BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780438|ref|YP_003064851.1| pyridoxine 5'-phosphate
synthase [Candidatus Liberibacter asiaticus str. psy62]
         (261 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|53715251|ref|YP_101243.1| pyridoxine 5'-phosphate synthase [Bacteroides fragilis YCH46]
 gi|60683185|ref|YP_213329.1| pyridoxine 5'-phosphate synthase [Bacteroides fragilis NCTC 9343]
 gi|253566383|ref|ZP_04843837.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_2_5]
 gi|265767081|ref|ZP_06094910.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 2_1_16]
 gi|81313762|sp|Q5L912|PDXJ_BACFN RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|91207220|sp|Q3V814|PDXJ_BACFR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|52218116|dbj|BAD50709.1| pyridoxal phosphate biosynthetic protein PdxJ [Bacteroides fragilis
           YCH46]
 gi|60494619|emb|CAH09420.1| putative pyridoxine biosynthesis protein [Bacteroides fragilis NCTC
           9343]
 gi|251945487|gb|EES85925.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_2_5]
 gi|263253458|gb|EEZ24934.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 2_1_16]
 gi|301164705|emb|CBW24264.1| putative pyridoxine biosynthesis protein [Bacteroides fragilis
           638R]
          Length = 237

 Score =  271 bits (692), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 138/246 (56%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    PN+V +       GA G+TVHPRPD+RHIR +D+ ++R
Sbjct: 1   MTKLSVNINKVATLRNARGGNVPNVVKVALDCESFGADGITVHPRPDERHIRRSDVYDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP+  F++L  + KP Q+TLVPDDP Q+TS+ GWD   N   LT
Sbjct: 61  P-----LLRTEFNIEGYPSPEFIDLVLKVKPHQVTLVPDDPSQITSNSGWDTKVNFDFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +   +  G R S+F     +   ++ A   GAD +ELYT PY   Y       +    
Sbjct: 116 EVLDEFNGAGIRTSVFVAP--DAEMIEYAAKAGADRVELYTEPYATAYPKDPAAAVA--P 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+ A+++ + +NAGHDL++ N+      IP++ E+S+GHA  + AL  G++  +  
Sbjct: 172 FVEAAKAARRLGIGLNAGHDLSLLNLNYFYKNIPWLDEVSIGHALISDALYLGLERTIQE 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKNCLR 237


>gi|86606908|ref|YP_475671.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. JA-3-3Ab]
 gi|123505418|sp|Q2JSG7|PDXJ_SYNJA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|86555450|gb|ABD00408.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           JA-3-3Ab]
          Length = 245

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 133/246 (54%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ VA LR  R    P+ V    IA  +GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MLSLGVNIDHVATLRQARRTVEPDPVAAAVIAELAGADGITVHLREDRRHIQERDVRLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  +  LN+E    +  + +    KP+ +TLVP+   ++T++ G D     + L+
Sbjct: 61  -----QTVRTHLNLEMAATDEMVAIALEIKPDYVTLVPERREEVTTEGGLDVAGQVSRLS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V++L   G  +SLF D +  + +  AA   GA  +EL+TG Y    +   Q+   L +
Sbjct: 116 EVVSQLQGSGIPVSLFVDPDPIQIA--AAAQVGARWVELHTGRYAEASSE-AQQEAELAQ 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   +Q A ++ L++NAGH LT  N+   +  IP + E+++GH+  + A+  G++ AV  
Sbjct: 173 LRQASQQAIQLGLRVNAGHGLTYWNVGP-VARIPGMEELNIGHSIISRAVLVGLERAVRE 231

Query: 242 FRRACG 247
            R+A G
Sbjct: 232 MRQAMG 237


>gi|167765303|ref|ZP_02437416.1| hypothetical protein BACSTE_03691 [Bacteroides stercoris ATCC
           43183]
 gi|167696931|gb|EDS13510.1| hypothetical protein BACSTE_03691 [Bacteroides stercoris ATCC
           43183]
          Length = 237

 Score =  270 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 137/246 (55%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    PN+V +       GA G+TVHPRPD+RHIR +D+ ++R
Sbjct: 1   MTRLSVNINKVATLRNARGGNVPNVVKVALDCESFGADGITVHPRPDERHIRKSDVYDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP   F++L  + KP Q+TLVPD P QLTS+ GWD   N   LT
Sbjct: 61  P-----LLRTEFNIEGYPAPEFIDLVLKVKPHQVTLVPDSPTQLTSNSGWDTKANLEFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +   +  G R S+F     +   ++ A   GAD +ELYT PY   +    +  +    
Sbjct: 116 EVLEAFNTAGIRTSVFVS--TDAEMIEYAAKAGADRVELYTEPYATAFPKNPEAAVA--P 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+ A+ + L +NAGHDL+++N+      IP++ E+S+GHA  + AL  G++  +  
Sbjct: 172 FVEAARTARSLGLGLNAGHDLSLENLNYFYKNIPWLDEVSIGHALISDALYLGLERTIQE 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKNCLR 237


>gi|329957267|ref|ZP_08297787.1| pyridoxine 5'-phosphate synthase [Bacteroides clarus YIT 12056]
 gi|328522980|gb|EGF50083.1| pyridoxine 5'-phosphate synthase [Bacteroides clarus YIT 12056]
          Length = 237

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 138/246 (56%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    PN+V +       GA G+TVHPRPD+RHIR  D+ ++R
Sbjct: 1   MTRLSVNINKVATLRNARGGDVPNVVKVALDCENFGADGITVHPRPDERHIRKRDVFDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP   F++L  + KP Q+TLVPD P QLTS+ GWD   N   LT
Sbjct: 61  P-----LLRTEFNIEGYPAPEFIDLVLKVKPHQVTLVPDSPTQLTSNSGWDTKTNLEFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +   +  G R S+F     +   ++ A   GAD +ELYT PY   +   ++  +    
Sbjct: 116 EVLEAFNTAGIRTSVFVS--TDAEMIEYAAKAGADRVELYTEPYATAFPKGKEAAVA--P 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A++A+ + L +NAGHDL+++N+      IP++ E+S+GHA  + AL  G++  +  
Sbjct: 172 FVEAAKIARSLGLGLNAGHDLSLENLNYFYKNIPWLDEVSIGHALISDALYLGLERTIQE 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKNCLR 237


>gi|160890800|ref|ZP_02071803.1| hypothetical protein BACUNI_03245 [Bacteroides uniformis ATCC 8492]
 gi|270295799|ref|ZP_06201999.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. D20]
 gi|317479762|ref|ZP_07938884.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 4_1_36]
 gi|156859799|gb|EDO53230.1| hypothetical protein BACUNI_03245 [Bacteroides uniformis ATCC 8492]
 gi|270273203|gb|EFA19065.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. D20]
 gi|316904132|gb|EFV25964.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 4_1_36]
          Length = 237

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 93/246 (37%), Positives = 137/246 (55%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    PN+V +       GA G+TVHPRPD+RHIR  D+ ++R
Sbjct: 1   MTRLSVNINKVATLRNARGGDVPNVVKVALDCEDFGADGITVHPRPDERHIRRKDVYDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP   F++L  + KP Q+TLVPD P QLTS+ GWD   +   L 
Sbjct: 61  P-----LLRTEFNIEGYPAPEFMDLVLKVKPHQVTLVPDSPTQLTSNAGWDTKTHFDFLN 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +   +N G R S+F     +   ++ A   GAD +ELYT PY   Y   ++  +    
Sbjct: 116 EVLDEFNNAGIRTSVFVS--TDAEMIEYAAKAGADRVELYTEPYATAYPKGREAAVA--P 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A++A+ + L +NAGHDL++ N+      IP++ E+S+GHA  + AL  G++  V  
Sbjct: 172 FVEAAKVARSLGLGLNAGHDLSLVNLNYFYQNIPWLDEVSIGHALISDALYLGLERTVKE 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKNCLR 237


>gi|160883173|ref|ZP_02064176.1| hypothetical protein BACOVA_01142 [Bacteroides ovatus ATCC 8483]
 gi|237714381|ref|ZP_04544862.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides sp. D1]
 gi|260171937|ref|ZP_05758349.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. D2]
 gi|262408213|ref|ZP_06084760.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 2_1_22]
 gi|294646282|ref|ZP_06723934.1| pyridoxine 5'-phosphate synthase [Bacteroides ovatus SD CC 2a]
 gi|294806769|ref|ZP_06765596.1| pyridoxine 5'-phosphate synthase [Bacteroides xylanisolvens SD CC
           1b]
 gi|299148206|ref|ZP_07041268.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_1_23]
 gi|315920249|ref|ZP_07916489.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|156111398|gb|EDO13143.1| hypothetical protein BACOVA_01142 [Bacteroides ovatus ATCC 8483]
 gi|229445545|gb|EEO51336.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides sp. D1]
 gi|262353765|gb|EEZ02858.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 2_1_22]
 gi|292638363|gb|EFF56729.1| pyridoxine 5'-phosphate synthase [Bacteroides ovatus SD CC 2a]
 gi|294446051|gb|EFG14691.1| pyridoxine 5'-phosphate synthase [Bacteroides xylanisolvens SD CC
           1b]
 gi|298512967|gb|EFI36854.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_1_23]
 gi|313694124|gb|EFS30959.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 238

 Score =  269 bits (688), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 143/246 (58%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P++V +       GA G+TVHPRPD+RHIR +D+ ++R
Sbjct: 1   MTKLSVNINKIATLRNARGGNVPDVVKVALDCESFGADGITVHPRPDERHIRRSDVYDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP+  F++L  + KP Q+TLVPDDP Q+TS+ GWD   NQ  LT
Sbjct: 61  P-----LLRTEFNIEGYPSPEFIDLVLKVKPHQVTLVPDDPSQITSNSGWDTKANQEFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + + + ++ G R S+F     +   ++ A   GAD +ELYT PY    + P+     +  
Sbjct: 116 EVLDQFNSAGIRTSVFVAA--DPEMVEYAAKAGADRVELYTEPY--ATDYPKNPEAAIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+ A+K+ + +NAGHDL++ N+      IP++ E+S+GHA  + AL  G++  +  
Sbjct: 172 FIEAAKTARKLGIGLNAGHDLSLVNLNYFYKNIPWVDEVSIGHALISDALYLGLERTIQE 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKNCLR 237


>gi|330996644|ref|ZP_08320522.1| pyridoxine 5'-phosphate synthase [Paraprevotella xylaniphila YIT
           11841]
 gi|329572716|gb|EGG54349.1| pyridoxine 5'-phosphate synthase [Paraprevotella xylaniphila YIT
           11841]
          Length = 237

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 91/246 (36%), Positives = 141/246 (57%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    P++V +     + GA G+TVHPRPD+RHIRY D+ +++
Sbjct: 1   MTKLSVNINKVATLRNARGGNNPDVVQVALDCEKFGAQGITVHPRPDERHIRYQDVYDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++     + E NIEG P + F +L  + +P Q+TLVPD P Q+TS+ GWD  +N + LT
Sbjct: 61  AVL-----RTEFNIEGNPVDKFNDLVLKVRPTQVTLVPDAPDQITSNTGWDTKKNLSFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +      G R S+F +       ++ A   GAD +ELYT PY + Y    ++   +  
Sbjct: 116 EIIGEFKEKGIRTSVFVNA--EAEMVEYAAKAGADRVELYTEPYASAYAGSPED--AVRP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+ A+ + L +NAGHDL+++N+  +   I +I E+S+GHA    AL  G++E V  
Sbjct: 172 FVEAARTARGLGLGLNAGHDLSLENLKYMHEQIGWIDEVSIGHALICDALYLGLEETVKR 231

Query: 242 FRRACG 247
           +     
Sbjct: 232 YLECLK 237


>gi|255011375|ref|ZP_05283501.1| pyridoxine 5'-phosphate synthase [Bacteroides fragilis 3_1_12]
 gi|313149190|ref|ZP_07811383.1| pyridoxine 5'-phosphate synthase [Bacteroides fragilis 3_1_12]
 gi|313137957|gb|EFR55317.1| pyridoxine 5'-phosphate synthase [Bacteroides fragilis 3_1_12]
          Length = 237

 Score =  269 bits (687), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 139/246 (56%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    PN+V +       GA G+TVHPRPD+RHIR +D+ ++R
Sbjct: 1   MTKLSVNINKVATLRNARGGNVPNVVKVALDCESFGADGITVHPRPDERHIRRSDVYDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP+  F++L  + KP Q+TLVPDDP Q+TS+ GWD   N   LT
Sbjct: 61  P-----LLRTEFNIEGYPSPEFIDLVLKVKPHQVTLVPDDPSQITSNSGWDTKANFDFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +   +  G R S+F     +   ++ A   GAD +ELYT PY   Y       +    
Sbjct: 116 EVLDEFNGAGIRTSVFVAA--DAEMIEYAAKAGADRVELYTEPYATAYPKDPAAAVA--P 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A++A+++ + +NAGHDL++ N+      IP++ E+S+GHA  + AL  G++  +  
Sbjct: 172 FVEAAKVARRLGIGLNAGHDLSLLNLNYFYKNIPWLDEVSIGHALISDALYLGLERTIQE 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKNCLR 237


>gi|29349326|ref|NP_812829.1| pyridoxine 5'-phosphate synthase [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|253570327|ref|ZP_04847736.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 1_1_6]
 gi|298384859|ref|ZP_06994418.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 1_1_14]
 gi|81586666|sp|Q8A0V3|PDXJ_BACTN RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|29341234|gb|AAO79023.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|251840708|gb|EES68790.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 1_1_6]
 gi|298262003|gb|EFI04868.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 1_1_14]
          Length = 237

 Score =  269 bits (687), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 140/246 (56%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    PN+V +       GA G+TVHPRPD+RHIR  D+ ++R
Sbjct: 1   MTKLSVNINKVATLRNARGGDTPNVVKVALDCEAFGADGITVHPRPDERHIRRADVYDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP+  F++L  + KP Q+TLVPDDP Q+TS+ GWD   N   L+
Sbjct: 61  P-----LLRTEFNIEGYPSPEFIDLVLKVKPHQVTLVPDDPSQITSNSGWDTKANLEFLS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + + + ++ G R S+F     +   ++ A   GAD +ELYT PY   Y    +  +    
Sbjct: 116 EVLDQFNSAGIRTSVFVAA--DPEMVEYAAKAGADRVELYTEPYATAYPKNPEAAVA--P 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+ A+K+ + +NAGHDL++ N+      IP++ E+S+GHA  + AL  G++  +  
Sbjct: 172 FVEAAKTARKLGIGLNAGHDLSLVNLNYFYKNIPWVDEVSIGHALISDALYLGLERTIQE 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKNCLR 237


>gi|323491195|ref|ZP_08096381.1| pyridoxine 5'-phosphate synthase [Vibrio brasiliensis LMG 20546]
 gi|323314563|gb|EGA67641.1| pyridoxine 5'-phosphate synthase [Vibrio brasiliensis LMG 20546]
          Length = 243

 Score =  268 bits (686), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 80/250 (32%), Positives = 128/250 (51%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  ++A ++GA G+T+H R D+RHI+  D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEVAERAGADGITIHLREDRRHIKDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    E  + +    KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  -----ETLQTRMNLEMAVTEEMVEIALETKPEYVCLVPEKREELTTEGGLDVVGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               RL   G ++SLF D +  +    AAK  GA  IEL+TG Y        Q+   L K
Sbjct: 118 NATQRLTEAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYADAETEEDQQ-DELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GH+    A   G+ +AV  
Sbjct: 175 IAAGASYAADLGITVNAGHGLTYHNVAP-IAAIPEIYELNIGHSIIGRAAFDGLHKAVAD 233

Query: 242 FRRACGQHLD 251
            +    +   
Sbjct: 234 MKALMVEARR 243


>gi|86607950|ref|YP_476712.1| pyridoxine 5'-phosphate synthase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|123503702|sp|Q2JP46|PDXJ_SYNJB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|86556492|gb|ABD01449.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 239

 Score =  268 bits (686), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 131/246 (53%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A LR  R    P+ V    IA  +GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MLSLGVNIDHIATLRQARRTVEPDPVAAAVIAELAGADGITVHLREDRRHIQDRDVRLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  +  LN+E    E  + +    KP+ +TLVP+   ++T++ G D     + L 
Sbjct: 61  -----QTVRTHLNLEMAATEEMVAIALEVKPDYVTLVPERREEITTEGGLDVAGQVSRLR 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V +L   G  +SLF D +  + +  AA   GA  +EL+TG Y    ++  Q ++ L+ 
Sbjct: 116 DVVGQLQGSGIPVSLFIDPDPTQIA--AAAQVGARWVELHTGRYAEA-SSAAQRQVELDH 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   +Q A ++ L++NAGH LT  N+   +  IP + E+++GH+  + A+  G+  AV  
Sbjct: 173 LEKASQQALQLGLRVNAGHGLTYWNVGP-VARIPGMEELNIGHSIISRAVLVGLDRAVRE 231

Query: 242 FRRACG 247
            R+A G
Sbjct: 232 MRQAMG 237


>gi|323499984|ref|ZP_08104940.1| pyridoxine 5'-phosphate synthase [Vibrio sinaloensis DSM 21326]
 gi|323314950|gb|EGA68005.1| pyridoxine 5'-phosphate synthase [Vibrio sinaloensis DSM 21326]
          Length = 243

 Score =  268 bits (686), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 78/250 (31%), Positives = 130/250 (52%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  ++A ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEVAERAGADGITIHLREDRRHIVDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMVEIALKTKPEYVCLVPEKREELTTEGGLDVVGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L + G ++SLF D +  +    AAK  GA  IEL+TG Y        Q+   L K
Sbjct: 118 AATTKLTDAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYADAVAEDDQQ-DELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GH+    A+  G+ +AV  
Sbjct: 175 IAAGASYAADLGITVNAGHGLTYHNVAP-IAAIPEIYELNIGHSIIGRAVFDGLHKAVAD 233

Query: 242 FRRACGQHLD 251
            +    +   
Sbjct: 234 MKALMVEARK 243


>gi|218128536|ref|ZP_03457340.1| hypothetical protein BACEGG_00106 [Bacteroides eggerthii DSM 20697]
 gi|317475648|ref|ZP_07934909.1| pyridoxine 5'-phosphate synthase [Bacteroides eggerthii 1_2_48FAA]
 gi|217989260|gb|EEC55574.1| hypothetical protein BACEGG_00106 [Bacteroides eggerthii DSM 20697]
 gi|316908218|gb|EFV29911.1| pyridoxine 5'-phosphate synthase [Bacteroides eggerthii 1_2_48FAA]
          Length = 237

 Score =  268 bits (686), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 93/246 (37%), Positives = 140/246 (56%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    PN+V +       GA G+TVHPRPD+RHIR +D+ ++R
Sbjct: 1   MTKLSVNINKVATLRNARGGEVPNVVKVALDCENFGADGITVHPRPDERHIRRSDVYDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP   F++L  + KP Q+TLVPD P QLTS+ GWD   N   LT
Sbjct: 61  P-----LLRTEFNIEGYPAPEFIDLVLKVKPHQVTLVPDSPTQLTSNSGWDTKNNLEFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +   +N G R S+F     +   ++ A   GAD +ELYT PY   +   ++  +    
Sbjct: 116 EVLDTFNNAGIRTSVFVS--TDVEMIEYAAKAGADRVELYTEPYATAFPKGREAAVA--P 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A++A+ + L +NAGHDL+++N+      IP++ E+S+GHA  + AL  G++  +  
Sbjct: 172 FVEAAKMARSLGLGLNAGHDLSLENLNYFYTNIPWLDEVSIGHALISDALYLGLERTIQE 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKNCLR 237


>gi|82545016|ref|YP_408963.1| pyridoxine 5'-phosphate synthase [Shigella boydii Sb227]
 gi|187733777|ref|YP_001881343.1| pyridoxine 5'-phosphate synthase [Shigella boydii CDC 3083-94]
 gi|91207567|sp|Q31XS3|PDXJ_SHIBS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|81246427|gb|ABB67135.1| pyridoxine biosynthesis [Shigella boydii Sb227]
 gi|187430769|gb|ACD10043.1| pyridoxine 5'-phosphate synthase [Shigella boydii CDC 3083-94]
 gi|320176134|gb|EFW51201.1| Pyridoxine 5'-phosphate synthase [Shigella dysenteriae CDC 74-1112]
 gi|320186363|gb|EFW61097.1| Pyridoxine 5'-phosphate synthase [Shigella flexneri CDC 796-83]
 gi|332092606|gb|EGI97678.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella boydii
           3594-74]
          Length = 243

 Score =  268 bits (686), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLTDAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELVRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|146312692|ref|YP_001177766.1| pyridoxine 5'-phosphate synthase [Enterobacter sp. 638]
 gi|145319568|gb|ABP61715.1| pyridoxine 5'-phosphate synthase [Enterobacter sp. 638]
          Length = 243

 Score =  268 bits (685), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 82/247 (33%), Positives = 125/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVKILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    Q  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIACETKPHFCCLVPEKRQEVTTEGGLDVAGQQDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D + ++   +AA   GA  IE++TG Y    +   Q    L ++A 
Sbjct: 121 KRLADAGILVSLFIDADFDQI--KAAAAVGAPYIEIHTGCYADAEDEVAQA-KELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I  IP + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAQIPEMFELNIGHAIIGRAVMSGLKEAVSEMKR 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMLEARQ 243


