERSRDLVFKNTFADIEFILKTCGGNGTRFEFECY-DTS--HLYNLAHF  185 (311)
T ss_dssp             EEEEECSCEECCCGGGGGTCCCCSSHHHHHHHHGGGGCEECCCHHHHHHHHHHHHTTTCEEEEEEC-SHH--HHHHHHHH
T ss_pred             EEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEECCCHHHHHHHHHHHHHCCCCEEEEEE-CHH--HHHHHHHH
T ss_conf             331233566766422555532112332034441366626328999999999999974985059995-389--99999999


Q ss_pred             -------CCCEEEECCCCCHHH
Q ss_conf             -------661465112111024
Q gi|254780438|r  154 -------GADCIELYTGPYGAC  168 (261)
Q Consensus       154 -------Gad~VElhTG~Ya~a  168 (261)
                             +.-.+-|.-|.|.-.
T Consensus       186 ~~~Gll~~p~~~~~vlG~~~g~  207 (311)
T 3e49_A          186 VDRKLATPPFFVQTVFGLLGGI  207 (311)
T ss_dssp             HHTTCSCSSEEEEEEESCTTSC
T ss_pred             HHCCCCCCCCEEEEEECCCCCC
T ss_conf             9757778996599995246666