HHsearch results for GI: 254780438 and protein with PDBid: 2fli_A

>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2
Probab=95.06  E-value=0.11  Score=31.66  Aligned_cols=164  Identities=15%  Similarity=0.165  Sum_probs=106.2

Q ss_pred             CCCCCCHHHHHHHHCCCCCCC--------CHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             533221443223220788689--------989999999974998999824788334888999998874000136741588
Q gi|254780438|r    4 SVSVNLNAVAVLRNRRNLPWP--------NLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNI   75 (261)
Q Consensus         4 ~LsVNidhiAtLRnaRg~~~P--------~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNi   75 (261)
                      .++...+.+..+|+-  .+.|        +|........++|||-||+|..-.. + -.+.+..+++    .  +.+.-+
T Consensus        45 n~t~g~~~i~~i~~~--t~~~~dvHLMv~~P~~~i~~~~~~g~d~I~~H~E~~~-~-~~~~i~~i~~----~--g~~~Gl  114 (220)
T 2fli_A           45 NISFGADVVASMRKH--SKLVFDCHLMVVDPERYVEAFAQAGADIMTIHTESTR-H-IHGALQKIKA----A--GMKAGV  114 (220)
T ss_dssp             CBCBCHHHHHHHHTT--CCSEEEEEEESSSGGGGHHHHHHHTCSEEEEEGGGCS-C-HHHHHHHHHH----T--TSEEEE
T ss_pred             CCCCCHHHHHHHHHC--CCCCEEEEEECCCHHHHHHHHHHCCCCEEEECHHHHC-C-HHHHHHHHHH----C--CCEEEE
T ss_conf             547499999988636--8976799985179888899998659978995323320-8-8999999987----6--986999


Q ss_pred             EECCCHHHHHHHHHH-CCCEEEEEECCCCCCCCCCCCCHH-HHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHC
Q ss_conf             834856899999850-721289710165553335782213-337889999986202696389972544441479999740
Q gi|254780438|r   76 EGYPNETFLNLCERY-KPEQITLVPDDPHQLTSDHGWDFL-QNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLT  153 (261)
Q Consensus        76 Eg~p~~e~i~ia~~i-kP~qvtLVPe~r~elTTegGldv~-~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~  153 (261)
                      -.+|...+-.+..-. .-++|.+.--.|+    -+|..+. ...++++...+.+.+.+..+.+-+|-..+...+....+.
T Consensus       115 al~p~T~~~~~~~~l~~vd~vlvM~V~pG----~~Gq~f~~~~~~ki~~l~~~~~~~~~~~~I~vDGGin~~~i~~l~~~  190 (220)
T 2fli_A          115 VINPGTPATALEPLLDLVDQVLIMTVNPG----FGGQAFIPECLEKVATVAKWRDEKGLSFDIEVDGGVDNKTIRACYEA  190 (220)
T ss_dssp             EECTTSCGGGGGGGTTTCSEEEEESSCTT----CSSCCCCGGGHHHHHHHHHHHHHTTCCCEEEEESSCCTTTHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHCCEEEEEEECCC----CCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHC
T ss_conf             96487640366616755087989887566----46655540578999999999975299706998467788879999987


Q ss_pred             CCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             661465112111024443564336668899987
Q gi|254780438|r  154 GADCIELYTGPYGACYNNPQQERIFLNKLAITA  186 (261)
Q Consensus       154 Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa  186 (261)
                      |||.+=.=++    .|+.+. ....+.+++.+.
T Consensus       191 Gad~~V~GS~----if~~~d-~~~~i~~Lr~~l  218 (220)
T 2fli_A          191 GANVFVAGSY----LFKASD-LVSQVQTLRTAL  218 (220)
T ss_dssp             TCCEEEESHH----HHTSSC-HHHHHHHHHHHH
T ss_pred             CCCEEEECHH----HHCCCC-HHHHHHHHHHHH
T ss_conf             9999997858----868999-999999999974