>gi|13786833|pdb|1HO1|A Chain A, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase
 gi|13786834|pdb|1HO1|B Chain B, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase
 gi|13786835|pdb|1HO1|C Chain C, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase
 gi|13786836|pdb|1HO1|D Chain D, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase
 gi|13786837|pdb|1HO4|A Chain A, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase In
           Complex With Pyridoxine 5'-Phosphate And Inorganic
           Phosphate
 gi|13786838|pdb|1HO4|B Chain B, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase In
           Complex With Pyridoxine 5'-Phosphate And Inorganic
           Phosphate
 gi|13786839|pdb|1HO4|C Chain C, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase In
           Complex With Pyridoxine 5'-Phosphate And Inorganic
           Phosphate
 gi|13786840|pdb|1HO4|D Chain D, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase In
           Complex With Pyridoxine 5'-Phosphate And Inorganic
           Phosphate
 gi|28948390|pdb|1IXN|A Chain A, Enzyme-Substrate Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948391|pdb|1IXN|B Chain B, Enzyme-Substrate Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948392|pdb|1IXN|C Chain C, Enzyme-Substrate Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948393|pdb|1IXN|D Chain D, Enzyme-Substrate Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948394|pdb|1IXO|A Chain A, Enzyme-Analogue Substrate Complex Of Pyridoxine 5'-
           Phosphate Synthase
 gi|28948395|pdb|1IXO|B Chain B, Enzyme-Analogue Substrate Complex Of Pyridoxine 5'-
           Phosphate Synthase
 gi|28948396|pdb|1IXO|C Chain C, Enzyme-Analogue Substrate Complex Of Pyridoxine 5'-
           Phosphate Synthase
 gi|28948397|pdb|1IXO|D Chain D, Enzyme-Analogue Substrate Complex Of Pyridoxine 5'-
           Phosphate Synthase
 gi|28948398|pdb|1IXP|A Chain A, Enzyme-Phosphate Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948399|pdb|1IXP|B Chain B, Enzyme-Phosphate Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948400|pdb|1IXP|C Chain C, Enzyme-Phosphate Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948401|pdb|1IXP|D Chain D, Enzyme-Phosphate Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948402|pdb|1IXQ|A Chain A, Enzyme-Phosphate2 Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948403|pdb|1IXQ|B Chain B, Enzyme-Phosphate2 Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948404|pdb|1IXQ|C Chain C, Enzyme-Phosphate2 Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948405|pdb|1IXQ|D Chain D, Enzyme-Phosphate2 Complex Of Pyridoxine 5'-Phosphate
           Synthase
          Length = 242

 Score =  268 bits (685), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 5   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 62  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 119

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 120 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 176

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 177 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 235

Query: 245 ACGQHL 250
              +  
Sbjct: 236 LMLEAR 241


>gi|197285740|ref|YP_002151612.1| pyridoxine 5'-phosphate synthase [Proteus mirabilis HI4320]
 gi|227356254|ref|ZP_03840643.1| pyridoxal phosphate biosynthetic protein [Proteus mirabilis ATCC
           29906]
 gi|194683227|emb|CAR43908.1| pyridoxal phosphate biosynthetic protein [Proteus mirabilis HI4320]
 gi|227163718|gb|EEI48634.1| pyridoxal phosphate biosynthetic protein [Proteus mirabilis ATCC
           29906]
          Length = 243

 Score =  268 bits (685), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 76/249 (30%), Positives = 124/249 (49%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ V    IA Q+GA G+T+H R D+RHI   DL  I  
Sbjct: 4   ILLGVNIDHIATLRNARGTTYPDPVQAAFIAEQAGADGITIHLREDRRHITDRDLMLIS- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               Q  +  LN+E    E  + +  + +P+   LVP+   ++T++ G D + N+  +  
Sbjct: 63  ----QTVQTRLNLEMAVTEEMIEIACQTQPDFCCLVPEKRQEVTTEGGLDVVGNEEKVAD 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            + RL   G ++SLF D +  + +  AA   GA  IE++TG Y    +   QE     ++
Sbjct: 119 AIKRLSLAGIKVSLFIDPDHEQIN--AADRVGAPFIEIHTGAYADAEDEQAQE-KEFVRI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
                 A    L++NAGH L   N+   I A+P + E+++GHA    A+  G+  AV   
Sbjct: 176 RDAVTYAASKGLKVNAGHGLHYHNVQR-IAALPELYELNIGHAIIGRAVFSGLAPAVEEM 234

Query: 243 RRACGQHLD 251
           +R   +   
Sbjct: 235 KRLMREARR 243


>gi|332881839|ref|ZP_08449482.1| pyridoxine 5'-phosphate synthase [Capnocytophaga sp. oral taxon 329
           str. F0087]
 gi|332680183|gb|EGJ53137.1| pyridoxine 5'-phosphate synthase [Capnocytophaga sp. oral taxon 329
           str. F0087]
          Length = 237

 Score =  268 bits (685), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 141/246 (57%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    P++V +     + GA G+TVHPRPD+RHIRY D+ +++
Sbjct: 1   MTKLSVNINKVATLRNARGGNNPDVVQVALDCEKFGAQGITVHPRPDERHIRYQDVYDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++     + E NIEG P + F +L  + +P Q+TLVPD P Q+TS+ GWD  +N + LT
Sbjct: 61  AVL-----RTEFNIEGNPVDKFNDLVLKVRPTQVTLVPDAPDQITSNAGWDTKKNLSFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +      G R S+F +       ++ A   GAD +ELYT PY + Y    +  + +  
Sbjct: 116 EIIGEFKEKGIRTSVFVNA--EAEMVEYAAKAGADRVELYTEPYASAYAGSPE--VAVRP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+ A+ + L +NAGHDL+++N+  +   I +I E+S+GHA    AL  G++E +  
Sbjct: 172 FVEAARTARSLGLGLNAGHDLSLENLKYMHEQIGWIDEVSIGHALICDALYLGLEETIKR 231

Query: 242 FRRACG 247
           +     
Sbjct: 232 YLECLK 237


>gi|153809131|ref|ZP_01961799.1| hypothetical protein BACCAC_03441 [Bacteroides caccae ATCC 43185]
 gi|149128464|gb|EDM19683.1| hypothetical protein BACCAC_03441 [Bacteroides caccae ATCC 43185]
          Length = 237

 Score =  268 bits (685), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 91/246 (36%), Positives = 142/246 (57%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P++V +       GA G+TVHPRPD+RHIR +D+ ++R
Sbjct: 1   MTKLSVNINKIATLRNARGGNVPDVVKVALDCESFGADGITVHPRPDERHIRRSDVYDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP+  F++L  + KP Q+TLVPDDP Q+TS+ GWD   N   LT
Sbjct: 61  P-----LLRTEFNIEGYPSPEFIDLVLKVKPHQVTLVPDDPSQITSNSGWDTKANLEFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + + + ++ G R S+F     +   ++ A   GAD +ELYT PY    + P+     +  
Sbjct: 116 EVLDQFNSAGIRTSVFVAA--DPEMVEYAAKAGADRVELYTEPY--ATDFPKNPEAAIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+ A+K+ + +NAGHDL++ N+      IP++ E+S+GHA  + AL  G++  +  
Sbjct: 172 FIEAAKTARKLGIGLNAGHDLSLVNLNYFYKNIPWVDEVSIGHALISDALYLGLERTIQE 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKNCLR 237


>gi|30063966|ref|NP_838137.1| pyridoxine 5'-phosphate synthase [Shigella flexneri 2a str. 2457T]
 gi|56480141|ref|NP_708416.2| pyridoxine 5'-phosphate synthase [Shigella flexneri 2a str. 301]
 gi|110806509|ref|YP_690029.1| pyridoxine 5'-phosphate synthase [Shigella flexneri 5 str. 8401]
 gi|194432058|ref|ZP_03064347.1| pyridoxine 5'-phosphate synthase [Shigella dysenteriae 1012]
 gi|30042222|gb|AAP17947.1| pyridoxal phosphate biosynthetic protein [Shigella flexneri 2a str.
           2457T]
 gi|56383692|gb|AAN44123.2| pyridoxal phosphate biosynthetic protein [Shigella flexneri 2a str.
           301]
 gi|110616057|gb|ABF04724.1| pyridoxine biosynthesis [Shigella flexneri 5 str. 8401]
 gi|194419587|gb|EDX35667.1| pyridoxine 5'-phosphate synthase [Shigella dysenteriae 1012]
 gi|281601977|gb|ADA74961.1| Pyridoxine 5'-phosphate synthase [Shigella flexneri 2002017]
 gi|313648242|gb|EFS12686.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri 2a
           str. 2457T]
 gi|320182111|gb|EFW57015.1| Pyridoxine 5'-phosphate synthase [Shigella boydii ATCC 9905]
 gi|332088076|gb|EGI93201.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella boydii
           5216-82]
 gi|332089188|gb|EGI94295.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella dysenteriae
           155-74]
 gi|332753973|gb|EGJ84347.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           4343-70]
 gi|332755802|gb|EGJ86160.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           2747-71]
 gi|332761957|gb|EGJ92230.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           K-671]
 gi|332766565|gb|EGJ96770.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           2930-71]
 gi|333000424|gb|EGK20006.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           VA-6]
 gi|333000829|gb|EGK20401.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           K-218]
 gi|333001657|gb|EGK21224.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           K-272]
 gi|333015933|gb|EGK35268.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           K-227]
 gi|333016833|gb|EGK36159.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           K-304]
          Length = 243

 Score =  268 bits (684), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKIRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELVRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|15832684|ref|NP_311457.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           Sakai]
 gi|16130489|ref|NP_417059.1| pyridoxine 5'-phosphate synthase [Escherichia coli str. K-12
           substr. MG1655]
 gi|89109370|ref|AP_003150.1| pyridoxine 5'-phosphate synthase [Escherichia coli str. K-12
           substr. W3110]
 gi|157158897|ref|YP_001463887.1| pyridoxine 5'-phosphate synthase [Escherichia coli E24377A]
 gi|157162043|ref|YP_001459361.1| pyridoxine 5'-phosphate synthase [Escherichia coli HS]
 gi|168748366|ref|ZP_02773388.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4113]
 gi|168757775|ref|ZP_02782782.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4401]
 gi|168761185|ref|ZP_02786192.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4501]
 gi|168768668|ref|ZP_02793675.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773510|ref|ZP_02798517.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4196]
 gi|168778541|ref|ZP_02803548.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4076]
 gi|168787924|ref|ZP_02812931.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC869]
 gi|168798946|ref|ZP_02823953.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC508]
 gi|170019153|ref|YP_001724107.1| pyridoxine 5'-phosphate synthase [Escherichia coli ATCC 8739]
 gi|170082173|ref|YP_001731493.1| pyridoxine 5'-phosphate synthase [Escherichia coli str. K-12
           substr. DH10B]
 gi|188495429|ref|ZP_03002699.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           53638]
 gi|191167992|ref|ZP_03029794.1| pyridoxine 5'-phosphate synthase [Escherichia coli B7A]
 gi|193064042|ref|ZP_03045127.1| pyridoxine 5'-phosphate synthase [Escherichia coli E22]
 gi|193068330|ref|ZP_03049293.1| pyridoxine 5'-phosphate synthase [Escherichia coli E110019]
 gi|194429293|ref|ZP_03061820.1| pyridoxine 5'-phosphate synthase [Escherichia coli B171]
 gi|194437613|ref|ZP_03069709.1| pyridoxine 5'-phosphate synthase [Escherichia coli 101-1]
 gi|195936711|ref|ZP_03082093.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           O157:H7 str. EC4024]
 gi|208808919|ref|ZP_03251256.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208814486|ref|ZP_03255815.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208819341|ref|ZP_03259661.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209396227|ref|YP_002272039.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209920043|ref|YP_002294127.1| pyridoxine 5'-phosphate synthase [Escherichia coli SE11]
 gi|217326667|ref|ZP_03442750.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           TW14588]
 gi|218547908|ref|YP_002381699.1| pyridoxine 5'-phosphate synthase [Escherichia fergusonii ATCC
           35469]
 gi|218555145|ref|YP_002388058.1| pyridoxine 5'-phosphate synthase [Escherichia coli IAI1]
 gi|218696192|ref|YP_002403859.1| pyridoxine 5'-phosphate synthase [Escherichia coli 55989]
 gi|238901729|ref|YP_002927525.1| pyridoxine 5'-phosphate synthase [Escherichia coli BW2952]
 gi|253772537|ref|YP_003035368.1| pyridoxine 5'-phosphate synthase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162539|ref|YP_003045647.1| pyridoxine 5'-phosphate synthase [Escherichia coli B str. REL606]
 gi|254794514|ref|YP_003079351.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           TW14359]
 gi|256021750|ref|ZP_05435615.1| pyridoxine 5'-phosphate synthase [Escherichia sp. 4_1_40B]
 gi|260845249|ref|YP_003223027.1| pyridoxine 5'-phosphate synthase [Escherichia coli O103:H2 str.
           12009]
 gi|260856658|ref|YP_003230549.1| pyridoxine 5'-phosphate synthase [Escherichia coli O26:H11 str.
           11368]
 gi|260869251|ref|YP_003235653.1| pyridoxine 5'-phosphate synthase [Escherichia coli O111:H- str.
           11128]
 gi|261223000|ref|ZP_05937281.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261259449|ref|ZP_05951982.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283839|ref|YP_003500657.1| Pyridoxine 5'-phosphate synthase [Escherichia coli O55:H7 str.
           CB9615]
 gi|293446918|ref|ZP_06663340.1| pyridoxine 5'-phosphate synthase [Escherichia coli B088]
 gi|297521528|ref|ZP_06939914.1| pyridoxine 5'-phosphate synthase [Escherichia coli OP50]
 gi|301022062|ref|ZP_07185989.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 196-1]
 gi|307139200|ref|ZP_07498556.1| pyridoxine 5'-phosphate synthase [Escherichia coli H736]
 gi|307313865|ref|ZP_07593481.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli W]
 gi|312973190|ref|ZP_07787362.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           1827-70]
 gi|331669314|ref|ZP_08370162.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA271]
 gi|67470415|sp|P0A794|PDXJ_ECOLI RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|67470416|sp|P0A795|PDXJ_ECO57 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|34811392|pdb|1M5W|A Chain A, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate
           Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate
 gi|34811393|pdb|1M5W|B Chain B, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate
           Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate
 gi|34811394|pdb|1M5W|C Chain C, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate
           Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate
 gi|34811395|pdb|1M5W|D Chain D, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate
           Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate
 gi|34811396|pdb|1M5W|E Chain E, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate
           Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate
 gi|34811397|pdb|1M5W|F Chain F, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate
           Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate
 gi|34811398|pdb|1M5W|G Chain G, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate
           Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate
 gi|34811399|pdb|1M5W|H Chain H, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate
           Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate
 gi|147137|gb|AAA24315.1| pdxJ [Escherichia coli]
 gi|147555|gb|AAA21845.1| pdxJ [Escherichia coli]
 gi|1033153|gb|AAA79826.1| CG Site No. 416 [Escherichia coli str. K-12 substr. MG1655]
 gi|1788917|gb|AAC75617.1| pyridoxine 5'-phosphate synthase [Escherichia coli str. K-12
           substr. MG1655]
 gi|13362901|dbj|BAB36853.1| pyridoxine biosynthesis [Escherichia coli O157:H7 str. Sakai]
 gi|85675455|dbj|BAE76740.1| pyridoxine 5'-phosphate synthase [Escherichia coli str. K12 substr.
           W3110]
 gi|157067723|gb|ABV06978.1| pyridoxine 5'-phosphate synthase [Escherichia coli HS]
 gi|157080927|gb|ABV20635.1| pyridoxine 5'-phosphate synthase [Escherichia coli E24377A]
 gi|169754081|gb|ACA76780.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           ATCC 8739]
 gi|169890008|gb|ACB03715.1| pyridoxine 5'-phosphate synthase [Escherichia coli str. K-12
           substr. DH10B]
 gi|187770734|gb|EDU34578.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017072|gb|EDU55194.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4113]
 gi|188490628|gb|EDU65731.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           53638]
 gi|189003261|gb|EDU72247.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189355300|gb|EDU73719.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189362219|gb|EDU80638.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189368383|gb|EDU86799.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4501]
 gi|189372245|gb|EDU90661.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC869]
 gi|189378686|gb|EDU97102.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC508]
 gi|190901999|gb|EDV61746.1| pyridoxine 5'-phosphate synthase [Escherichia coli B7A]
 gi|192929277|gb|EDV82886.1| pyridoxine 5'-phosphate synthase [Escherichia coli E22]
 gi|192958282|gb|EDV88722.1| pyridoxine 5'-phosphate synthase [Escherichia coli E110019]
 gi|194412701|gb|EDX28996.1| pyridoxine 5'-phosphate synthase [Escherichia coli B171]
 gi|194423419|gb|EDX39410.1| pyridoxine 5'-phosphate synthase [Escherichia coli 101-1]
 gi|208728720|gb|EDZ78321.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208735763|gb|EDZ84450.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208739464|gb|EDZ87146.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209157627|gb|ACI35060.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209762908|gb|ACI79766.1| pyridoxine biosynthesis [Escherichia coli]
 gi|209762910|gb|ACI79767.1| pyridoxine biosynthesis [Escherichia coli]
 gi|209762912|gb|ACI79768.1| pyridoxine biosynthesis [Escherichia coli]
 gi|209762914|gb|ACI79769.1| pyridoxine biosynthesis [Escherichia coli]
 gi|209762916|gb|ACI79770.1| pyridoxine biosynthesis [Escherichia coli]
 gi|209913302|dbj|BAG78376.1| pyridoxal phosphate biosynthetic protein [Escherichia coli SE11]
 gi|217319034|gb|EEC27459.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           TW14588]
 gi|218352924|emb|CAU98723.1| pyridoxine 5'-phosphate synthase [Escherichia coli 55989]
 gi|218355449|emb|CAQ88058.1| pyridoxine 5'-phosphate synthase [Escherichia fergusonii ATCC
           35469]
 gi|218361913|emb|CAQ99513.1| pyridoxine 5'-phosphate synthase [Escherichia coli IAI1]
 gi|238863352|gb|ACR65350.1| pyridoxine 5'-phosphate synthase [Escherichia coli BW2952]
 gi|242378165|emb|CAQ32939.1| pyridoxine 5'-phosphate synthase [Escherichia coli BL21(DE3)]
 gi|253323581|gb|ACT28183.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253974440|gb|ACT40111.1| pyridoxal phosphate biosynthetic protein [Escherichia coli B str.
           REL606]
 gi|253978607|gb|ACT44277.1| pyridoxal phosphate biosynthetic protein [Escherichia coli
           BL21(DE3)]
 gi|254593914|gb|ACT73275.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           TW14359]
 gi|257755307|dbj|BAI26809.1| pyridoxine 5'-phosphate synthase [Escherichia coli O26:H11 str.
           11368]
 gi|257760396|dbj|BAI31893.1| pyridoxine 5'-phosphate synthase [Escherichia coli O103:H2 str.
           12009]
 gi|257765607|dbj|BAI37102.1| pyridoxine 5'-phosphate synthase [Escherichia coli O111:H- str.
           11128]
 gi|260448356|gb|ACX38778.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           DH1]
 gi|290763712|gb|ADD57673.1| Pyridoxine 5'-phosphate synthase [Escherichia coli O55:H7 str.
           CB9615]
 gi|291323748|gb|EFE63176.1| pyridoxine 5'-phosphate synthase [Escherichia coli B088]
 gi|299881367|gb|EFI89578.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 196-1]
 gi|306906366|gb|EFN36881.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli W]
 gi|310331785|gb|EFP99020.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           1827-70]
 gi|315061883|gb|ADT76210.1| pyridoxine 5'-phosphate synthase [Escherichia coli W]
 gi|315137188|dbj|BAJ44347.1| pyridoxine 5'-phosphate synthase [Escherichia coli DH1]
 gi|315615826|gb|EFU96458.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           3431]
 gi|320188905|gb|EFW63564.1| Pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320200128|gb|EFW74717.1| Pyridoxine 5'-phosphate synthase [Escherichia coli EC4100B]
 gi|320640813|gb|EFX10307.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           G5101]
 gi|320646159|gb|EFX15099.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H- str.
           493-89]
 gi|320651454|gb|EFX19850.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H- str. H
           2687]
 gi|320657055|gb|EFX24874.1| pyridoxine 5'-phosphate synthase [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320662720|gb|EFX30059.1| pyridoxine 5'-phosphate synthase [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320667540|gb|EFX34460.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323156222|gb|EFZ42381.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           EPECa14]
 gi|323159221|gb|EFZ45211.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           E128010]
 gi|323173118|gb|EFZ58749.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           LT-68]
 gi|323177306|gb|EFZ62894.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           1180]
 gi|323184556|gb|EFZ69930.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           1357]
 gi|323377536|gb|ADX49804.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           KO11]
 gi|323941173|gb|EGB37358.1| pyridoxine 5'-phosphate synthase [Escherichia coli E482]
 gi|323944621|gb|EGB40689.1| pyridoxine 5'-phosphate synthase [Escherichia coli H120]
 gi|323961179|gb|EGB56792.1| pyridoxine 5'-phosphate synthase [Escherichia coli H489]
 gi|323971110|gb|EGB66357.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA007]
 gi|324118226|gb|EGC12122.1| pyridoxine 5'-phosphate synthase [Escherichia coli E1167]
 gi|326340370|gb|EGD64174.1| Pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           1125]
 gi|326345053|gb|EGD68797.1| Pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           1044]
 gi|331064508|gb|EGI36419.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA271]
          Length = 243

 Score =  268 bits (684), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|215487908|ref|YP_002330339.1| pyridoxine 5'-phosphate synthase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218706068|ref|YP_002413587.1| pyridoxine 5'-phosphate synthase [Escherichia coli UMN026]
 gi|293406006|ref|ZP_06649998.1| pyridoxine 5'-phosphate synthase [Escherichia coli FVEC1412]
 gi|298381806|ref|ZP_06991405.1| pyridoxine 5'-phosphate synthase [Escherichia coli FVEC1302]
 gi|312965480|ref|ZP_07779712.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           2362-75]
 gi|331684214|ref|ZP_08384810.1| pyridoxine 5'-phosphate synthase [Escherichia coli H299]
 gi|215265980|emb|CAS10389.1| pyridoxine 5'-phosphate synthase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218433165|emb|CAR14061.1| pyridoxine 5'-phosphate synthase [Escherichia coli UMN026]
 gi|291428214|gb|EFF01241.1| pyridoxine 5'-phosphate synthase [Escherichia coli FVEC1412]
 gi|298279248|gb|EFI20762.1| pyridoxine 5'-phosphate synthase [Escherichia coli FVEC1302]
 gi|312289900|gb|EFR17788.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           2362-75]
 gi|320196400|gb|EFW71024.1| Pyridoxine 5'-phosphate synthase [Escherichia coli WV_060327]
 gi|331079166|gb|EGI50368.1| pyridoxine 5'-phosphate synthase [Escherichia coli H299]
          Length = 243

 Score =  268 bits (684), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLAEAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|306814372|ref|ZP_07448534.1| pyridoxine 5'-phosphate synthase [Escherichia coli NC101]
 gi|30316042|sp|Q8FF18|PDXJ_ECOL6 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|305851766|gb|EFM52218.1| pyridoxine 5'-phosphate synthase [Escherichia coli NC101]
 gi|307554583|gb|ADN47358.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli ABU
           83972]
          Length = 243

 Score =  268 bits (684), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 128/246 (52%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVCILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D + ++   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGIQVSLFIDADEDQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFATSLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|110642726|ref|YP_670456.1| pyridoxine 5'-phosphate synthase [Escherichia coli 536]
 gi|191174007|ref|ZP_03035524.1| pyridoxine 5'-phosphate synthase [Escherichia coli F11]
 gi|218559485|ref|YP_002392398.1| pyridoxine 5'-phosphate synthase [Escherichia coli S88]
 gi|218690680|ref|YP_002398892.1| pyridoxine 5'-phosphate synthase [Escherichia coli ED1a]
 gi|331658708|ref|ZP_08359652.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA206]
 gi|110344318|gb|ABG70555.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           536]
 gi|190905698|gb|EDV65320.1| pyridoxine 5'-phosphate synthase [Escherichia coli F11]
 gi|218366254|emb|CAR04001.1| pyridoxine 5'-phosphate synthase [Escherichia coli S88]
 gi|218428244|emb|CAR09161.2| pyridoxine 5'-phosphate synthase [Escherichia coli ED1a]
 gi|222034269|emb|CAP77010.1| Pyridoxine 5'-phosphate synthase [Escherichia coli LF82]
 gi|281179613|dbj|BAI55943.1| pyridoxal phosphate biosynthetic protein [Escherichia coli SE15]
 gi|307625888|gb|ADN70192.1| pyridoxine 5'-phosphate synthase [Escherichia coli UM146]
 gi|312947135|gb|ADR27962.1| pyridoxine 5'-phosphate synthase [Escherichia coli O83:H1 str. NRG
           857C]
 gi|323949218|gb|EGB45109.1| pyridoxine 5'-phosphate synthase [Escherichia coli H252]
 gi|323955800|gb|EGB51558.1| pyridoxine 5'-phosphate synthase [Escherichia coli H263]
 gi|331054373|gb|EGI26400.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA206]
          Length = 243

 Score =  268 bits (684), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVCILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFATSLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|309702950|emb|CBJ02281.1| pyridoxine 5'-phosphate synthase [Escherichia coli ETEC H10407]
 gi|323936304|gb|EGB32595.1| pyridoxine 5'-phosphate synthase [Escherichia coli E1520]
 gi|332344439|gb|AEE57773.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           UMNK88]
          Length = 243

 Score =  267 bits (683), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|170682415|ref|YP_001744753.1| pyridoxine 5'-phosphate synthase [Escherichia coli SMS-3-5]
 gi|218701078|ref|YP_002408707.1| pyridoxine 5'-phosphate synthase [Escherichia coli IAI39]
 gi|170520133|gb|ACB18311.1| pyridoxine 5'-phosphate synthase [Escherichia coli SMS-3-5]
 gi|218371064|emb|CAR18891.1| pyridoxine 5'-phosphate synthase [Escherichia coli IAI39]
          Length = 243

 Score =  267 bits (683), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLAEAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|329963086|ref|ZP_08300866.1| pyridoxine 5'-phosphate synthase [Bacteroides fluxus YIT 12057]
 gi|328529127|gb|EGF56057.1| pyridoxine 5'-phosphate synthase [Bacteroides fluxus YIT 12057]
          Length = 262

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 93/246 (37%), Positives = 137/246 (55%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    PN+V +       GA G+TVHPRPD+RHIR +D+ ++R
Sbjct: 26  MTRLSVNINKVATLRNARGGDAPNVVKVALDCENFGADGITVHPRPDERHIRRSDVYDLR 85

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP   F++L  + KP Q+TLVPD P QLTS+ GWD   N   L+
Sbjct: 86  P-----LLRTEFNIEGYPAPDFIDLVLKVKPHQVTLVPDSPTQLTSNAGWDTKTNLDFLS 140

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +   +N G R S+F     +   ++ A   GAD +ELYT PY   Y   ++  I    
Sbjct: 141 EVLDEFNNAGIRTSVFVS--TDAEMIEYAAKAGADRVELYTEPYATAYPKGKEAAIA--P 196

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A++ + + L +NAGHDL++ N+      IP++ E+S+GHA    AL  G++  +  
Sbjct: 197 FVEAAKVVRSLGLGLNAGHDLSLVNLNYFYQNIPWLDEVSIGHALICDALYLGLERTIQE 256

Query: 242 FRRACG 247
           ++    
Sbjct: 257 YKNCLR 262


>gi|74313126|ref|YP_311545.1| pyridoxine 5'-phosphate synthase [Shigella sonnei Ss046]
 gi|91207569|sp|Q3YYV2|PDXJ_SHISS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|73856603|gb|AAZ89310.1| pyridoxine biosynthesis [Shigella sonnei Ss046]
 gi|323167802|gb|EFZ53497.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella sonnei 53G]
          Length = 243

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 81/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G +ISLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLTDAGIQISLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELVRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|331664132|ref|ZP_08365042.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA143]
 gi|331059931|gb|EGI31908.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA143]
          Length = 243

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGIQVSLFIDADVEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|319899978|ref|YP_004159706.1| pyridoxine 5'-phosphate synthase [Bacteroides helcogenes P 36-108]
 gi|319415009|gb|ADV42120.1| pyridoxine 5'-phosphate synthase [Bacteroides helcogenes P 36-108]
          Length = 237

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 135/246 (54%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    P++V +       GA G+TVHPRPD+RHIR  D+ ++R
Sbjct: 1   MTRLSVNINKVATLRNARGGDMPDVVKVALDCENYGADGITVHPRPDERHIRQNDVYDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP   F++L  + KP Q+TLVPD P QLTS+ GWD   +   L+
Sbjct: 61  P-----LLRTEFNIEGYPAPEFIDLVLKVKPHQVTLVPDSPTQLTSNAGWDTKTHFDFLS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +   ++ G R S+F   + +    + A   GAD +ELYT PY      P+     +  
Sbjct: 116 EVLDEFNDAGIRTSVFVSTDADMI--EHAAKAGADRVELYTEPY--ATVYPKDREAAVAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A++ + + L +NAGHDL++ N+      IP++ E+S+GHA    AL  G++  +  
Sbjct: 172 FVEAAKVTRSLGLGLNAGHDLSLVNLNYFYQNIPWLDEVSIGHALICDALYLGLERTIQE 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKNCLR 237


>gi|237719135|ref|ZP_04549616.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides sp.
           2_2_4]
 gi|293368684|ref|ZP_06615290.1| pyridoxine 5'-phosphate synthase [Bacteroides ovatus SD CMC 3f]
 gi|298480232|ref|ZP_06998430.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. D22]
 gi|229451514|gb|EEO57305.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides sp.
           2_2_4]
 gi|292636225|gb|EFF54711.1| pyridoxine 5'-phosphate synthase [Bacteroides ovatus SD CMC 3f]
 gi|295086524|emb|CBK68047.1| pyridoxine 5'-phosphate synthase [Bacteroides xylanisolvens XB1A]
 gi|298273513|gb|EFI15076.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. D22]
          Length = 238

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 141/246 (57%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P++V +       GA G+TVHPRPD+RHIR +D+ ++R
Sbjct: 1   MTKLSVNINKIATLRNARGGNVPDVVKVALDCESFGADGITVHPRPDERHIRRSDVYDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP   F++L  + KP Q+TLVPDDP Q+TS+ GWD   N   LT
Sbjct: 61  P-----LLRTEFNIEGYPAPEFIDLVLKVKPHQVTLVPDDPSQITSNSGWDTKANLEFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + + + ++ G R S+F     +   ++ A   GAD +ELYT PY    N P+     +  
Sbjct: 116 EVLDQFNSAGIRTSVFVAA--DPEMVEYAAKAGADRVELYTEPY--ATNYPKNPEAAIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+ A+K+ + +NAGHDL++ N+      IP++ E+S+GHA  + AL  G++  +  
Sbjct: 172 FIEAAKTARKLGIGLNAGHDLSLVNLNYFYKNIPWVDEVSIGHALISDALYLGLERTIQE 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKNCLR 237


>gi|226328138|ref|ZP_03803656.1| hypothetical protein PROPEN_02029 [Proteus penneri ATCC 35198]
 gi|225203842|gb|EEG86196.1| hypothetical protein PROPEN_02029 [Proteus penneri ATCC 35198]
          Length = 243

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 77/249 (30%), Positives = 125/249 (50%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ V    IA Q+GA G+T+H R D+RHI   DL  I  
Sbjct: 4   ILLGVNIDHIATLRNARGTTYPDPVQAAFIAEQAGADGITIHLREDRRHITDRDLMLIS- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               Q  +  LN+E    E  + +  + +P+   LVP+   ++T++ G D + N+A +  
Sbjct: 63  ----QTVQTRLNLEMAVTEEMIEIACQTQPDFCCLVPEKRQEVTTEGGLDVVGNEAKVAD 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            + RL   G ++SLF D +  + +  AA   GA  IE++TG Y    +   QE     ++
Sbjct: 119 AIKRLSLAGIKVSLFIDPDHEQIN--AADRVGAPFIEIHTGAYADAEDEMAQE-KEFMRI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
                 A    L++NAGH L   N+   I A+P + E+++GHA    A+  G+  AV   
Sbjct: 176 RDAVTYAASKGLKVNAGHGLHYHNVQR-IAALPELYELNIGHAIIGRAVFSGLAPAVEEM 234

Query: 243 RRACGQHLD 251
           +R   +   
Sbjct: 235 KRLMREARR 243


>gi|268593247|ref|ZP_06127468.1| pyridoxine 5'-phosphate synthase [Providencia rettgeri DSM 1131]
 gi|291311142|gb|EFE51595.1| pyridoxine 5'-phosphate synthase [Providencia rettgeri DSM 1131]
          Length = 243

 Score =  267 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 124/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +    
Sbjct: 6   LGVNIDHIATVRNARGTQYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDITLL---- 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    +  + +  R KP    LVP+   ++T++ G D    +  +   V
Sbjct: 62  -NETIQTRMNLEMAVTDEMVEIACRIKPTFCCLVPEKREEVTTEGGLDVAGQKQKVADAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  +    AA+  GA  IE++TG Y    +  +QE +   ++  
Sbjct: 121 KRLTEAGILVSLFIDADHQQI--DAAQECGAPFIEIHTGAYADAKSEQEQE-LEFRRIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    +++NAGH LT  N+   I  +P I E+++GHA    AL  G+ +AV   ++
Sbjct: 178 GAVYAASKGIKVNAGHGLTYHNVQR-IAQLPEIYELNIGHAIIGRALFSGLAQAVTDMKK 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 ILLEARK 243


>gi|261253897|ref|ZP_05946470.1| pyridoxine 5'-phosphate synthase [Vibrio orientalis CIP 102891]
 gi|260937288|gb|EEX93277.1| pyridoxine 5'-phosphate synthase [Vibrio orientalis CIP 102891]
          Length = 243

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 78/250 (31%), Positives = 128/250 (51%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHIVDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + KPE + LVP+   +LT++ G D   +   + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMVEIALKTKPEYVCLVPEKREELTTEGGLDVAGHLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
                L   G ++SLF D +  +    AAK  GA  +EL+TG Y        Q+   L K
Sbjct: 118 AATQTLSEAGIKVSLFIDADREQI--DAAKACGAPFVELHTGHYADAETEEDQQ-DELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GH+    A+  G+ +AV  
Sbjct: 175 IAAGASYAADLGITVNAGHGLTYHNVAP-IAAIPEIFELNIGHSIMGRAVFDGLNKAVAD 233

Query: 242 FRRACGQHLD 251
            +    +   
Sbjct: 234 MKAIMVEARK 243


>gi|269965788|ref|ZP_06179885.1| Pyridoxine 5'-phosphate synthase [Vibrio alginolyticus 40B]
 gi|269829656|gb|EEZ83893.1| Pyridoxine 5'-phosphate synthase [Vibrio alginolyticus 40B]
          Length = 244

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 77/250 (30%), Positives = 132/250 (52%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  -----ETIQTRMNLEMAVTDEMVEIALQTKPEFVCLVPEKREELTTEGGLDVVGQLEKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L + G ++SLF D +  +   +AAK  GA  IEL+TG Y        +++  L K
Sbjct: 118 AATKKLTDAGIKVSLFIDADRQQI--EAAKKCGAPFIELHTGHYADATTE-DEQQAELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G+ +AV  
Sbjct: 175 IAAGASYAHDLGIIVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLNKAVAD 233

Query: 242 FRRACGQHLD 251
            +    +   
Sbjct: 234 MKALMIEARQ 243


>gi|153835466|ref|ZP_01988133.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio harveyi HY01]
 gi|156975789|ref|YP_001446696.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio harveyi ATCC
           BAA-1116]
 gi|269960402|ref|ZP_06174775.1| Pyridoxine 5''-phosphate synthase [Vibrio harveyi 1DA3]
 gi|148867977|gb|EDL67174.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio harveyi HY01]
 gi|156527383|gb|ABU72469.1| hypothetical protein VIBHAR_03533 [Vibrio harveyi ATCC BAA-1116]
 gi|269834829|gb|EEZ88915.1| Pyridoxine 5''-phosphate synthase [Vibrio harveyi 1DA3]
          Length = 243

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 77/250 (30%), Positives = 129/250 (51%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  -----ETIQTRMNLEMAVTDEMVEIALQTKPEFVCLVPEKREELTTEGGLDVVGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  IEL+TG Y        Q+   L K
Sbjct: 118 AATQKLTEAGIKVSLFIDADRQQI--DAAKACGAPYIELHTGHYADATTEEDQQ-DELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G++++V  
Sbjct: 175 IAAGASYADDLGIIVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLEKSVAE 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKAIMVAARK 243


>gi|261345438|ref|ZP_05973082.1| pyridoxine 5'-phosphate synthase [Providencia rustigianii DSM 4541]
 gi|282566485|gb|EFB72020.1| pyridoxine 5'-phosphate synthase [Providencia rustigianii DSM 4541]
          Length = 243

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 124/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A Q+GA G+T+H R D+RHI   D+  +    
Sbjct: 6   LGVNIDHIATVRNARGTQYPDPVQAAFVAEQAGADGITIHLREDRRHITDRDVELL---- 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  +++  R KP    LVP+   ++T++ G D    +  +   V
Sbjct: 62  -NQTIQTRMNLEMAVTDEMIDIACRIKPTYCCLVPEKREEVTTEGGLDVAGQKQKVAAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  +    AA+  GA  IE++TG Y        QE I   ++  
Sbjct: 121 KRLTESGILVSLFIDADHEQI--DAAQECGAPFIEIHTGAYADAKTEQAQE-IEFRRIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             + A    +++NAGH LT  N+   I A+P I E+++GHA    AL  G+ +AV   ++
Sbjct: 178 GVKYAAGKGIKVNAGHGLTYHNVQR-IAALPEIYELNIGHAIIGRALFSGLAQAVSDMKQ 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LLTEARK 243


>gi|333029292|ref|ZP_08457353.1| Pyridoxine 5'-phosphate synthase [Bacteroides coprosuis DSM 18011]
 gi|332739889|gb|EGJ70371.1| Pyridoxine 5'-phosphate synthase [Bacteroides coprosuis DSM 18011]
          Length = 238

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 94/247 (38%), Positives = 145/247 (58%), Gaps = 9/247 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    PN+V + K   + GA G+T+HPRPD+RHI   D+ ++R
Sbjct: 1   MTKLSVNINKVATLRNSRGGNVPNVVQVAKDCERFGADGITIHPRPDERHITRKDVFDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            +I       E NIEGYP+  F++L    KP Q+TLVPD P QLTS+ GW+  ++QA L 
Sbjct: 61  PIIT-----TEFNIEGYPSRDFIDLVLSVKPHQVTLVPDSPDQLTSNAGWNTKEHQAFLR 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +   +  G R S+F +   ++  ++ A   GAD +ELYT PY    N P         
Sbjct: 116 EVLDEFNTAGIRTSVFIE--TDKEMIEYAAKAGADRVELYTEPY--ALNYPTDPATAAAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+L + + + +NAGHDL ++N+  L N IP++ E+S+GHA  + AL  G+++ +  
Sbjct: 172 FIEAAKLVKSLGMGLNAGHDLNLENLNYLYNNIPWLDEVSIGHALISDALYLGLEKTIQE 231

Query: 242 FRRACGQ 248
           +++   +
Sbjct: 232 YKKCLSE 238


>gi|293410980|ref|ZP_06654556.1| pyridoxine 5'-phosphate synthase [Escherichia coli B354]
 gi|291471448|gb|EFF13932.1| pyridoxine 5'-phosphate synthase [Escherichia coli B354]
          Length = 243

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVCILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|293415833|ref|ZP_06658476.1| pyridoxine 5'-phosphate synthase [Escherichia coli B185]
 gi|291433481|gb|EFF06460.1| pyridoxine 5'-phosphate synthase [Escherichia coli B185]
          Length = 243

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRNAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|170767556|ref|ZP_02902009.1| pyridoxine 5'-phosphate synthase [Escherichia albertii TW07627]
 gi|170123890|gb|EDS92821.1| pyridoxine 5'-phosphate synthase [Escherichia albertii TW07627]
          Length = 243

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRGKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGIQVSLFIDADEEQI--KAAADVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AASFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|295097903|emb|CBK86993.1| pyridoxine 5'-phosphate synthase [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 243

 Score =  267 bits (682), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 82/247 (33%), Positives = 125/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D       +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIACETKPHFCCLVPEKRQEVTTEGGLDVAGQLDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +   +AA   GA  IE++TG Y    N+  Q    L ++A 
Sbjct: 121 KRLADAGILVSLFIDADFTQI--KAAADVGAPYIEIHTGCYADAENDAAQA-KELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVSEMKR 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMLEARQ 243


>gi|260551502|ref|ZP_05825686.1| pyridoxal phosphate biosynthesis protein [Acinetobacter sp.
           RUH2624]
 gi|260405496|gb|EEW98989.1| pyridoxal phosphate biosynthesis protein [Acinetobacter sp.
           RUH2624]
          Length = 241

 Score =  266 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 76/249 (30%), Positives = 125/249 (50%), Gaps = 9/249 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTTYPDPVEAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R        K  +N+E    +  +   +  KP+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RP-----LLKTRMNLELAVTDEMVEFAKEIKPQHVCFVPEKRQEVTTEGGLDVVTNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  LG  +SLF D +  +    AA   GA  IEL+TG Y       +Q+   L 
Sbjct: 116 KAATQALAALGCDVSLFIDADFAQI--DAAVACGAPTIELHTGAYADAATEQEQQ-EELA 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A    L +NAGH L ++NI   I AIP I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIVKGVEYAASKGLVVNAGHGLNLKNIAP-IAAIPQIHELNIGHSIIADSVFVGLAQAVK 231

Query: 241 CFRRACGQH 249
             ++A    
Sbjct: 232 DMKKAIQAA 240


>gi|311278503|ref|YP_003940734.1| pyridoxal phosphate biosynthetic protein PdxJ [Enterobacter cloacae
           SCF1]
 gi|308747698|gb|ADO47450.1| pyridoxal phosphate biosynthetic protein PdxJ [Enterobacter cloacae
           SCF1]
          Length = 243

 Score =  266 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 81/246 (32%), Positives = 125/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIACETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y        Q    L ++A 
Sbjct: 121 KRLADAGIQVSLFIDADDEQI--KAAAEVGAPYIEIHTGCYADAETEDAQA-KELARIAR 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|323968012|gb|EGB63424.1| pyridoxine 5'-phosphate synthase [Escherichia coli M863]
 gi|327252274|gb|EGE63946.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           STEC_7v]
          Length = 243

 Score =  266 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 79/246 (32%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVEIKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++  
Sbjct: 121 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARITK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|284922514|emb|CBG35601.1| pyridoxine 5'-phosphate synthase [Escherichia coli 042]
          Length = 243

 Score =  266 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 78/246 (31%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D +  +   +A+   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLAEAGIQVSLFIDADEEQI--KASAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|91227849|ref|ZP_01262022.1| pyridoxal phosphate biosynthetic protein [Vibrio alginolyticus
           12G01]
 gi|91188359|gb|EAS74655.1| pyridoxal phosphate biosynthetic protein [Vibrio alginolyticus
           12G01]
          Length = 244

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 77/250 (30%), Positives = 132/250 (52%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  -----ETIQTRMNLEMAVTDEMIEIALQTKPEFVCLVPEKREELTTEGGLDVVGQLEKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L + G ++SLF D +  +   +AAK  GA  IEL+TG Y        +++  L K
Sbjct: 118 AATKKLTDAGIKVSLFIDADRQQI--EAAKKCGAPFIELHTGHYADATTE-DEQQAELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G+ +AV  
Sbjct: 175 IAAGASYAHDLGIIVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLNKAVAD 233

Query: 242 FRRACGQHLD 251
            +    +   
Sbjct: 234 MKALMIEARQ 243


>gi|262273707|ref|ZP_06051520.1| pyridoxine 5'-phosphate synthase [Grimontia hollisae CIP 101886]
 gi|262222122|gb|EEY73434.1| pyridoxine 5'-phosphate synthase [Grimontia hollisae CIP 101886]
          Length = 243

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 77/247 (31%), Positives = 129/247 (52%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R   +P+ VH  +IA ++GA G+T+H R D+RHI+  D+  ++   
Sbjct: 6   LGVNIDHVATVRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHIKDRDVYLLK--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    +  +N+    KP  + LVP+   +LT++ G D       +    
Sbjct: 63  --ETIQTRMNLEMAVTDEMVNIALEVKPAYVCLVPEKREELTTEGGLDVAGQLEKVKAAT 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L   G ++SLF D +  +    AAK  GA  IEL+TG Y     + ++ +  L K+A 
Sbjct: 121 ETLTAAGIKVSLFIDADRAQI--DAAKACGAPFIELHTGRYAEASTD-EEMQAELKKIAA 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + +++NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV   + 
Sbjct: 178 GASYAADLGIKVNAGHGLTYHNVKP-IAAIPEIYELNIGHAIIGRAVFDGLHKAVADMKA 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMLEARR 243


>gi|82777990|ref|YP_404339.1| pyridoxine 5'-phosphate synthase [Shigella dysenteriae Sd197]
 gi|309784621|ref|ZP_07679256.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella dysenteriae
           1617]
 gi|91207568|sp|Q32CV7|PDXJ_SHIDS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|81242138|gb|ABB62848.1| pyridoxine biosynthesis [Shigella dysenteriae Sd197]
 gi|308927518|gb|EFP72990.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella dysenteriae
           1617]
          Length = 243

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGQDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|183599774|ref|ZP_02961267.1| hypothetical protein PROSTU_03281 [Providencia stuartii ATCC 25827]
 gi|188022037|gb|EDU60077.1| hypothetical protein PROSTU_03281 [Providencia stuartii ATCC 25827]
          Length = 243

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 77/246 (31%), Positives = 124/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  ++   
Sbjct: 6   LGVNIDHIATVRNARGTQYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDIELLK--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    E  +N+  R KP    LVP+   ++T++ G D       +T  V
Sbjct: 63  --ETIQTRMNLEMAVTEEMINIACRVKPAFCCLVPEKREEVTTEGGLDVAGQLPKITDAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D +  +    AA+  GA  IE++TG Y       +QE I   ++  
Sbjct: 121 KRLTEAGIQVSLFIDADHTQI--DAAQAAGAPFIEIHTGAYADAKTEQEQE-IEYRRIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
               A    L++NAGH LT  N+   I  +P I E+++GHA    AL  G+  AV   ++
Sbjct: 178 GVAYAAGKGLKVNAGHGLTYHNVQR-IALLPEIYELNIGHAIIGRALFSGLANAVADMKK 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LLREAR 242


>gi|301024851|ref|ZP_07188488.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 69-1]
 gi|300396382|gb|EFJ79920.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 69-1]
          Length = 248

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 67

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 68  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 126 KRLAEAGIQVSLFIDADEGQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241

Query: 245 ACGQHL 250
              +  
Sbjct: 242 LMLEAR 247


>gi|296104239|ref|YP_003614385.1| pyridoxine 5-phosphate synthase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058698|gb|ADF63436.1| pyridoxine 5-phosphate synthase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 243

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 81/247 (32%), Positives = 127/247 (51%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLTIACDTKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +   +AA   GA  IE++TG Y    N+  ++   L ++A 
Sbjct: 121 KRLADAGILVSLFIDADAEQI--KAAADVGAPYIEIHTGCYADAKND-AEQAKELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVSEMKR 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMLEARQ 243


>gi|300817659|ref|ZP_07097874.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 107-1]
 gi|300820757|ref|ZP_07100907.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 119-7]
 gi|300904252|ref|ZP_07122111.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 84-1]
 gi|300927059|ref|ZP_07142811.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 182-1]
 gi|300927690|ref|ZP_07143258.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 187-1]
 gi|300951718|ref|ZP_07165537.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 116-1]
 gi|300958795|ref|ZP_07170907.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 175-1]
 gi|301302931|ref|ZP_07209059.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 124-1]
 gi|301330334|ref|ZP_07222981.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 78-1]
 gi|301648328|ref|ZP_07248068.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 146-1]
 gi|331643188|ref|ZP_08344323.1| pyridoxine 5'-phosphate synthase [Escherichia coli H736]
 gi|331654026|ref|ZP_08355027.1| pyridoxine 5'-phosphate synthase [Escherichia coli M718]
 gi|331678560|ref|ZP_08379235.1| pyridoxine 5'-phosphate synthase [Escherichia coli H591]
 gi|300314543|gb|EFJ64327.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 175-1]
 gi|300403785|gb|EFJ87323.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 84-1]
 gi|300416943|gb|EFK00254.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 182-1]
 gi|300449002|gb|EFK12622.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 116-1]
 gi|300464243|gb|EFK27736.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 187-1]
 gi|300526510|gb|EFK47579.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 119-7]
 gi|300529647|gb|EFK50709.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 107-1]
 gi|300841866|gb|EFK69626.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 124-1]
 gi|300843668|gb|EFK71428.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 78-1]
 gi|301073604|gb|EFK88410.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 146-1]
 gi|315256592|gb|EFU36560.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 85-1]
 gi|324020022|gb|EGB89241.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 117-3]
 gi|331039986|gb|EGI12206.1| pyridoxine 5'-phosphate synthase [Escherichia coli H736]
 gi|331048875|gb|EGI20951.1| pyridoxine 5'-phosphate synthase [Escherichia coli M718]
 gi|331075020|gb|EGI46340.1| pyridoxine 5'-phosphate synthase [Escherichia coli H591]
          Length = 248

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 67

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 68  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 126 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241

Query: 245 ACGQHL 250
              +  
Sbjct: 242 LMLEAR 247


>gi|300898321|ref|ZP_07116669.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 198-1]
 gi|300357983|gb|EFJ73853.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 198-1]
          Length = 248

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 67

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 68  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 126 KRLAEAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241

Query: 245 ACGQHL 250
              +  
Sbjct: 242 LMLEAR 247


>gi|224025359|ref|ZP_03643725.1| hypothetical protein BACCOPRO_02098 [Bacteroides coprophilus DSM
           18228]
 gi|224018595|gb|EEF76593.1| hypothetical protein BACCOPRO_02098 [Bacteroides coprophilus DSM
           18228]
          Length = 237

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 139/245 (56%), Gaps = 9/245 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    P++  +     + GA G+TVHPRPD+RHIRY D+  +R
Sbjct: 1   MTKLSVNINKVATLRNARGGNNPDVEKVALDCERFGAEGITVHPRPDERHIRYADVYALR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   K E NIEGYP++ F++L  + KP Q+TLVPD P Q+TS+ GWD   NQ+ L 
Sbjct: 61  P-----LLKTEFNIEGYPSKEFIDLVLKVKPHQVTLVPDAPDQITSNAGWDTKTNQSFLA 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             +    N G R S+F     +   ++ A   GAD +ELYT PY + Y    +  +    
Sbjct: 116 DLMETFGNAGIRTSIFVG--TDAEMIEYAAKAGADRVELYTEPYASLYLESPEAAVA--P 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A++ + + + +NAGHDL++ N+     +IP++ E+S+GHA    AL  G+++ +  
Sbjct: 172 FVEAAKITRSLGMGLNAGHDLSLVNLKYFHESIPWLDEVSIGHALICDALYLGLEKTIKE 231

Query: 242 FRRAC 246
           ++   
Sbjct: 232 YKTCL 236


>gi|116734172|gb|ABK20147.1| pyridoxal phosphate biosynthetic protein [Shigella boydii]
          Length = 243

 Score =  266 bits (680), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 79/246 (32%), Positives = 125/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGTTVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLTDAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELVRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+ V   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDTVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|195941199|ref|ZP_03086581.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           O157:H7 str. EC4024]
          Length = 239

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 81/247 (32%), Positives = 126/247 (51%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 2   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 58

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D       +    
Sbjct: 59  --QTLDTRMNLEMAVTEEMLTIACDTKPHFCCLVPEKRQEVTTEGGLDVAGQLDKMRDAC 116

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +   +AA   GA  IE++TG Y    N+  ++   L ++A 
Sbjct: 117 KRLADAGILVSLFIDADFAQI--KAAADVGAPYIEIHTGCYADAKND-AEQAKELERIAK 173

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 174 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVSEMKR 232

Query: 245 ACGQHLD 251
              +   
Sbjct: 233 LMLEARQ 239


>gi|300920732|ref|ZP_07137138.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 115-1]
 gi|300412303|gb|EFJ95613.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 115-1]
          Length = 248

 Score =  266 bits (679), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 67

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 68  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 126 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241

Query: 245 ACGQHL 250
              +  
Sbjct: 242 LMLEAR 247


>gi|294493163|gb|ADE91919.1| pyridoxine 5'-phosphate synthase [Escherichia coli IHE3034]
          Length = 243

 Score =  266 bits (679), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 79/246 (32%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVCILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +A    GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGIQVSLFIDADEEQI--KAVAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFATSLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|26248929|ref|NP_754969.1| pyridoxine 5'-phosphate synthase [Escherichia coli CFT073]
 gi|227887600|ref|ZP_04005405.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           83972]
 gi|300982268|ref|ZP_07175979.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 45-1]
 gi|301047203|ref|ZP_07194295.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 185-1]
 gi|26109335|gb|AAN81537.1|AE016764_219 Pyridoxal phosphate biosynthetic protein pdxJ [Escherichia coli
           CFT073]
 gi|227835950|gb|EEJ46416.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           83972]
 gi|300300880|gb|EFJ57265.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 185-1]
 gi|300408822|gb|EFJ92360.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 45-1]
 gi|315292460|gb|EFU51812.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 153-1]
          Length = 248

 Score =  266 bits (679), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 128/246 (52%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVCILR--- 67

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 68  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D + ++   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 126 KRLADAGIQVSLFIDADEDQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFATSLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241

Query: 245 ACGQHL 250
              +  
Sbjct: 242 LMLEAR 247


>gi|91211890|ref|YP_541876.1| pyridoxine 5'-phosphate synthase [Escherichia coli UTI89]
 gi|117624785|ref|YP_853698.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           APEC O1]
 gi|237705074|ref|ZP_04535555.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia sp.
           3_2_53FAA]
 gi|300974164|ref|ZP_07172482.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 200-1]
 gi|331648310|ref|ZP_08349399.1| pyridoxine 5'-phosphate synthase [Escherichia coli M605]
 gi|91073464|gb|ABE08345.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           UTI89]
 gi|115513909|gb|ABJ01984.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           APEC O1]
 gi|226901440|gb|EEH87699.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia sp.
           3_2_53FAA]
 gi|300308903|gb|EFJ63423.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 200-1]
 gi|315288041|gb|EFU47443.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 110-3]
 gi|315300509|gb|EFU59738.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 16-3]
 gi|324014391|gb|EGB83610.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 60-1]
 gi|331042859|gb|EGI15000.1| pyridoxine 5'-phosphate synthase [Escherichia coli M605]
          Length = 248

 Score =  266 bits (679), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVCILR--- 67

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 68  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 126 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFATSLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241

Query: 245 ACGQHL 250
              +  
Sbjct: 242 LMLEAR 247


>gi|323188321|gb|EFZ73613.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           RN587/1]
          Length = 243

 Score =  266 bits (679), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVCILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFATSLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEVR 242


>gi|163802961|ref|ZP_02196848.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio sp. AND4]
 gi|159173251|gb|EDP58079.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio sp. AND4]
          Length = 243

 Score =  266 bits (679), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 75/250 (30%), Positives = 128/250 (51%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + +PE + LVP+   +LT++ G D       + 
Sbjct: 63  -----ETIQTRMNLEMAVTDEMVEIALKTQPEFVCLVPEKREELTTEGGLDVAGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  +EL+TG Y        Q+   L K
Sbjct: 118 AATHKLTEAGIKVSLFIDADRQQI--DAAKACGAPYVELHTGHYADATTEEDQQ-DELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G++++V  
Sbjct: 175 IAAGASYADDLGIIVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLEKSVAD 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKAIMVAARK 243


>gi|157144500|ref|YP_001451819.1| pyridoxine 5'-phosphate synthase [Citrobacter koseri ATCC BAA-895]
 gi|157081705|gb|ABV11383.1| hypothetical protein CKO_00218 [Citrobacter koseri ATCC BAA-895]
          Length = 243

 Score =  265 bits (678), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGILVSLFIDADEEQI--KAAADVGAPYIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNVQA-IAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|324008473|gb|EGB77692.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 57-2]
          Length = 248

 Score =  265 bits (678), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVCILR--- 67

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 68  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 126 KRLAEAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241

Query: 245 ACGQHL 250
              +  
Sbjct: 242 LMLEAR 247


>gi|254230527|ref|ZP_04923898.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio sp. Ex25]
 gi|262393273|ref|YP_003285127.1| pyridoxine 5'-phosphate synthase [Vibrio sp. Ex25]
 gi|151936952|gb|EDN55839.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio sp. Ex25]
 gi|262336867|gb|ACY50662.1| pyridoxine 5'-phosphate synthase [Vibrio sp. Ex25]
          Length = 243

 Score =  265 bits (678), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 76/250 (30%), Positives = 132/250 (52%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + +PE + LVP+   +LT++ G D +     + 
Sbjct: 63  -----ETIQTRMNLEMAVTDEMVEIALQTQPEFVCLVPEKREELTTEGGLDVVGQLEKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L + G ++SLF D +  +   +AAK  GA  IEL+TG Y        +++  L K
Sbjct: 118 AATKKLTDAGIKVSLFIDADRQQI--EAAKKCGAPFIELHTGHYADATTE-DEQQAELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G+ +AV  
Sbjct: 175 IAAGASYAHDLGIIVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLNKAVAD 233

Query: 242 FRRACGQHLD 251
            +    +   
Sbjct: 234 MKALMIEARQ 243


>gi|309794382|ref|ZP_07688805.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 145-7]
 gi|308121838|gb|EFO59100.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 145-7]
          Length = 248

 Score =  265 bits (678), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 67

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 68  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 126 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AAIFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241

Query: 245 ACGQHL 250
              +  
Sbjct: 242 LMLEAR 247


>gi|258622342|ref|ZP_05717367.1| Pyridoxine 5'-phosphate synthase [Vibrio mimicus VM573]
 gi|262166499|ref|ZP_06034236.1| pyridoxine 5'-phosphate synthase [Vibrio mimicus VM223]
 gi|258585358|gb|EEW10082.1| Pyridoxine 5'-phosphate synthase [Vibrio mimicus VM573]
 gi|262026215|gb|EEY44883.1| pyridoxine 5'-phosphate synthase [Vibrio mimicus VM223]
          Length = 243

 Score =  265 bits (678), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 80/250 (32%), Positives = 130/250 (52%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  IEL+TG Y    +   +++  L K
Sbjct: 118 AATEKLTAAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYSDAKSE-VEQQNELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV  
Sbjct: 175 IAAAASYAHDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLSKAVAD 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKAIMVAARR 243


>gi|212710659|ref|ZP_03318787.1| hypothetical protein PROVALCAL_01725 [Providencia alcalifaciens DSM
           30120]
 gi|212686740|gb|EEB46268.1| hypothetical protein PROVALCAL_01725 [Providencia alcalifaciens DSM
           30120]
          Length = 243

 Score =  265 bits (678), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 124/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A Q+GA G+T+H R D+RHI   D+  +    
Sbjct: 6   LGVNIDHIATVRNARGTQYPDPVQAAFVAEQAGADGITIHLREDRRHITDRDVELL---- 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    E  +++  R KP    LVP+   ++T++ G D    +  +   V
Sbjct: 62  -NKTIQTRMNLEMAVTEEMIDIACRIKPTYCCLVPEKREEVTTEGGLDVAGQKQKVAFAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D   +   + AA+  GA  IE++TG Y       +QE +   ++  
Sbjct: 121 KRLTDAGILVSLFIDA--DHKQIDAAQECGAPFIEIHTGAYADAKTEQEQE-LEFRRIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
               A    +++NAGH LT  N+   I A+P I E+++GHA    AL  G+ +AV   + 
Sbjct: 178 GVSYAAGKGIKVNAGHGLTYHNVQR-IAALPEIYELNIGHAIIGRALFSGLSQAVSDMKN 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LLIEARK 243


>gi|262040300|ref|ZP_06013551.1| pyridoxal phosphate biosynthetic protein PdxJ [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|259042409|gb|EEW43429.1| pyridoxal phosphate biosynthetic protein PdxJ [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
          Length = 243

 Score =  265 bits (678), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLTIACETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 QRLADAGILVSLFIDADQAQI--KAAADVGAPYIEIHTGCYADAKTD-AEQARELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|237732550|ref|ZP_04563031.1| pyridoxine 5'-phosphate synthase [Citrobacter sp. 30_2]
 gi|226908089|gb|EEH94007.1| pyridoxine 5'-phosphate synthase [Citrobacter sp. 30_2]
          Length = 243

 Score =  265 bits (678), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 79/246 (32%), Positives = 125/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    I  Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIVEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L++    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLSIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGILVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQASELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I  IP + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIARIPEMHELNIGHAIIGRAVMSGLKEAVVEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|256017287|ref|ZP_05431152.1| pyridoxine 5'-phosphate synthase [Shigella sp. D9]
          Length = 243

 Score =  265 bits (677), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 79/246 (32%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL +   ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAWIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|206580518|ref|YP_002237093.1| pyridoxine 5'-phosphate synthase [Klebsiella pneumoniae 342]
 gi|288934055|ref|YP_003438114.1| pyridoxal phosphate biosynthetic protein PdxJ [Klebsiella variicola
           At-22]
 gi|290508251|ref|ZP_06547622.1| pyridoxine 5'-phosphate synthase [Klebsiella sp. 1_1_55]
 gi|206569576|gb|ACI11352.1| pyridoxine 5'-phosphate synthase [Klebsiella pneumoniae 342]
 gi|288888784|gb|ADC57102.1| pyridoxal phosphate biosynthetic protein PdxJ [Klebsiella variicola
           At-22]
 gi|289777645|gb|EFD85642.1| pyridoxine 5'-phosphate synthase [Klebsiella sp. 1_1_55]
          Length = 243

 Score =  265 bits (677), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 125/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --ETLHTRMNLEMAVTEEMLTIACETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +   +AA   GA  IE++TG Y     +  Q    L ++A 
Sbjct: 121 QRLADAGILVSLFIDADNEQI--KAAADVGAPYIEIHTGCYADAKTDAGQA-KELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|261211552|ref|ZP_05925840.1| pyridoxine 5'-phosphate synthase [Vibrio sp. RC341]
 gi|260839507|gb|EEX66133.1| pyridoxine 5'-phosphate synthase [Vibrio sp. RC341]
          Length = 243

 Score =  265 bits (677), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 81/250 (32%), Positives = 129/250 (51%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  IEL+TG Y    +   Q+   L K
Sbjct: 118 AATEKLTAAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYSDAKSEVDQQ-NELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV  
Sbjct: 175 IAAAASYAHDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLAKAVAD 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKAIMVAARR 243


>gi|238896015|ref|YP_002920751.1| pyridoxine 5'-phosphate synthase [Klebsiella pneumoniae NTUH-K2044]
 gi|238548333|dbj|BAH64684.1| pyridoxal phosphate biosynthetic protein [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
          Length = 243

 Score =  265 bits (677), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLTIACETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 QRLADAGILVSLFIDADEAQI--KAAADVGAPYIEIHTGCYADAKTD-AEQARELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|261340865|ref|ZP_05968723.1| pyridoxine 5'-phosphate synthase [Enterobacter cancerogenus ATCC
           35316]
 gi|288317295|gb|EFC56233.1| pyridoxine 5'-phosphate synthase [Enterobacter cancerogenus ATCC
           35316]
          Length = 243

 Score =  265 bits (677), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 80/247 (32%), Positives = 126/247 (51%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D       +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIACETKPHFCCLVPEKRQEVTTEGGLDVAGQPEKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +   +AA   GA  IE++TG Y    N+  ++   L ++A 
Sbjct: 121 KRLADAGILVSLFIDADDAQI--KAAADAGAPYIEIHTGCYADAKND-AEQAKELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKDAVAEMKR 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMLEARQ 243


>gi|313205321|ref|YP_004043978.1| pyridoxine 5'-phosphate synthase [Paludibacter propionicigenes WB4]
 gi|312444637|gb|ADQ80993.1| pyridoxine 5'-phosphate synthase [Paludibacter propionicigenes WB4]
          Length = 237

 Score =  265 bits (677), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 94/243 (38%), Positives = 145/243 (59%), Gaps = 9/243 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA +RN R    PN+  +     + GA G+TVHPRPD+RHIRY D+ +++
Sbjct: 1   MTKLSVNINKVATIRNARGGNVPNVCQVALDCEKFGAEGITVHPRPDERHIRYADVWDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   K E NIEGYP+  F+ L +  KP Q+TLVPD P  +TS  GWD + +   L 
Sbjct: 61  P-----LLKTEFNIEGYPSPDFIKLVKSVKPHQVTLVPDPPEAITSSAGWDTITHLEFLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + VA   ++G R+S+F D   +  +++ A  TG D +ELYT PY    + P+     +  
Sbjct: 116 EVVADFQSVGIRVSIFID--TDLKNIEFAAKTGTDRVELYTEPY--ATDYPKDREKAIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+LA+ + L +NAGHDL+++N+  +   IP+I E+S+GHA  A AL  G+++ +  
Sbjct: 172 FVAAAKLAKGLGLGLNAGHDLSLENLAYMHKFIPWIDEVSIGHALIADALYFGLEDTIKR 231

Query: 242 FRR 244
           +++
Sbjct: 232 YKK 234


>gi|218265376|ref|ZP_03478775.1| hypothetical protein PRABACTJOHN_04486 [Parabacteroides johnsonii
           DSM 18315]
 gi|218221507|gb|EEC94157.1| hypothetical protein PRABACTJOHN_04486 [Parabacteroides johnsonii
           DSM 18315]
          Length = 243

 Score =  264 bits (676), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 98/245 (40%), Positives = 142/245 (57%), Gaps = 9/245 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T++SVN+N VA +RN R    PN++ +       GA G+TVHPRPD+RHIRY+D+  ++
Sbjct: 1   MTNLSVNINKVATIRNARGGNVPNVLKVALDCEAFGAQGITVHPRPDERHIRYSDVYALK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     K E NIEGYP E F++L  + KP Q+TLVPD P  +TS+ GWD   +   L+
Sbjct: 61  PEI-----KTEFNIEGYPCEKFIDLVLKVKPTQVTLVPDAPDAITSNAGWDVRTHFDQLS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V    + G R S+F     +  +++ A  TG D IELYT PY      PQ     +  
Sbjct: 116 ELVETFTSHGIRTSIFIG--TDLENIEWAAKTGTDRIELYTEPY--ATLYPQNREEAIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               AQLA+ + L +NAGHDL+++N+      IP + E+S+GHA  + AL  G+KE +  
Sbjct: 172 FIAAAQLAKNLGLGVNAGHDLSLENLAYFHQNIPGLDEVSIGHALISDALYYGLKETIRL 231

Query: 242 FRRAC 246
           ++ A 
Sbjct: 232 YKEAL 236


>gi|256821983|ref|YP_003145946.1| pyridoxal phosphate biosynthetic protein PdxJ [Kangiella koreensis
           DSM 16069]
 gi|256795522|gb|ACV26178.1| pyridoxal phosphate biosynthetic protein PdxJ [Kangiella koreensis
           DSM 16069]
          Length = 249

 Score =  264 bits (676), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 78/249 (31%), Positives = 130/249 (52%), Gaps = 9/249 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ +A +RN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  + 
Sbjct: 4   PILLGVNIDHIATVRNARGTDYPDPVQAAFVAEQNGADGITVHLREDRRHITDRDVELL- 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    E  L + ER KP  + LVP+   +LT++ G D    ++ + 
Sbjct: 63  ----ARTIQTRMNLEMAVTEEMLAIAERIKPHYVCLVPEKREELTTEGGLDVKGQESKIK 118

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               R+   G ++SLF D +  + +  AA  TGA  IE++TG Y     + +Q+++ L K
Sbjct: 119 DACHRMAEAGIQVSLFIDADEEQIN--AAARTGAPLIEIHTGAYADA-KSTEQQQVELVK 175

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +    + A    LQ+NAGH L   N+   I AIP I E+++GHA    A+  G+ +AV  
Sbjct: 176 VKHGVEHAVSEGLQVNAGHGLQYHNVQP-IAAIPEIVELNIGHAIIGRAVFSGLDKAVSD 234

Query: 242 FRRACGQHL 250
            ++   +  
Sbjct: 235 MKKLILEAR 243


>gi|300935697|ref|ZP_07150667.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 21-1]
 gi|331674013|ref|ZP_08374776.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA280]
 gi|300459131|gb|EFK22624.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 21-1]
 gi|331069286|gb|EGI40678.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA280]
          Length = 248

 Score =  264 bits (676), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 125/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 67

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 68  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 126 KRLAEAGILVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241

Query: 245 ACGQHL 250
              +  
Sbjct: 242 LMLEAR 247


>gi|332828774|gb|EGK01466.1| pyridoxine 5'-phosphate synthase [Dysgonomonas gadei ATCC BAA-286]
          Length = 250

 Score =  264 bits (676), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 96/247 (38%), Positives = 150/247 (60%), Gaps = 9/247 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P++V +     + GA G+TVHPRPD+RHIR+ D+ +++
Sbjct: 7   MTKLSVNINKIATLRNARGGNIPDVVKVALDCEKFGAQGITVHPRPDERHIRFKDVYDLK 66

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     K ELNIEGYP++ F++L    +P Q+TLVPD P  +TS+ GWD ++NQ LL+
Sbjct: 67  AKI-----KTELNIEGYPSQKFVDLITTIRPTQVTLVPDKPDAITSNAGWDTIENQQLLS 121

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V     +G R S+F     +   ++ A  TG D IELYT PY + Y+  ++  I    
Sbjct: 122 DLVDEFKAVGVRTSIFTG--TDLKIIEFAAKTGTDRIELYTEPYASDYSKDKEAAIAS-- 177

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+ A+K+ L +NAGHDL+++N+  L   IP++ E+S+GHA  + AL  G+++ +  
Sbjct: 178 FIEAAKYAKKLGLGVNAGHDLSLENLHFLYKNIPWLDEVSIGHALISDALYLGLEKTIKA 237

Query: 242 FRRACGQ 248
           ++    +
Sbjct: 238 YKNCLKE 244


>gi|324113091|gb|EGC07067.1| pyridoxine 5'-phosphate synthase [Escherichia fergusonii B253]
 gi|325496356|gb|EGC94215.1| pyridoxine 5'-phosphate synthase [Escherichia fergusonii ECD227]
          Length = 243

 Score =  264 bits (676), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AAAFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|323978406|gb|EGB73491.1| pyridoxine 5'-phosphate synthase [Escherichia coli TW10509]
          Length = 243

 Score =  264 bits (675), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 124/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +PN V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPNPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++  
Sbjct: 121 KRLAEAGILVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARITK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|15803090|ref|NP_289121.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 EDL933]
 gi|25345853|pir||C85902 pyridoxine biosynthesis [imported] - Escherichia coli  (strain
           O157:H7, substrain EDL933)
 gi|12516981|gb|AAG57679.1|AE005487_3 pyridoxine biosynthesis [Escherichia coli O157:H7 str. EDL933]
          Length = 243

 Score =  264 bits (675), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 79/246 (32%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +  LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIXTLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|262368558|ref|ZP_06061887.1| pyridoxine 5'-phosphate synthase [Acinetobacter johnsonii SH046]
 gi|262316236|gb|EEY97274.1| pyridoxine 5'-phosphate synthase [Acinetobacter johnsonii SH046]
          Length = 241

 Score =  264 bits (675), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 72/250 (28%), Positives = 124/250 (49%), Gaps = 9/250 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V+   I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTSYPDPVNAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R  +     K  +N+E    +  +   +  KP  +  VP+   ++T++ G D + +   +
Sbjct: 61  RPAL-----KTRMNLELAVTDEMIAFAKEIKPHHVCFVPEKRQEVTTEGGLDVVGHFDDV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +    AA   GA  IE++TG Y        Q+   L 
Sbjct: 116 KAATQALSEIGCDVSLFIDADFAQI--DAAVACGAPTIEIHTGAYADAETPEAQQ-HELE 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++   A+ A    L +NAGH L ++N+   I  IP I E+++GH+  A A+  G+++AV 
Sbjct: 173 RIVKGAEYAASKGLVVNAGHGLNLENVTP-IAQIPQIHELNIGHSLIADAIFVGLEQAVR 231

Query: 241 CFRRACGQHL 250
             +       
Sbjct: 232 EMKAVIKAAR 241


>gi|254226242|ref|ZP_04919835.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae V51]
 gi|125621215|gb|EAZ49556.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae V51]
          Length = 243

 Score =  264 bits (675), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 81/250 (32%), Positives = 130/250 (52%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTSYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  IEL+TG Y    ++  Q+   L K
Sbjct: 118 AATEKLTAAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYSDAKSDVDQQ-NELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV  
Sbjct: 175 IAAAAAYAHDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLAKAVAD 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKAIMVAARR 243


>gi|161502270|ref|YP_001569382.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160863617|gb|ABX20240.1| hypothetical protein SARI_00300 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 243

 Score =  264 bits (675), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 129/246 (52%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTDYPDPVQAAFIAEQAGADGITVHLREDRRHISDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    +P    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLAIAVETRPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G ++SLF D +  + +  AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 SRLAAAGIQVSLFIDADEAQIN--AAAEVGAPFIEIHTGCYANAKTD-AEQSKELARIAS 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A LA ++ L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATLAVRLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|121728972|ref|ZP_01681976.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae V52]
 gi|147675577|ref|YP_001217960.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae O395]
 gi|262167289|ref|ZP_06034999.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae RC27]
 gi|121628738|gb|EAX61205.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae V52]
 gi|146317460|gb|ABQ21999.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           O395]
 gi|227014350|gb|ACP10560.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           O395]
 gi|262024264|gb|EEY42955.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae RC27]
          Length = 243

 Score =  264 bits (675), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 81/250 (32%), Positives = 130/250 (52%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  IEL+TG Y    ++  Q+   L K
Sbjct: 118 AATEKLTAAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYSDAKSDVDQQ-NELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV  
Sbjct: 175 IAAAAAYAHDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLAKAVSD 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKAIMVAARR 243


>gi|283786180|ref|YP_003366045.1| pyridoxine 5'-phosphate synthase [Citrobacter rodentium ICC168]
 gi|282949634|emb|CBG89253.1| pyridoxine 5'-phosphate synthase [Citrobacter rodentium ICC168]
          Length = 243

 Score =  264 bits (675), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 79/246 (32%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    +P    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETQPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGILVSLFIDADEAQI--KAAAEVGAPYIEIHTGCYADAQTD-AEQAQELARIAR 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|256421081|ref|YP_003121734.1| pyridoxine 5'-phosphate synthase [Chitinophaga pinensis DSM 2588]
 gi|256035989|gb|ACU59533.1| pyridoxal phosphate biosynthetic protein PdxJ [Chitinophaga
           pinensis DSM 2588]
          Length = 245

 Score =  264 bits (675), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 97/250 (38%), Positives = 145/250 (58%), Gaps = 10/250 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N  A LRN R    P+++ + +   + GA G+TVHPRPD+RHIRY D+ +++
Sbjct: 1   MTKLSVNINKFATLRNARGGNMPDILKVAQDCERFGADGITVHPRPDERHIRYQDVIDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L+       E NIEGYP++ F++L    KP Q TLVPD P  +TS+ GWD +Q+Q+ L 
Sbjct: 61  PLVT-----TEFNIEGYPSKEFMDLVLSVKPHQATLVPDPPDAITSNTGWDTIQHQSFLR 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY---NNPQQERIF 178
           + +  L   G R+S+F +   ++  ++AAK  GAD IELYTGPY   +       Q    
Sbjct: 116 EVIGTLKAAGIRVSIFLNAETDK--VEAAKTAGADRIELYTGPYAEEFERARTQPQNLQL 173

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
            N    TA+ A    L++NAGHDL + N+      IP + E+S+GHA    AL  G++  
Sbjct: 174 FNAYKDTARAATATGLELNAGHDLNLDNLRFFKLHIPQLKEVSIGHALVCDALYYGLENT 233

Query: 239 VFCFRRACGQ 248
           +  ++R   +
Sbjct: 234 IQLYKRQLTE 243


>gi|150008179|ref|YP_001302922.1| pyridoxine 5'-phosphate synthase [Parabacteroides distasonis ATCC
           8503]
 gi|255015132|ref|ZP_05287258.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 2_1_7]
 gi|301309704|ref|ZP_07215643.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 20_3]
 gi|166219102|sp|A6LC86|PDXJ_PARD8 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|149936603|gb|ABR43300.1| pyridoxal phosphate biosynthetic protein PdxJ [Parabacteroides
           distasonis ATCC 8503]
 gi|300831278|gb|EFK61909.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 20_3]
          Length = 238

 Score =  264 bits (675), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 138/246 (56%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T++SVN+N VA +RN R    PN++ + +     GA G+TVHPRPD+RHIRY+D+  ++
Sbjct: 1   MTNLSVNINKVATIRNARGGNMPNVLKVAQDCELFGAQGITVHPRPDERHIRYSDVYGLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP + F++L  + KP Q+TLVPD P  +TS+ GW+   N   L+
Sbjct: 61  P-----LIRTEFNIEGYPCDKFIDLVLKVKPTQVTLVPDAPDAITSNSGWNVKDNFDYLS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V    + G R S+F   +      + A  TG D IELYT PY      P+     +  
Sbjct: 116 ELVDTFTSQGIRTSIFVGTDLANI--ELAAKTGTDRIELYTEPY--ATYYPEDRDKAIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               AQLA+ + L +NAGHDL ++N+      IP++ E+S+GHA    AL  G++E +  
Sbjct: 172 FVEAAQLAKNLGLGVNAGHDLNLENLAFFNKNIPWLEEVSIGHALICDALYHGLQETIAL 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKACLN 237


>gi|283832044|ref|ZP_06351785.1| pyridoxine 5'-phosphate synthase [Citrobacter youngae ATCC 29220]
 gi|291071663|gb|EFE09772.1| pyridoxine 5'-phosphate synthase [Citrobacter youngae ATCC 29220]
          Length = 243

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 78/246 (31%), Positives = 124/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    I  Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIVEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 KRLADAGILVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQASELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I  IP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIARIPEMHELNIGHAIIGRAVMSGLKDAVVEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|258626726|ref|ZP_05721548.1| Pyridoxine 5'-phosphate synthase [Vibrio mimicus VM603]
 gi|262170593|ref|ZP_06038271.1| pyridoxine 5'-phosphate synthase [Vibrio mimicus MB-451]
 gi|258580982|gb|EEW05909.1| Pyridoxine 5'-phosphate synthase [Vibrio mimicus VM603]
 gi|261891669|gb|EEY37655.1| pyridoxine 5'-phosphate synthase [Vibrio mimicus MB-451]
          Length = 243

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 80/250 (32%), Positives = 130/250 (52%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  IEL+TG Y    +   +++  L K
Sbjct: 118 AATEKLTAAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYSDAKSE-VEQQNELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV  
Sbjct: 175 IAAAAAYAHDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLSKAVAD 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKAIMVAARR 243


>gi|16765898|ref|NP_461513.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|167549390|ref|ZP_02343149.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167992709|ref|ZP_02573805.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168238323|ref|ZP_02663381.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168243368|ref|ZP_02668300.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168261371|ref|ZP_02683344.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|194445975|ref|YP_002041841.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194447787|ref|YP_002046640.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194736368|ref|YP_002115641.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197265398|ref|ZP_03165472.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198243503|ref|YP_002216645.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|204929408|ref|ZP_03220482.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205353674|ref|YP_002227475.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207857985|ref|YP_002244636.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|20139015|sp|Q8ZN19|PDXJ_SALTY RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|16421125|gb|AAL21472.1| carries out condensation and ring closure step after PdxA in
           pyridoxine biosynthesis [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|194404638|gb|ACF64860.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194406091|gb|ACF66310.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194711870|gb|ACF91091.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197243653|gb|EDY26273.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197288846|gb|EDY28219.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197938019|gb|ACH75352.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|204321127|gb|EDZ06327.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205273455|emb|CAR38432.1| Pyridoxal phosphate biosynthetic protein pdxJ [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205325212|gb|EDZ13051.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205329096|gb|EDZ15860.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205337566|gb|EDZ24330.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205349515|gb|EDZ36146.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206709788|emb|CAR34140.1| Pyridoxal phosphate biosynthetic protein pdxJ [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|261247773|emb|CBG25601.1| PNP synthase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267994704|gb|ACY89589.1| pyridoxal phosphate biosynthetic protein PdxJ [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301159126|emb|CBW18640.1| Pyridoxal phosphate biosynthetic protein pdxJ [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|312913567|dbj|BAJ37541.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321222717|gb|EFX47788.1| Pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322613348|gb|EFY10290.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620448|gb|EFY17313.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625084|gb|EFY21913.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629472|gb|EFY26248.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322633859|gb|EFY30598.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635465|gb|EFY32176.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322639859|gb|EFY36538.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644255|gb|EFY40799.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649947|gb|EFY46367.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322654870|gb|EFY51187.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658202|gb|EFY54468.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322661726|gb|EFY57944.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669707|gb|EFY65853.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673286|gb|EFY69391.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322674925|gb|EFY71012.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682948|gb|EFY78966.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322685609|gb|EFY81604.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323130909|gb|ADX18339.1| pyridoxal phosphate biosynthetic protein PdxJ [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|323191963|gb|EFZ77201.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323200404|gb|EFZ85485.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323201304|gb|EFZ86371.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323208374|gb|EFZ93314.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211550|gb|EFZ96388.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323215982|gb|EGA00714.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221763|gb|EGA06171.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225629|gb|EGA09856.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229347|gb|EGA13471.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235338|gb|EGA19422.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237476|gb|EGA21539.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245231|gb|EGA29232.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323248805|gb|EGA32732.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323254015|gb|EGA37836.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323259063|gb|EGA42711.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323261985|gb|EGA45550.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323267769|gb|EGA51250.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269672|gb|EGA53124.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326624400|gb|EGE30745.1| pyridoxal phosphate biosynthetic protein PdxJ [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|326628778|gb|EGE35121.1| pyridoxal phosphate biosynthetic protein PdxJ [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
 gi|332989505|gb|AEF08488.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 243

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 81/246 (32%), Positives = 129/246 (52%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTDYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    +P    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLAIAVETRPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL   G ++SLF D +  + +  AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 ARLAAAGIQVSLFIDADETQIN--AAAEVGAPFIEIHTGCYANAETD-AEQAKELARIAS 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A LA ++ L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATLAARLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMTGLKEAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|260771919|ref|ZP_05880837.1| pyridoxine 5'-phosphate synthase [Vibrio metschnikovii CIP 69.14]
 gi|260613211|gb|EEX38412.1| pyridoxine 5'-phosphate synthase [Vibrio metschnikovii CIP 69.14]
          Length = 243

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 82/250 (32%), Positives = 130/250 (52%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI+  D+  +R
Sbjct: 3   SILLGVNIDHVATLRNARGTRYPDPVHAAEIAERAGADGITIHLREDRRHIQDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  L +    +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMLEIALNTQPEFVCLVPEKREELTTEGGLDVLGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  IEL+TG Y    N   +++  L K
Sbjct: 118 AATEKLTTAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYAEASNE-TEQQNELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV  
Sbjct: 175 IAAAAAYASDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIVGRAVFDGLSKAVAD 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKAIMDNVRR 243


>gi|27364937|ref|NP_760465.1| pyridoxine 5'-phosphate synthase [Vibrio vulnificus CMCP6]
 gi|37681012|ref|NP_935621.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio vulnificus
           YJ016]
 gi|320155323|ref|YP_004187702.1| pyridoxine 5'-phosphate synthase [Vibrio vulnificus MO6-24/O]
 gi|30316012|sp|Q8DC73|PDXJ_VIBVU RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|61214243|sp|Q7MHP1|PDXJ_VIBVY RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|27361083|gb|AAO09992.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio vulnificus
           CMCP6]
 gi|37199762|dbj|BAC95592.1| pyridoxal phosphate biosynthesis protein [Vibrio vulnificus YJ016]
 gi|319930635|gb|ADV85499.1| pyridoxine 5'-phosphate synthase [Vibrio vulnificus MO6-24/O]
          Length = 243

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 78/250 (31%), Positives = 127/250 (50%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  ++A ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTKYPDPVHAAEVAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + +PE + LVP+   +LT++ G D   +   + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMIEIALKTQPEYVCLVPEKREELTTEGGLDVAGHLDKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  IEL+TG Y        Q    L K
Sbjct: 118 AATEKLTAAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYADAATEADQ-LDELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GHA    A+  G+ +AV  
Sbjct: 175 IAAGASYAADLGITVNAGHGLTYHNVAP-IAALPEIYELNIGHAIIGRAVFDGLHKAVAD 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKAIMVAARQ 243


>gi|256840633|ref|ZP_05546141.1| pyridoxine 5'-phosphate synthase [Parabacteroides sp. D13]
 gi|256737905|gb|EEU51231.1| pyridoxine 5'-phosphate synthase [Parabacteroides sp. D13]
          Length = 238

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 138/246 (56%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T++SVN+N VA +RN R    PN++ + +     GA G+TVHPRPD+RHIRY+D+  ++
Sbjct: 1   MTNLSVNINKVATIRNARGGNMPNVLKVAQDCELFGAQGITVHPRPDERHIRYSDVYGLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP + F++L  + KP Q+TLVPD P  +TS+ GW+   N   L+
Sbjct: 61  P-----LIRTEFNIEGYPCDKFIDLVLKVKPTQVTLVPDAPDAITSNSGWNVKDNFDYLS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V    + G R S+F   +      + A  TG D IELYT PY      P+     +  
Sbjct: 116 ELVDTFTSQGIRTSIFVGTDLANI--ELAAKTGTDRIELYTEPY--ATFYPEDRDKAIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               AQLA+ + L +NAGHDL ++N+      IP++ E+S+GHA    AL  G++E +  
Sbjct: 172 FVEAAQLAKNLGLGVNAGHDLNLENLAFFNKNIPWLEEVSIGHALICDALYHGLQETIAL 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKACLN 237


>gi|15642454|ref|NP_232087.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121590989|ref|ZP_01678308.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           2740-80]
 gi|153803089|ref|ZP_01957675.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           MZO-3]
 gi|153826910|ref|ZP_01979577.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           MZO-2]
 gi|153830869|ref|ZP_01983536.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           623-39]
 gi|227082579|ref|YP_002811130.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           M66-2]
 gi|229507482|ref|ZP_04396987.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae BX 330286]
 gi|229512323|ref|ZP_04401802.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae B33]
 gi|229514084|ref|ZP_04403546.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae TMA 21]
 gi|229519459|ref|ZP_04408902.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae RC9]
 gi|229524445|ref|ZP_04413850.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae bv. albensis
           VL426]
 gi|229527065|ref|ZP_04416460.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae 12129(1)]
 gi|229606987|ref|YP_002877635.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae MJ-1236]
 gi|254291658|ref|ZP_04962446.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           AM-19226]
 gi|254849583|ref|ZP_05238933.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           MO10]
 gi|255746871|ref|ZP_05420816.1| pyridoxine 5'-phosphate synthase [Vibrio cholera CIRS 101]
 gi|262162036|ref|ZP_06031052.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae INDRE 91/1]
 gi|297581082|ref|ZP_06943007.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           RC385]
 gi|298500185|ref|ZP_07009990.1| pyridoxal phosphate biosynthesis protein PdxJ [Vibrio cholerae MAK
           757]
 gi|12644545|sp|Q9KPB5|PDXJ_VIBCH RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|9657036|gb|AAF95600.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121547166|gb|EAX57295.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           2740-80]
 gi|124121371|gb|EAY40114.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           MZO-3]
 gi|148873638|gb|EDL71773.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           623-39]
 gi|149739273|gb|EDM53535.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           MZO-2]
 gi|150422430|gb|EDN14389.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           AM-19226]
 gi|227010467|gb|ACP06679.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           M66-2]
 gi|229335462|gb|EEO00944.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae 12129(1)]
 gi|229338026|gb|EEO03043.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae bv. albensis
           VL426]
 gi|229344148|gb|EEO09123.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae RC9]
 gi|229349265|gb|EEO14222.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae TMA 21]
 gi|229352288|gb|EEO17229.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae B33]
 gi|229354987|gb|EEO19908.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae BX 330286]
 gi|229369642|gb|ACQ60065.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae MJ-1236]
 gi|254845288|gb|EET23702.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           MO10]
 gi|255735273|gb|EET90673.1| pyridoxine 5'-phosphate synthase [Vibrio cholera CIRS 101]
 gi|262028285|gb|EEY46942.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae INDRE 91/1]
 gi|297534908|gb|EFH73744.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           RC385]
 gi|297540878|gb|EFH76932.1| pyridoxal phosphate biosynthesis protein PdxJ [Vibrio cholerae MAK
           757]
 gi|327484950|gb|AEA79357.1| Pyridoxine 5'-phosphate synthase [Vibrio cholerae LMA3894-4]
          Length = 243

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 81/250 (32%), Positives = 130/250 (52%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  IEL+TG Y    ++  Q+   L K
Sbjct: 118 AATEKLTAAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYSDAKSDVDQQ-NELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV  
Sbjct: 175 IAAAAAYAHDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLAKAVAD 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKAIMVAARR 243


>gi|16761490|ref|NP_457107.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29140813|ref|NP_804155.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213425279|ref|ZP_03358029.1| pyridoxal phosphate biosynthetic protein PdxJ [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213583124|ref|ZP_03364950.1| pyridoxal phosphate biosynthetic protein PdxJ [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213613052|ref|ZP_03370878.1| pyridoxal phosphate biosynthetic protein PdxJ [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
 gi|213646356|ref|ZP_03376409.1| pyridoxal phosphate biosynthetic protein PdxJ [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|20139001|sp|Q8Z4K6|PDXJ_SALTI RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|25345856|pir||AH0828 probable pyridoxal phosphate biosynthetic protein STY2824
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)
 gi|16503790|emb|CAD02780.1| putative pyridoxal phosphate biosynthetic protein [Salmonella
           enterica subsp. enterica serovar Typhi]
 gi|29136438|gb|AAO68004.1| putative pyridoxal phosphate biosynthetic protein [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
          Length = 243

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 81/246 (32%), Positives = 129/246 (52%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTDYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    +P    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLAIAVETRPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL   G ++SLF D +  + +  AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 ARLAAAGIQVSLFIDADERQIN--AAAEVGAPFIEIHTGCYANAETD-AEQAKELARIAS 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A LA ++ L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATLAARLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMTGLKEAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|56412546|ref|YP_149621.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62181143|ref|YP_217560.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161612652|ref|YP_001586617.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|168232156|ref|ZP_02657214.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168466661|ref|ZP_02700515.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168821432|ref|ZP_02833432.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194469519|ref|ZP_03075503.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|197361481|ref|YP_002141117.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|200387784|ref|ZP_03214396.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|224582880|ref|YP_002636678.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238912696|ref|ZP_04656533.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|75481602|sp|Q57LD3|PDXJ_SALCH RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|91207566|sp|Q3V7K1|PDXJ_SALPA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|56126803|gb|AAV76309.1| putative pyridoxal phosphate biosynthetic protein [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|62128776|gb|AAX66479.1| carries out condensation and ring closure step after PdxA in
           pyridoxine biosynthesis [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161362016|gb|ABX65784.1| hypothetical protein SPAB_00348 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194455883|gb|EDX44722.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|195630869|gb|EDX49461.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197092957|emb|CAR58387.1| putative pyridoxal phosphate biosynthetic protein [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|199604882|gb|EDZ03427.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|205333714|gb|EDZ20478.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205341953|gb|EDZ28717.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|224467407|gb|ACN45237.1| pyridoxal phosphate biosynthetic protein [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|320087079|emb|CBY96848.1| Pyridoxine 5'-phosphate synthase PNP synthase [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|322715633|gb|EFZ07204.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 243

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 81/246 (32%), Positives = 129/246 (52%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTDYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    +P    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLAIAVETRPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL   G ++SLF D +  + +  AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 ARLAAAGIQVSLFIDADEAQIN--AAAEVGAPFIEIHTGCYANAETD-AEQAKELARIAS 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A LA ++ L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATLAARLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMTGLKEAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|262404771|ref|ZP_06081326.1| pyridoxine 5'-phosphate synthase [Vibrio sp. RC586]
 gi|262349803|gb|EEY98941.1| pyridoxine 5'-phosphate synthase [Vibrio sp. RC586]
          Length = 243

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 81/250 (32%), Positives = 129/250 (51%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  IEL+TG Y    +   Q+   L K
Sbjct: 118 AATEKLTAAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYSDAKSEVDQQ-NELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV  
Sbjct: 175 IAAAAAYAHDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLAKAVAD 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKAIMVAARR 243


>gi|260436681|ref|ZP_05790651.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. WH 8109]
 gi|260414555|gb|EEX07851.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. WH 8109]
          Length = 249

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 82/258 (31%), Positives = 135/258 (52%), Gaps = 10/258 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MASLGVNIDHIANIREARRTVEPDPVSMALLAELGGADGITVHLREDRRHIQDRDVELLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  ++ LN+E    E  + +  R KP+ +TLVP+   ++T++ G D    +A L 
Sbjct: 61  -----QTVRSRLNLEMAAIEEMVAIALRIKPDMVTLVPERREEVTTEGGLDVAGQEASLG 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V  L + G  +SLF D    +  LQA K TGA  +EL+TG Y     +   +   L +
Sbjct: 116 GMVQTLQSAGIPVSLFVDPEATQ--LQACKATGACWVELHTGSYADA--DWSTQPQELAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L     +A+++ L++NAGH LT QN+   I AIP + E+++GH   A ++  G+++AV  
Sbjct: 172 LQEGTAIARQLGLRVNAGHGLTYQNVEP-IAAIPGMEELNIGHTIVARSVAVGLQQAVRD 230

Query: 242 FRRACGQHLDNTMRLTHP 259
            +        + +    P
Sbjct: 231 MKVLVQNPRFDPLFGQAP 248


>gi|332278278|ref|ZP_08390691.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella sp. D9]
 gi|332100630|gb|EGJ03976.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella sp. D9]
          Length = 248

 Score =  263 bits (673), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 79/246 (32%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 67

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 68  --QTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL +   ++SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 126 KRLADAWIQVSLFIDADEEQI--KAAAEVGAPFIEIHTGCYADAKTD-AEQAQELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241

Query: 245 ACGQHL 250
              +  
Sbjct: 242 LMLEAR 247


>gi|198277581|ref|ZP_03210112.1| hypothetical protein BACPLE_03803 [Bacteroides plebeius DSM 17135]
 gi|198270079|gb|EDY94349.1| hypothetical protein BACPLE_03803 [Bacteroides plebeius DSM 17135]
          Length = 237

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 96/246 (39%), Positives = 141/246 (57%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    P++  +     Q GA G+TVHPRPD+RHIRY D+  +R
Sbjct: 1   MTKLSVNINKVATLRNARGGNNPDVEKVALDCEQFGAEGITVHPRPDERHIRYADVYALR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++     K E NIEGYP++ F++L  R KP Q+TLVPD P Q+TS+ GWD   +QA LT
Sbjct: 61  PVL-----KTEFNIEGYPSKEFIDLVLRVKPTQVTLVPDAPDQITSNCGWDTKTHQAFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +      G R S+F   +      + A  TGAD +ELYT PY + Y    +  +    
Sbjct: 116 ELMDTFGEAGIRTSIFVGTDLELI--EYAAKTGADRVELYTEPYASLYPKNPEAAVA--P 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+   K+ + +NAGHDL++ N+    + IP++ E+S+GHA    AL  G+K+ +  
Sbjct: 172 FIEAAERVHKLGMGLNAGHDLSLVNLKYFHDNIPWLDEVSIGHALICDALYLGLKKTIEE 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKNCLR 237


>gi|154493589|ref|ZP_02032909.1| hypothetical protein PARMER_02929 [Parabacteroides merdae ATCC
           43184]
 gi|154086799|gb|EDN85844.1| hypothetical protein PARMER_02929 [Parabacteroides merdae ATCC
           43184]
          Length = 238

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 96/245 (39%), Positives = 139/245 (56%), Gaps = 9/245 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T++SVN+N VA +RN R    PN++ +       GA G+TVHPRPD+RHIRY+D+  ++
Sbjct: 1   MTNLSVNINKVATIRNARGGNVPNVLKVALDCETFGAQGITVHPRPDERHIRYSDVYALK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     K E NIEGYP E F++L  + KP Q+TLVPD P  +TS+ GWD   +   L+
Sbjct: 61  PEI-----KTEFNIEGYPCEKFIDLVLKVKPTQVTLVPDAPDAITSNAGWDVKAHFDQLS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V    + G R S+F     +  +++ A  TG D IELYT PY      P      +  
Sbjct: 116 ELVETFTSHGIRTSIFVG--TDLENIELAAKTGTDRIELYTEPY--ATLYPVNREEAIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A LA+ + L INAGHDL+++N+      IP + E+S+GHA  + AL  G+KE +  
Sbjct: 172 FISAAGLAKNLGLGINAGHDLSLENLAYFHQNIPGLDEVSIGHALISDALYYGLKETIRL 231

Query: 242 FRRAC 246
           ++   
Sbjct: 232 YKECL 236


>gi|326798656|ref|YP_004316475.1| pyridoxine 5'-phosphate synthase [Sphingobacterium sp. 21]
 gi|326549420|gb|ADZ77805.1| Pyridoxine 5'-phosphate synthase [Sphingobacterium sp. 21]
          Length = 238

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 99/244 (40%), Positives = 143/244 (58%), Gaps = 10/244 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    PN++ +     + GA G+TVHPRPD+RHIRY D+ +++
Sbjct: 1   MTKLSVNINKVATLRNSRGGNNPNVLQVALDCEKFGAQGITVHPRPDERHIRYQDVYDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNE-TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
             I       E NIEG   E  F++L    KP Q+TLVPD+  Q+TS+HGWD + NQ+ L
Sbjct: 61  AAIT-----TEFNIEGNCREKKFVDLVLANKPTQVTLVPDEQGQITSNHGWDTIANQSYL 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            +  A   + G R+S+F D   +   ++AA  TG D IELYT  Y    N  +     + 
Sbjct: 116 KEMSALFKDAGIRVSIFVDP--DPKMVEAAASTGTDRIELYTEAY--ATNYYKNPAEAVQ 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
             A  A+LA ++ L +NAGHDL + N+    + IP++ E+S+GHA  A AL  G++E + 
Sbjct: 172 PYAEAAKLAHELGLGLNAGHDLDLHNLQYFRSQIPHLLEVSIGHALIADALYLGLEETIK 231

Query: 241 CFRR 244
            +R 
Sbjct: 232 RYRA 235


>gi|197249528|ref|YP_002147536.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197213231|gb|ACH50628.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
          Length = 243

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 81/246 (32%), Positives = 129/246 (52%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTDYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    +P    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEAMLAIAVETRPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL   G ++SLF D +  + +  AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 ARLAAAGIQVSLFIDADERQIN--AAAEVGAPFIEIHTGCYANAETD-AEQAKELARIAS 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A LA ++ L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATLAARLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMTGLKEAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|330007689|ref|ZP_08306028.1| pyridoxine 5'-phosphate synthase [Klebsiella sp. MS 92-3]
 gi|328535370|gb|EGF61852.1| pyridoxine 5'-phosphate synthase [Klebsiella sp. MS 92-3]
          Length = 243

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLTIACETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 QRLADAGILVSLFIDADEAQI--KAAADVGAPYIEIHTGCYADAKTD-AEQARELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEVR 242


>gi|288958020|ref|YP_003448361.1| pyridoxine 5-phosphate synthase [Azospirillum sp. B510]
 gi|288910328|dbj|BAI71817.1| pyridoxine 5-phosphate synthase [Azospirillum sp. B510]
          Length = 258

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 80/255 (31%), Positives = 128/255 (50%), Gaps = 11/255 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R    P+ V   ++A+++GA G+T H R D+RHI   D+  +   
Sbjct: 6   RLGVNIDHVATVRNARGGAHPDPVRAARLAIEAGADGITAHLREDRRHIVDRDIERLMAE 65

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           ID       LN E    +  L +  R+KP    LVP+   ++T++ G D +     L + 
Sbjct: 66  IDR-----PLNFEMAATDEMLAIALRHKPHAACLVPEKRTEVTTEGGLDVVGQYDQLVRR 120

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ---QERIFLN 180
           V  L   G R+SLF D    +  L AAK  GA  +EL+TG Y   + NPQ   +    L 
Sbjct: 121 VGDLGAAGIRVSLFIDPEPAQ--LDAAKRLGAPVVELHTGAYCDAHTNPQGAAEREAELA 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++   A  A+ + L+ +AGH L+  ++   + AIP I E+++GH     A+  G+  A+ 
Sbjct: 179 RIVRAAAHAEAIGLECHAGHGLSYDSVGP-VAAIPTIVELNIGHFLIGEAIFVGLTNAIA 237

Query: 241 CFRRACGQHLDNTMR 255
             R+A        +R
Sbjct: 238 RMRKAMDTARAAALR 252


>gi|229521285|ref|ZP_04410705.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae TM 11079-80]
 gi|229341817|gb|EEO06819.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae TM 11079-80]
          Length = 242

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 81/249 (32%), Positives = 130/249 (52%), Gaps = 9/249 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  IEL+TG Y    ++  Q+   L K
Sbjct: 118 AATEKLTAAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYSDAKSDVDQQ-NELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV  
Sbjct: 175 IAAAAAYAHDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLAKAVAD 233

Query: 242 FRRACGQHL 250
            +       
Sbjct: 234 MKAIMVAAR 242


>gi|153214521|ref|ZP_01949430.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           1587]
 gi|124115323|gb|EAY34143.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           1587]
          Length = 243

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 81/250 (32%), Positives = 129/250 (51%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  IEL+TG Y    ++  Q+   L K
Sbjct: 118 AATEKLTAAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYSDAKSDVDQQ-NELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A    + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV  
Sbjct: 175 IAAAAAYAHDFGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLAKAVAD 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKAIMVAARR 243


>gi|260641976|ref|ZP_05859170.1| pyridoxine 5'-phosphate synthase [Bacteroides finegoldii DSM 17565]
 gi|260623966|gb|EEX46837.1| pyridoxine 5'-phosphate synthase [Bacteroides finegoldii DSM 17565]
          Length = 291

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 94/246 (38%), Positives = 143/246 (58%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P++V +       GA G+TVHPRPD+RHIR++D+  +R
Sbjct: 55  MTKLSVNINKIATLRNARGGNVPDVVKVALDCESFGADGITVHPRPDERHIRHSDVYALR 114

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP+  F++L  + KP Q+TLVPDDP QLTS+ GWD   N  LLT
Sbjct: 115 P-----LLRTEFNIEGYPSPEFIDLVLKVKPHQVTLVPDDPSQLTSNSGWDTKANLELLT 169

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + + + ++ G R S+F     +   ++ A   GAD +ELYT PY    N P+     +  
Sbjct: 170 EVLDQFNSAGIRTSVFVAA--DSEMVEYAAKAGADRVELYTEPY--ATNYPKNPETAIAP 225

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+ A+K+ + +NAGHDL++ N+      IP++ E+S+GHA  + AL  G++  +  
Sbjct: 226 FIEAAKTARKLGIGLNAGHDLSLVNLNYFYKNIPWVDEVSIGHALISDALYLGLERTIQE 285

Query: 242 FRRACG 247
           ++    
Sbjct: 286 YKNCLR 291


>gi|148981904|ref|ZP_01816562.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrionales
           bacterium SWAT-3]
 gi|145960705|gb|EDK26047.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrionales
           bacterium SWAT-3]
          Length = 245

 Score =  263 bits (671), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 78/251 (31%), Positives = 128/251 (50%), Gaps = 9/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  + 
Sbjct: 3   SILLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHIVDRDVRIL- 61

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +    KPE + LVP+   +LT++ G D +     + 
Sbjct: 62  ----AETIQTRMNLEMAVTDEMVQIALDTKPEFVCLVPEKREELTTEGGLDVVGQLDKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  IEL+TG Y        Q+   L K
Sbjct: 118 AATQKLSEAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYADAKTEEDQQ-DELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G+ +AV  
Sbjct: 175 IAAGASYADDLGITVNAGHGLTYHNVAP-IAALPEIYELNIGHSIMGRAVFDGLNKAVAD 233

Query: 242 FRRACGQHLDN 252
            +       +N
Sbjct: 234 MKAVMETARNN 244


>gi|260771272|ref|ZP_05880199.1| pyridoxine 5'-phosphate synthase [Vibrio furnissii CIP 102972]
 gi|260613869|gb|EEX39061.1| pyridoxine 5'-phosphate synthase [Vibrio furnissii CIP 102972]
 gi|315179121|gb|ADT86035.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio furnissii
           NCTC 11218]
          Length = 243

 Score =  263 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 81/250 (32%), Positives = 126/250 (50%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+TVH R D+RHI   D+  +R
Sbjct: 3   SILLGVNIDHVATLRNARGTKYPDPVHAAEIAERAGADGITVHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + +PE + LVP+   +LT++ G D +     + 
Sbjct: 63  -----ETIQTRMNLEMAVTDEMVEIALQTQPEFVCLVPEKREELTTEGGLDVMGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
                L   G ++SLF D +  +    AAK  GA  IEL+TG Y        Q+   L K
Sbjct: 118 AATQTLTAAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYADATCEVDQQ-NELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A    + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV  
Sbjct: 175 IAAAASYAADQGIMVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLSKAVAD 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKAVMDDARR 243


>gi|28899343|ref|NP_798948.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260365944|ref|ZP_05778434.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus K5030]
 gi|260878966|ref|ZP_05891321.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus AN-5034]
 gi|260898317|ref|ZP_05906813.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus Peru-466]
 gi|32129842|sp|Q87LP2|PDXJ_VIBPA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|28807579|dbj|BAC60832.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308085239|gb|EFO34934.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus Peru-466]
 gi|308090510|gb|EFO40205.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus AN-5034]
 gi|308113211|gb|EFO50751.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus K5030]
          Length = 243

 Score =  263 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 77/250 (30%), Positives = 130/250 (52%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    E  + +  + KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  -----ETIQTRMNLEMAVTEEMVEIALKTKPEFVCLVPEKREELTTEGGLDVVGQLDKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +   +AAK  GA  IEL+TG Y       +Q+     K
Sbjct: 118 AATQKLTEAGIKVSLFIDADRQQI--EAAKQCGAPFIELHTGHYADAETEEEQQAELK-K 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G++++V  
Sbjct: 175 IAAGASYADDLGIIVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLEKSVAE 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKALMIAARK 243


>gi|78213182|ref|YP_381961.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           CC9605]
 gi|123577976|sp|Q3AJ26|PDXJ_SYNSC RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|78197641|gb|ABB35406.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           CC9605]
          Length = 249

 Score =  263 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 82/258 (31%), Positives = 134/258 (51%), Gaps = 10/258 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MASLGVNIDHIANIREARRTVEPDPVSMALLAELGGADGITVHLREDRRHIQDRDVELLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  ++ LN+E    E  + +  R KP+ +TLVP+   ++T++ G D    +A L+
Sbjct: 61  -----QTVRSRLNLEMASTEEMVAIALRIKPDMVTLVPERREEVTTEGGLDVAGQKASLS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V  L   G  +SLF D    +  LQA K TGA  +EL+TG Y     +   +   L +
Sbjct: 116 AMVQTLQAAGIPVSLFVDPEATQ--LQACKNTGACWVELHTGRYADA--DWSTQPQELAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L     +AQ++ L++NAGH LT QN+   I AI  + E+++GH   A ++  G+++AV  
Sbjct: 172 LQEGTAIAQQLGLRVNAGHGLTYQNVEP-IAAIAGMEELNIGHTIVARSVAVGLQQAVRD 230

Query: 242 FRRACGQHLDNTMRLTHP 259
            +        + +    P
Sbjct: 231 MKVLVQNPRLDPLFGQAP 248


>gi|152971420|ref|YP_001336529.1| pyridoxine 5'-phosphate synthase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150956269|gb|ABR78299.1| pyridoxal phosphate biosynthetic protein [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
          Length = 243

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 79/246 (32%), Positives = 125/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLTIACETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +   +AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 QRLADAGILVSLFIDADEAQI--KAAADVGAPYIEIHTGCYADAKTD-AEQARELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   + 
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKC 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|149910152|ref|ZP_01898798.1| pyridoxal phosphate biosynthetic protein [Moritella sp. PE36]
 gi|149806738|gb|EDM66702.1| pyridoxal phosphate biosynthetic protein [Moritella sp. PE36]
          Length = 245

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 81/252 (32%), Positives = 131/252 (51%), Gaps = 9/252 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ +A LR  R   +P+ VH   +A  +GA G+TVH R D+RHI+  D+  ++
Sbjct: 3   KIFLGVNIDHIATLRQARGTTYPDPVHAAAVAELNGADGITVHLREDRRHIQDRDVRVLK 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E       L++    KPE + LVP+   +LT++ G D L  Q  +T
Sbjct: 63  -----ETIQTRMNLEMAVTAEMLDIACEIKPEFVCLVPEKREELTTEGGLDVLGQQDKIT 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V RL   G  +SLF D +  +    AA  +GA  IE++TG Y    +   +++  L K
Sbjct: 118 QAVKRLSEAGILVSLFIDADKEQI--DAAVASGAPYIEVHTGAYADAESE-GEQQAELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A     A    L++NAGH L   N+   I AIP I E+++GHA  A A   G+ +AV  
Sbjct: 175 IAAGVSYAHNAGLKVNAGHGLHYHNVQP-IAAIPEIYELNIGHAIIARAAFDGLGKAVKD 233

Query: 242 FRRACGQHLDNT 253
            +    +  +N+
Sbjct: 234 MQVIMQEARNNS 245


>gi|260899638|ref|ZP_05908033.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus AQ4037]
 gi|308110551|gb|EFO48091.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus AQ4037]
          Length = 243

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 77/250 (30%), Positives = 130/250 (52%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    E  + +  + KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  -----ETIQTRMNLEMAVTEEMVEIALKTKPEFVCLVPEKREELTTEGGLDVVGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +   +AAK  GA  IEL+TG Y       +Q+     K
Sbjct: 118 AATQKLTEAGIKVSLFIDADRQQI--EAAKQCGAPFIELHTGHYADAETEEEQQAELK-K 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G++++V  
Sbjct: 175 IAAGASYADDLGIIVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLEKSVAE 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKALMIAARK 243


>gi|184159112|ref|YP_001847451.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii ACICU]
 gi|332875941|ref|ZP_08443727.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii 6014059]
 gi|183210706|gb|ACC58104.1| Pyridoxal phosphate biosynthesis protein [Acinetobacter baumannii
           ACICU]
 gi|322509026|gb|ADX04480.1| pdxJ [Acinetobacter baumannii 1656-2]
 gi|323519008|gb|ADX93389.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332735807|gb|EGJ66848.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii 6014059]
          Length = 241

 Score =  262 bits (670), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 74/249 (29%), Positives = 125/249 (50%), Gaps = 9/249 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTAYPDPVEAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R        K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RP-----LLKTRMNLEMAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +    AA   GA  IEL+TG Y     + +Q+   L 
Sbjct: 116 KAATQALAAIGCDVSLFIDADFAQI--DAAIACGAPTIELHTGAYADATTDQEQQ-EELA 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A    L +NAGH L ++NI   I AIP I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIVKGVEYAASKGLVVNAGHGLNLKNIAP-IAAIPQIHELNIGHSIIAESVFVGLAQAVK 231

Query: 241 CFRRACGQH 249
             + A    
Sbjct: 232 DMKTAIQAA 240


>gi|86146356|ref|ZP_01064680.1| pyridoxal phosphate biosynthetic protein [Vibrio sp. MED222]
 gi|218710566|ref|YP_002418187.1| pyridoxine 5'-phosphate synthase [Vibrio splendidus LGP32]
 gi|85835835|gb|EAQ53969.1| pyridoxal phosphate biosynthetic protein [Vibrio sp. MED222]
 gi|218323585|emb|CAV19823.1| Pyridoxal phosphate biosynthetic protein pdxJ [Vibrio splendidus
           LGP32]
          Length = 245

 Score =  262 bits (670), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 77/252 (30%), Positives = 127/252 (50%), Gaps = 9/252 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  + 
Sbjct: 3   SILLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHIVDRDVRIL- 61

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +     PE + LVP+   +LT++ G D +     + 
Sbjct: 62  ----AETIQTRMNLEMAVTDEMVQIALDTNPEFVCLVPEKREELTTEGGLDVVGQLEKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  IEL+TG Y        Q+   L K
Sbjct: 118 AATEKLSAAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYADAKTEEDQQ-DELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G+ +AV  
Sbjct: 175 IAAGASYADDLGITVNAGHGLTYHNVAP-IAALPEIYELNIGHSIMGRAVFDGLNKAVAD 233

Query: 242 FRRACGQHLDNT 253
            +       +N 
Sbjct: 234 MKAVMETARNNA 245


>gi|84390107|ref|ZP_00991369.1| pyridoxal phosphate biosynthetic protein [Vibrio splendidus 12B01]
 gi|84376761|gb|EAP93636.1| pyridoxal phosphate biosynthetic protein [Vibrio splendidus 12B01]
          Length = 245

 Score =  262 bits (669), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 77/252 (30%), Positives = 126/252 (50%), Gaps = 9/252 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  + 
Sbjct: 3   SILLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHIVDRDVRIL- 61

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +     PE + LVP+   +LT++ G D +     + 
Sbjct: 62  ----AETIQTRMNLEMAVTDEMVQIALDTNPEFVCLVPEKREELTTEGGLDVVGQLEKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D    +    AAK  GA  IEL+TG Y        Q+   L K
Sbjct: 118 AATEKLSAAGIKVSLFIDAEREQI--DAAKACGAPFIELHTGHYADAKTEEDQQ-DELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G+ +AV  
Sbjct: 175 IAAGASYADDLGITVNAGHGLTYHNVAP-IAALPEIYELNIGHSIMGRAVFDGLNKAVAD 233

Query: 242 FRRACGQHLDNT 253
            +       +N 
Sbjct: 234 MKAVMETARNNA 245


>gi|322834124|ref|YP_004214151.1| pyridoxal phosphate biosynthetic protein PdxJ [Rahnella sp. Y9602]
 gi|321169325|gb|ADW75024.1| pyridoxal phosphate biosynthetic protein PdxJ [Rahnella sp. Y9602]
          Length = 243

 Score =  262 bits (669), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 121/247 (48%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRLLR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  + +     P    LVP+   ++T++ G D       +T  V
Sbjct: 63  --QTIQTRMNLEMAVTDEMVGIACEVLPHFCCLVPEKREEVTTEGGLDVAGQLDKMTVAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G  +SLF D +  +    AA   GA  IE++TG Y     +  + +  L ++  
Sbjct: 121 SRLSEAGILVSLFIDPDMRQI--DAAVAVGAPYIEIHTGAYAEAKTD-LERQAELERIKQ 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV   + 
Sbjct: 178 GAAYAAGKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVIDGLSCAVREMKN 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|307132115|ref|YP_003884131.1| pyridoxine 5'-phosphate synthase [Dickeya dadantii 3937]
 gi|306529644|gb|ADM99574.1| pyridoxine 5'-phosphate synthase [Dickeya dadantii 3937]
          Length = 243

 Score =  262 bits (669), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 121/247 (48%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVRLLR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  L +    KP    LVP+   ++T++ G D       +T  V
Sbjct: 63  --QTIQTRMNLEMAVTDEMLAIACELKPHFCCLVPEKRQEVTTEGGLDVAGQLDRITAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G ++SLF D    +    AA  +GA  IE++TG Y     +  ++     ++  
Sbjct: 121 TQLRQAGIQVSLFIDAGRTQI--DAAVASGAPYIEIHTGAYADAQTDAARQ-QEFERIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    +++NAGH LT  NI   I A+P + E+++GHA    A+  G+  AV   + 
Sbjct: 178 AAAYAASRGIKVNAGHGLTYHNIQP-IAALPEMHELNIGHAIIGRAVMSGLASAVAEMKT 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|254780438|ref|YP_003064851.1| pyridoxine 5'-phosphate synthase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040115|gb|ACT56911.1| pyridoxine 5'-phosphate synthase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 261

 Score =  262 bits (669), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 261/261 (100%), Positives = 261/261 (100%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI
Sbjct: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL
Sbjct: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN
Sbjct: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF
Sbjct: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240

Query: 241 CFRRACGQHLDNTMRLTHPVK 261
           CFRRACGQHLDNTMRLTHPVK
Sbjct: 241 CFRRACGQHLDNTMRLTHPVK 261


>gi|189462959|ref|ZP_03011744.1| hypothetical protein BACCOP_03661 [Bacteroides coprocola DSM 17136]
 gi|189430241|gb|EDU99225.1| hypothetical protein BACCOP_03661 [Bacteroides coprocola DSM 17136]
          Length = 237

 Score =  262 bits (669), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 139/246 (56%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    P++  +       GA G+TVHPRPD+RHIRY D+  +R
Sbjct: 1   MTKLSVNINKVATLRNARGGNNPDVEKVALDCEAFGAEGITVHPRPDERHIRYADVLALR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++     + E NIEGYP++ F++L  + KP Q+TLVPD P Q+TS+ GWD   N + LT
Sbjct: 61  PIL-----RTEFNIEGYPSKEFIDLVLKVKPHQVTLVPDAPDQITSNSGWDTKNNLSFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +      G R S+F     +   ++ A   GAD +ELYT PY       +     +  
Sbjct: 116 ELMDTFGEAGIRTSIFVG--TDTEMIEYAAKAGADRVELYTEPY--ASQYGKNREAAIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A++ +K+ + +NAGHDL+++N+      IP++ E+S+GHA    AL  G+K+ +  
Sbjct: 172 FVEAAKVTRKLGMGLNAGHDLSLENLAYFHENIPWVDEVSIGHALICDALYLGLKKTIEE 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKNCLR 237


>gi|189463783|ref|ZP_03012568.1| hypothetical protein BACINT_00116 [Bacteroides intestinalis DSM
           17393]
 gi|189438733|gb|EDV07718.1| hypothetical protein BACINT_00116 [Bacteroides intestinalis DSM
           17393]
          Length = 262

 Score =  262 bits (669), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 95/246 (38%), Positives = 141/246 (57%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PN+V +       GA G+TVHPRPD+RHIR  D+ ++R
Sbjct: 26  MTRLSVNINKIATLRNARGGDVPNVVKVALDCESFGAEGITVHPRPDERHIRQRDVYDLR 85

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP   F++L  + KP Q+TLVPD P QLTS+ GWD  QN   LT
Sbjct: 86  P-----LLRTEFNIEGYPAPEFIDLVLKVKPHQVTLVPDSPTQLTSNAGWDTKQNLEFLT 140

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +   ++ G R S+F     +   ++ A   GAD +ELYT PY   Y  PQ +   +  
Sbjct: 141 EVLETFNDAGIRTSVFVSA--DAEMIEYAAKAGADRVELYTEPYATAY--PQNKEAAVAP 196

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A++A+ + L +NAGHDL++ N+  L   IP++ E+S+GH+  + AL  G++  +  
Sbjct: 197 FVEAAKVARSLGLGLNAGHDLSLVNLNYLYQNIPWMDEVSIGHSLISDALYLGLERTIQE 256

Query: 242 FRRACG 247
           ++    
Sbjct: 257 YKNCLR 262


>gi|260598947|ref|YP_003211518.1| pyridoxine 5'-phosphate synthase [Cronobacter turicensis z3032]
 gi|260218124|emb|CBA32919.1| Pyridoxine 5'-phosphate synthase [Cronobacter turicensis z3032]
          Length = 245

 Score =  262 bits (669), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 80/247 (32%), Positives = 122/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 8   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 64

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D       +    
Sbjct: 65  --QTLHTRMNLEMAVTEEMLAIACETKPHFCCLVPEKRQEVTTEGGLDVAGQLDKMRDAC 122

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  +    AA   GA  IE++TG Y    ++  +    L ++A 
Sbjct: 123 QRLAAAGILVSLFIDADNAQI--DAAVAVGAPYIEIHTGCYADAEDDATR-VRELERIAK 179

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 180 AATYAASKGLKVNAGHGLTYHNVQA-IAALPEMHELNIGHAIIGRAVMSGLKEAVSEMKR 238

Query: 245 ACGQHLD 251
              +   
Sbjct: 239 LMLEARR 245


>gi|262381242|ref|ZP_06074380.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 2_1_33B]
 gi|298376392|ref|ZP_06986347.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_1_19]
 gi|262296419|gb|EEY84349.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 2_1_33B]
 gi|298266270|gb|EFI07928.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_1_19]
          Length = 238

 Score =  262 bits (669), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 139/246 (56%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T++SVN+N VA +RN R    PN++ + +     GA G+TVHPRPD+RHIRY+D+  ++
Sbjct: 1   MTNLSVNINKVATIRNARGGNMPNVLKVAQDCELFGAQGITVHPRPDERHIRYSDVYGLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP + F++L  + KP Q+TLVPD P  +TS+ GW+   N   L+
Sbjct: 61  P-----LIRTEFNIEGYPCDKFIDLVLKVKPTQVTLVPDAPDAITSNSGWNVKDNFDYLS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V    + G R S+F   +      + A  TG D IELYT PY      P+     +  
Sbjct: 116 ELVDTFTSQGIRTSIFVGTDLANI--ELAAKTGTDRIELYTEPY--ATFYPEDRDKAIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               AQLA+ + L +NAGHDL+++N+      IP++ E+S+GHA    AL  G++E +  
Sbjct: 172 FVEAAQLAKNLGLGVNAGHDLSLENLAFFNKNIPWLEEVSIGHALICDALYHGLQETIAL 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKACLN 237


>gi|156932893|ref|YP_001436809.1| pyridoxine 5'-phosphate synthase [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156531147|gb|ABU75973.1| hypothetical protein ESA_00695 [Cronobacter sakazakii ATCC BAA-894]
          Length = 243

 Score =  262 bits (669), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 80/247 (32%), Positives = 122/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D       +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLTIACETKPHFCCLVPEKRQEVTTEGGLDVAGQLDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  +    AA   GA  IE++TG Y    ++  +    L ++A 
Sbjct: 121 QRLAAAGILVSLFIDADNAQI--DAAVAVGAPYIEIHTGCYADAEDDATRA-RELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASKGLKVNAGHGLTYHNVQA-IAALPEMHELNIGHAIIGRAVMSGLKEAVSEMKR 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMLEARR 243


>gi|312881715|ref|ZP_07741492.1| pyridoxine 5'-phosphate synthase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370605|gb|EFP98080.1| pyridoxine 5'-phosphate synthase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 243

 Score =  262 bits (669), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 77/250 (30%), Positives = 130/250 (52%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVKILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +    KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  -----ETIQTRMNLEMAVTDEMIAIAIDTKPEYVCLVPEKREELTTEGGLDVVGQLEKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L + G ++SLF D +  +    AAK  GA  +EL+TG Y    ++  ++   L K
Sbjct: 118 AATNKLSDAGIKVSLFIDADREQIM--AAKECGAPFVELHTGQYAEAKSDEDKQ-NELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GH+    A   G+ +AV  
Sbjct: 175 IAAGASYAHGLGITVNAGHGLTYHNVTP-IAAIPEIFELNIGHSIIGRAAFDGLHKAVGD 233

Query: 242 FRRACGQHLD 251
            +    +   
Sbjct: 234 MKLLMTEARR 243


>gi|262375522|ref|ZP_06068755.1| pyridoxal phosphate biosynthesis protein PdxJ [Acinetobacter
           lwoffii SH145]
 gi|262309776|gb|EEY90906.1| pyridoxal phosphate biosynthesis protein PdxJ [Acinetobacter
           lwoffii SH145]
          Length = 241

 Score =  261 bits (668), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 74/250 (29%), Positives = 125/250 (50%), Gaps = 9/250 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V+   I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTTYPDPVNAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R ++     K  +N+E    +  +   +  KP+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RPVL-----KTRMNLELAITDEMIAFAKEIKPQHVCFVPEKRQEVTTEGGLDVVGNFDAV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +    AA   GA  IE++TG Y        Q+   L 
Sbjct: 116 KAATQELAAIGCDVSLFIDADFAQI--DAAVACGAPTIEIHTGAYADAETPEAQQ-AELE 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++   A+ A    L +NAGH L + N+   I AIP I E+++GH+  A A+  G+ +AV 
Sbjct: 173 RIIKGAEYAVSKGLVVNAGHGLNLDNVTP-IAAIPQIHELNIGHSLIADAVFVGLAQAVQ 231

Query: 241 CFRRACGQHL 250
             +       
Sbjct: 232 QMKAVIKSAR 241


>gi|124022665|ref|YP_001016972.1| pyridoxine 5'-phosphate synthase [Prochlorococcus marinus str. MIT
           9303]
 gi|166219105|sp|A2C897|PDXJ_PROM3 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|123962951|gb|ABM77707.1| Pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. MIT 9303]
          Length = 245

 Score =  261 bits (668), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 77/255 (30%), Positives = 127/255 (49%), Gaps = 10/255 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  DL  +R
Sbjct: 1   MASLGVNIDHIANVRQARQTVEPDPVPMALLAELGGADGITVHLREDRRHIQDRDLELLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   ++ LN+E       + +  + +P+ +TLVP+   ++T++ G D    Q  L 
Sbjct: 61  -----ATVRSRLNLEMAATPEMVGIALKIQPDMVTLVPERRQEVTTEGGLDVAAQQGSLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V +L   G  +SLF D    +  L+AA  +GA  +EL+TG Y         +   L +
Sbjct: 116 GMVDQLQVAGIPVSLFVDPVSQQ--LEAACKSGARWVELHTGAYAEAC--WANQSFELAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L      A+ + L++NAGH LT QN+   + AI  I E+++GH   A ++  G++EAV  
Sbjct: 172 LNEATARARSLGLRVNAGHGLTYQNV-EAVAAIEGIEELNIGHTIVARSIAVGLQEAVRE 230

Query: 242 FRRACGQHLDNTMRL 256
            +R         +  
Sbjct: 231 MKRLVQNPRREPLFG 245


>gi|163744859|ref|ZP_02152219.1| pyridoxal phosphate biosynthetic protein PdxJ [Oceanibulbus
           indolifex HEL-45]
 gi|161381677|gb|EDQ06086.1| pyridoxal phosphate biosynthetic protein PdxJ [Oceanibulbus
           indolifex HEL-45]
          Length = 250

 Score =  261 bits (668), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 70/252 (27%), Positives = 122/252 (48%), Gaps = 10/252 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R   +P+ +   KIA ++GA G+T H R D+RHI   D+  + 
Sbjct: 6   KLRLGVNIDHVATVRNARGGAYPDPLRAAKIAEKAGADGITAHLREDRRHISDADIEGLM 65

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +     LN E    +    +  R+KP  + +VP+   + T++ G +  + +  L 
Sbjct: 66  -----EVLSVPLNFEMAATDEMQKIALRHKPHAVCIVPEKREERTTEGGLEVAREENKLA 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFL 179
             +A L   GSR+S+F      +   +AA   GA+ IEL+TG Y   +      +  + L
Sbjct: 121 HFIAPLREAGSRVSIFIAAEPAQI--EAANRIGAEVIELHTGAYCDAFAEGRWDEADVEL 178

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            KL   +  A  + L+++AGH LT   +   + A P + E+++GH     A+  G++ A+
Sbjct: 179 KKLREMSTFAASLGLEVHAGHGLTYDTVTP-VAAFPEVRELNIGHFLIGEAIFLGLEPAI 237

Query: 240 FCFRRACGQHLD 251
              RR      +
Sbjct: 238 TEMRRLMDAARE 249


>gi|224535817|ref|ZP_03676356.1| hypothetical protein BACCELL_00681 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224522540|gb|EEF91645.1| hypothetical protein BACCELL_00681 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 262

 Score =  261 bits (668), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 95/246 (38%), Positives = 141/246 (57%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PN+V +       GA G+TVHPRPD+RHIR  D+ ++R
Sbjct: 26  MTRLSVNINKIATLRNARGGDVPNVVKVALDCESFGAEGITVHPRPDERHIRQRDVYDLR 85

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + E NIEGYP   F++L  + KP Q+TLVPD P QLTS+ GWD  QN   LT
Sbjct: 86  P-----LLRTEFNIEGYPAPEFIDLVLKVKPHQVTLVPDSPTQLTSNAGWDTKQNLEFLT 140

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +   ++ G R S+F     +   ++ A   GAD +ELYT PY   Y  PQ +   +  
Sbjct: 141 EVLETFNDAGIRTSVFVSA--DAEMIEYAAKAGADRVELYTEPYATAY--PQNKEAAVAP 196

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A++A+ + L +NAGHDL++ N+  L   IP++ E+S+GH+  + AL  G++  +  
Sbjct: 197 FVEAAKVARSLGLGLNAGHDLSLVNLNYLYQNIPWMDEVSIGHSLISDALYLGLERTIQE 256

Query: 242 FRRACG 247
           ++    
Sbjct: 257 YKNCLR 262


>gi|242240200|ref|YP_002988381.1| pyridoxal phosphate biosynthetic protein PdxJ [Dickeya dadantii
           Ech703]
 gi|242132257|gb|ACS86559.1| pyridoxal phosphate biosynthetic protein PdxJ [Dickeya dadantii
           Ech703]
          Length = 243

 Score =  261 bits (668), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 77/247 (31%), Positives = 125/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHVATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRLLR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  L +    KP    LVP+   ++T++ G D       +  +V
Sbjct: 63  --QTIQTRMNLEMAVTDEMLAIACELKPHFCCLVPEKRQEVTTEGGLDVAGQLERMKISV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL + G ++SLF D N  +    AA   GA  IE++TG Y    +   ++ +   ++  
Sbjct: 121 ARLRDAGIQVSLFIDANHAQI--DAAAACGAPYIEIHTGAYADAVDEHTRQ-LEFARIRE 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + + +NAGH LT  N+   I A+P + E+++GHA    A+  G+ +AV   + 
Sbjct: 178 AASYAAGLGINVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGRAVMSGLADAVADMKS 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|260775205|ref|ZP_05884103.1| pyridoxine 5'-phosphate synthase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608906|gb|EEX35068.1| pyridoxine 5'-phosphate synthase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 243

 Score =  261 bits (668), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 78/250 (31%), Positives = 129/250 (51%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  ++A ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEVAERAGADGITIHLREDRRHIVDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +  + +PE + LVP+   +LT++ G D   +   + 
Sbjct: 63  -----ETIQTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVAGHVEKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
                L   G ++SLF D +  +    AAK  GA  IEL+TG Y    N+  Q+   L K
Sbjct: 118 AATKILTEAGIKVSLFIDADREQI--DAAKACGAPYIELHTGHYADAENDEDQQ-DELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GH+    A   G+ +AV  
Sbjct: 175 IAAGASYAADLGITVNAGHGLTYHNVAP-IAAIPEIYELNIGHSIIGRAAFDGLHKAVAD 233

Query: 242 FRRACGQHLD 251
            +    +   
Sbjct: 234 MKALMVEARK 243


>gi|91207548|sp|Q2Y865|PDXJ_NITMU RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
          Length = 241

 Score =  261 bits (668), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 74/250 (29%), Positives = 119/250 (47%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR  R   +P+ +    IA  +GA  +T+H R D+RHI+  D+  +R
Sbjct: 1   MIKLGVNIDHVATLRQARGTTYPDPIEAALIAESAGADAITLHLREDRRHIQDRDVEILR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     K  +N+E    +  +    R KP  I LVP+   +LT++ G D  ++   + 
Sbjct: 61  GAL-----KTRMNLESAVTDEMIGFALRIKPHDICLVPERREELTTEGGLDVARHFEQVQ 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           +   RL   G R+SLF D    +    A+   GA  IE++TG Y        +++  L +
Sbjct: 116 RACHRLAEAGIRVSLFVDAEPAQI--DASVEAGAPVIEIHTGHYADA-QTTDEQQGELER 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +           L +NAGH L   N+   I AIP +SE+++GHA  A AL  G + AV  
Sbjct: 173 VRAAVSKGLNHGLTVNAGHGLHYLNVQA-IAAIPGVSELNIGHAIVARALFVGFERAVRE 231

Query: 242 FRRACGQHLD 251
            +    +   
Sbjct: 232 MKNLMLEACK 241


>gi|293609822|ref|ZP_06692124.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828274|gb|EFF86637.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 241

 Score =  261 bits (668), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 73/249 (29%), Positives = 123/249 (49%), Gaps = 9/249 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  ++GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTTYPDPVEAALICEEAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R        K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RP-----LLKTRMNLELAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +    AA   GA  IEL+TG Y        Q+   L 
Sbjct: 116 KAATQTLAAIGCDVSLFIDADLAQI--DAAVACGAPTIELHTGAYADAETEQDQQ-AELE 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A    L +NAGH L ++NI   I AIP I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIIKGVEYAASKGLVVNAGHGLNLKNIAP-IAAIPQIHELNIGHSIIAESVFVGLVQAVK 231

Query: 241 CFRRACGQH 249
             + A    
Sbjct: 232 DMKTAIQAA 240


>gi|50122197|ref|YP_051364.1| pyridoxine 5'-phosphate synthase [Pectobacterium atrosepticum
           SCRI1043]
 gi|91207234|sp|Q3V7N3|PDXJ_ERWCT RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|49612723|emb|CAG76173.1| pyridoxal phosphate biosynthetic protein [Pectobacterium
           atrosepticum SCRI1043]
          Length = 243

 Score =  261 bits (667), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 78/247 (31%), Positives = 126/247 (51%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R  P+P+ V    +A Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTPYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    E  LN+    KP    LVP+   ++T++ G D    Q  +   V
Sbjct: 63  --ETLQTRMNLEMAVTEEMLNIACEVKPHFCCLVPEKRQEVTTEGGLDVAGQQEKIDNAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL      +SLF D +  +    AA  +GA  IE++TG Y    ++  ++     ++  
Sbjct: 121 ARLSQANILVSLFIDADKRQI--DAAVASGAAYIEIHTGAYADAPDDETRQ-HEFERIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+K+AV   + 
Sbjct: 178 AATYAAAKGLKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVISGLKDAVAEMKS 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|253689437|ref|YP_003018627.1| pyridoxal phosphate biosynthetic protein PdxJ [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251756015|gb|ACT14091.1| pyridoxal phosphate biosynthetic protein PdxJ [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 243

 Score =  261 bits (667), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 77/247 (31%), Positives = 125/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R  +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVRILRDTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  LN+    KP    LVP+   ++T++ G D    Q  +   V
Sbjct: 66  -----QTRMNLEMAVTEEMLNIACEVKPHFCCLVPEKRQEVTTEGGLDVAGQQEKINNAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL      +SLF D +  +    AA  +GA  IE++TG Y    ++  ++     ++  
Sbjct: 121 ARLSQANILVSLFIDADKRQI--DAAVASGAPYIEIHTGAYADAPDDEARQ-HEFERIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+K+AV   + 
Sbjct: 178 AATYAAAQGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGRAVMSGLKDAVAEMKN 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|169795100|ref|YP_001712893.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii AYE]
 gi|215482649|ref|YP_002324843.1| pyridoxal phosphate biosynthetic protein PdxJ [Acinetobacter
           baumannii AB307-0294]
 gi|239501070|ref|ZP_04660380.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii AB900]
 gi|301511103|ref|ZP_07236340.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii AB058]
 gi|332851051|ref|ZP_08433160.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii 6013150]
 gi|332869700|ref|ZP_08438888.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii 6013113]
 gi|169148027|emb|CAM85890.1| pyridoxal phosphate biosynthetic protein [Acinetobacter baumannii
           AYE]
 gi|193078012|gb|ABO12933.2| pyridoxal phosphate biosynthetic protein [Acinetobacter baumannii
           ATCC 17978]
 gi|213988826|gb|ACJ59125.1| pyridoxal phosphate biosynthetic protein PdxJ [Acinetobacter
           baumannii AB307-0294]
 gi|332730215|gb|EGJ61540.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii 6013150]
 gi|332732602|gb|EGJ63835.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii 6013113]
          Length = 241

 Score =  261 bits (667), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 74/249 (29%), Positives = 124/249 (49%), Gaps = 9/249 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTAYPDPVEAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R        K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RP-----LLKTRMNLEMAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +    AA   GA  IEL+TG Y       +Q+   L 
Sbjct: 116 KAATQALAAIGCDVSLFIDADFAQI--DAAIACGAPTIELHTGAYADATTEQEQQ-EELA 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A    L +NAGH L ++NI   I AIP I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIVKGVEYAASKGLVVNAGHGLNLKNIAP-IAAIPQIHELNIGHSIIAESVFVGLVQAVK 231

Query: 241 CFRRACGQH 249
             + A    
Sbjct: 232 DMKTAIQAA 240


>gi|271501618|ref|YP_003334644.1| pyridoxal phosphate biosynthetic protein PdxJ [Dickeya dadantii
           Ech586]
 gi|270345173|gb|ACZ77938.1| pyridoxal phosphate biosynthetic protein PdxJ [Dickeya dadantii
           Ech586]
          Length = 243

 Score =  261 bits (667), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 72/247 (29%), Positives = 123/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ +    +A Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPIQAAFVAEQAGADGITVHLREDRRHITDRDVRLLR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  L +    KP    LVP+   ++T++ G D     A +T  V
Sbjct: 63  --QTIQTRMNLEMAVTDEMLAIACELKPHFCCLVPEKRQEVTTEGGLDVAGQLARITSAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G ++SLF D +  +    AA  +GA  IE++TG Y    ++  ++     ++  
Sbjct: 121 TQLREAGIQVSLFIDADRTQI--DAAVASGAPYIEIHTGAYADAQDDVARQ-QEFERIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
               A    +++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV   + 
Sbjct: 178 AVAYAASRGIKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVMSGLAPAVAEMKT 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|88808740|ref|ZP_01124250.1| pyridoxal phosphate biosynthetic protein [Synechococcus sp. WH
           7805]
 gi|88787728|gb|EAR18885.1| pyridoxal phosphate biosynthetic protein [Synechococcus sp. WH
           7805]
          Length = 249

 Score =  261 bits (667), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 75/258 (29%), Positives = 133/258 (51%), Gaps = 10/258 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MASLGVNIDHIANVRQARRTVEPDPVPMALLAELGGADGITVHLREDRRHIQDRDVDLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  +  LN+E    +  +++  R +P+ +TLVP+   +++++ G D    +A L+
Sbjct: 61  -----QTVRTRLNLEMAATDEMISIALRVQPDMVTLVPERREEVSTEGGLDVSSQRADLS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             ++ L + G  +SLF D    +  LQA +   A  +EL+TG Y    +    +   L +
Sbjct: 116 IKISSLQDAGIPVSLFVDPEKGQ--LQACRDCKARWVELHTGTY--AESKWTDQPAELAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L     LA+   L++NAGH LT QN+   +  I  + E+++GH+  A +L  G+++AV  
Sbjct: 172 LIEATALARSFGLRVNAGHGLTYQNVEP-VACIDGMEELNIGHSIVARSLAVGLQQAVRE 230

Query: 242 FRRACGQHLDNTMRLTHP 259
            R          +  ++P
Sbjct: 231 MRSLVQNPRREPLFGSYP 248


>gi|120434586|ref|YP_860278.1| pyridoxine 5'-phosphate synthase [Gramella forsetii KT0803]
 gi|166219092|sp|A0LXW0|PDXJ_GRAFK RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|117576736|emb|CAL65205.1| pyridoxal phosphate biosynthesis protein [Gramella forsetii KT0803]
          Length = 237

 Score =  261 bits (667), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 91/246 (36%), Positives = 141/246 (57%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PN++   K     GA G+TVHPRPD+RHIRY D  E++
Sbjct: 1   MTKLSVNINKIATLRNARGGDVPNVLEAAKNIESFGAEGITVHPRPDERHIRYADARELK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++       E NIEG P + F++L    KP Q+TLVPD  + +TSD GWD ++++  L 
Sbjct: 61  PVL-----NTEFNIEGKPIQQFIDLVLEVKPAQVTLVPDAENAITSDSGWDTVKHRDYLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +A     G R S+F D    +  ++ A  TG+D IELYT  +    +  +     +  
Sbjct: 116 EVIAEFKANGIRTSIFVDPV--KKMIEGAAETGSDRIELYTESF--AVDFEKGNSNAVKP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
            A  A++A ++ L INAGHDL+++NI      +PY+ E+S+GHA  + AL  G+++ +  
Sbjct: 172 YAECAKIAHELGLGINAGHDLSLKNINYFKENVPYLDEVSIGHALISEALYLGLEKTIQQ 231

Query: 242 FRRACG 247
           + +   
Sbjct: 232 YLKLLK 237


>gi|227328578|ref|ZP_03832602.1| pyridoxine 5'-phosphate synthase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 243

 Score =  261 bits (667), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 78/247 (31%), Positives = 127/247 (51%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    E  LN+    KP    LVP+   ++T++ G D    Q  + K V
Sbjct: 63  --ETLQTRMNLEMAVTEEMLNIACEVKPHFCCLVPEKRQEVTTEGGLDVAGQQEKIDKAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL      +SLF D +  +    AA  +GA  IE++TG Y    ++  ++     ++  
Sbjct: 121 ARLSQANILVSLFIDADKRQI--DAAVASGAPYIEIHTGAYADALDDEARQ-HEFERIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
           +A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+K+AV   + 
Sbjct: 178 SATYAAAKGLKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVMSGLKDAVAEMKN 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|300717984|ref|YP_003742787.1| Pyridoxal phosphate biosynthesis protein [Erwinia billingiae Eb661]
 gi|299063820|emb|CAX60940.1| Pyridoxal phosphate biosynthesis protein [Erwinia billingiae Eb661]
          Length = 243

 Score =  261 bits (666), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 122/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R   +P+ V    ++ Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHVATVRNARGTNYPDPVQAAFVSEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  +++    KP    LVP+   ++T++ G D       +T  V
Sbjct: 63  --QTIQTRMNLEMAVTDEMVDIACEIKPHFCCLVPEKREEVTTEGGLDVAGQLEKVTYAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  +    AA  +GA  IE++TG Y       ++      ++  
Sbjct: 121 TRLAEAGILVSLFIDADHRQI--DAAMASGAPYIEIHTGAYAEA-EEGRERHAEFIRIKD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+ +AV   + 
Sbjct: 178 AAAYAAGKGLKVNAGHGLTYHNVQP-IAALPQMHELNIGHAIIGRAVMSGLADAVKEMKA 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|259907680|ref|YP_002648036.1| pyridoxine 5'-phosphate synthase [Erwinia pyrifoliae Ep1/96]
 gi|224963302|emb|CAX54787.1| Pyridoxal phosphate biosynthetic protein (PNP synthase) [Erwinia
           pyrifoliae Ep1/96]
 gi|283477531|emb|CAY73447.1| Pyridoxine 5'-phosphate synthase [Erwinia pyrifoliae DSM 12163]
 gi|310764812|gb|ADP09762.1| pyridoxine 5'-phosphate synthase [Erwinia sp. Ejp617]
          Length = 243

 Score =  261 bits (666), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 122/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R   +P+ V    ++ Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHVATVRNARGTHYPDPVQAAFVSEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    +  +++    +P    LVP+   ++T++ G D    Q  +T  V
Sbjct: 63  --ETIQTRMNLEMAVTDEMVDIACEIQPHFCCLVPEKREEVTTEGGLDVAAQQDKVTAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  +    AA   GA  IE++TG Y             L ++A 
Sbjct: 121 KRLSAAGILVSLFIDADPRQI--DAAVAAGAPYIEIHTGAYAEA-PEGPARDAELARIAE 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   + A+P + E+++GHA    A+  G+  AV   ++
Sbjct: 178 AATCAAGKGLKVNAGHGLTYHNVLP-VAALPEMHELNIGHAIIGRAVFTGLAAAVQEMKQ 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LLREARR 243


>gi|218438251|ref|YP_002376580.1| pyridoxine 5'-phosphate synthase [Cyanothece sp. PCC 7424]
 gi|226694866|sp|B7K7E4|PDXJ_CYAP7 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|218170979|gb|ACK69712.1| pyridoxal phosphate biosynthetic protein PdxJ [Cyanothece sp. PCC
           7424]
          Length = 240

 Score =  261 bits (666), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 75/246 (30%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ VA +R  R    P+ +    +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MLTLGVNIDHVATIRQARRTVEPDPLAAAVLAELGGADGITVHLREDRRHIQDRDVRLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  +  LN+E  P E  +++    KP+ +TLVP+   ++T++ G D + N     
Sbjct: 61  -----QTVRTHLNLEMAPTEEMISIALDIKPDYVTLVPEKREEVTTEGGIDLVSNFTRFA 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V +L   G  +S F D +  +   +AA  TGA  IEL+TG Y    N   +    L  
Sbjct: 116 QVVDQLQGAGIPVSWFIDADPAQI--EAASKTGAKFIELHTGKYAEALNEESRA-QELES 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L    + A  + L++NAGH LT  N+   +  +P + E+++GH+  + A+  G+ +AV  
Sbjct: 173 LKKGCEQALSLGLRVNAGHGLTYWNV-YPVACLPGMEELNIGHSIISRAVLIGIDKAVRE 231

Query: 242 FRRACG 247
            + A  
Sbjct: 232 MKLAMR 237


>gi|328474124|gb|EGF44929.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus 10329]
          Length = 243

 Score =  261 bits (666), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 77/250 (30%), Positives = 131/250 (52%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH+ +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHVAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    E  + +  + KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  -----ETIQTRMNLEMAVTEEMVEIALKTKPEFVCLVPEKREELTTEGGLDVVGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +   +AAK  GA  IEL+TG Y       +Q+     K
Sbjct: 118 AATQKLTEAGIKVSLFIDADRQQI--EAAKQCGAPFIELHTGHYADAETEEEQQAELK-K 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G++++V  
Sbjct: 175 IAAGASYADDLGIIVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLEKSVAE 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKALMIAARK 243


>gi|124006235|ref|ZP_01691070.1| pyridoxal phosphate biosynthetic protein PdxJ [Microscilla marina
           ATCC 23134]
 gi|123988159|gb|EAY27817.1| pyridoxal phosphate biosynthetic protein PdxJ [Microscilla marina
           ATCC 23134]
          Length = 237

 Score =  261 bits (666), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 99/246 (40%), Positives = 142/246 (57%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    P+++ + +   + GA G+TVHPRPD+RHIRY D+ ++ 
Sbjct: 1   MTKLSVNINKVATLRNARGGNNPDVIKVAQDCERFGAQGITVHPRPDERHIRYQDVMDL- 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
               ++    E NIEG PN  FL L ++ KP Q+TLVPD    LTSD GWD ++ +  LT
Sbjct: 60  ----QKVVTTEFNIEGNPNGRFLELVKKIKPTQVTLVPDAEDVLTSDTGWDTIKYEVFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           +T+A L + G R S+F +   +  +   A   GAD IE YTGPY   Y+   ++ I    
Sbjct: 116 ETIAELKSYGMRTSIFINPAKDLIT--GAAKVGADRIEFYTGPYAEQYSKDCEQAIEA-- 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+LA  + L INAGHDL + N+  L + IP + E+S+GHA    AL  G++  +  
Sbjct: 172 YVECAKLANSLGLGINAGHDLDLTNLQYLKHQIPALKEVSIGHALICDALYYGLENTIQM 231

Query: 242 FRRACG 247
           + R   
Sbjct: 232 YLRELQ 237


>gi|182679396|ref|YP_001833542.1| pyridoxine 5'-phosphate synthase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182635279|gb|ACB96053.1| pyridoxal phosphate biosynthetic protein PdxJ [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 260

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 77/249 (30%), Positives = 128/249 (51%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA LRN R    P+ V    +A+++GA G+T H R D+RHI+  D+  ++  
Sbjct: 8   RLGVNIDHVATLRNARGGARPDPVRAALLAIEAGADGITAHLREDRRHIQDGDMIRLKAA 67

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I++      LN E    E  L++  + KP    LVP+   + T++ G D L   A L   
Sbjct: 68  INK-----PLNFEMAATEQMLDIALKIKPHAACLVPERRTERTTEGGLDVLGGLATLKPF 122

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER--IFLNK 181
           VA L   G R+SLF +   +  ++ AA   GA  +EL+TG +       ++E+      +
Sbjct: 123 VAELGRAGIRVSLFIEP--SFEAIDAAVDIGAPVVELHTGAWCHAVEEGEREKAAREFER 180

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L + AQ A +  L+ +AGH L  +    +++A+P I E+++GH     A+  G+ EA+  
Sbjct: 181 LRLAAQRAARAGLECHAGHGLDFET-ARILSALPEIVELNIGHFLIGEAVFIGLPEAIRQ 239

Query: 242 FRRACGQHL 250
            R+A     
Sbjct: 240 MRKAMDAGR 248


>gi|117620211|ref|YP_855346.1| pyridoxine 5'-phosphate synthase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117561618|gb|ABK38566.1| pyridoxal phosphate biosynthetic protein PdxJ [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 245

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 78/249 (31%), Positives = 126/249 (50%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R 
Sbjct: 4   IYLGVNIDHIATLRNARGTQYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVEILR- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               Q  +  +N+E    E  + +  R +P  + LVP+   ++T++ G D       +T 
Sbjct: 63  ----QTIQTRMNLEMAVTEEMIGIACRIQPHFVCLVPEKRTEVTTEGGLDVAGQLDKVTD 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VARL  +G+++SLF D +  +    AA  +GA  IE++TG Y     +  +      ++
Sbjct: 119 AVARLSAVGAQVSLFIDADPLQI--DAAAESGAPFIEIHTGRYADATTD-AERNAEFKRI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A  A    L++NAGH L   N+   I AIP + E+++GHA    A   G+ +AV   
Sbjct: 176 AAGASYAAGKGLKVNAGHGLHYHNV-KAIAAIPELYELNIGHAIIGRAAFDGLAKAVSDM 234

Query: 243 RRACGQHLD 251
           R    +   
Sbjct: 235 RLLMQEARQ 243


>gi|253988789|ref|YP_003040145.1| pyridoxine 5'-phosphate synthase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780239|emb|CAQ83400.1| pyridoxine 5'-phosphate synthase [Photorhabdus asymbiotica]
          Length = 243

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 76/246 (30%), Positives = 125/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A Q+GA G+T+H R D+RHI   D+  +    
Sbjct: 6   LGVNIDHIATVRNARGTNYPDPVQAAFVAEQAGADGITIHLREDRRHITDRDVELLS--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  +++  R KPE   LVP+   ++T++ G D +  +  +   V
Sbjct: 63  --QTIQTRMNLEMAVTDEMVDIACRIKPEFCCLVPEKRQEVTTEGGLDVVGQKDKVMAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  +    AA+  GA  IE++TG Y    N  +QE     ++  
Sbjct: 121 KRLSEAGILVSLFIDADHQQI--DAAREVGAPFIEIHTGAYADAENEIEQE-KEFQRIKK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LT  N+   I A+P I E+++GHA    A+  G+  AV   + 
Sbjct: 178 AATYAVGIGLTVNAGHGLTYHNVQR-IAALPEIYELNIGHAIIGRAVFSGLTAAVADMKT 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 QMRKVR 242


>gi|332884758|gb|EGK05014.1| pyridoxine 5'-phosphate synthase [Dysgonomonas mossii DSM 22836]
          Length = 243

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 94/246 (38%), Positives = 147/246 (59%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P++V +     + GA G+TVHPRPD+RHIR+ D+ +++
Sbjct: 1   MTKLSVNINKIATLRNARGGNVPDVVQVALDCEKFGAEGITVHPRPDERHIRFKDVYDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     + E NIEGYP++ F++L    +P Q+TLVPD P  +TS+ GW+ +++Q LL+
Sbjct: 61  AKI-----RTEFNIEGYPSQKFIDLVTTIRPTQVTLVPDKPDAITSNAGWNTVEHQQLLS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V     +G R S+F         ++AA  TG D IELYT PY + +   ++  I    
Sbjct: 116 DLVDTFRAVGVRTSIFVG--TELEIIEAAAKTGTDRIELYTEPYASNFLKDKEAAIE--P 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
             + A+LA+K+ L +NAGHDL+++N+  L   IP I E+S+GHA  + AL  G++  +  
Sbjct: 172 FIVAAKLAKKLGLGLNAGHDLSLENLNYLYENIPTIDEVSIGHALISDALYLGLENTIKA 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKDCLK 237


>gi|330828485|ref|YP_004391437.1| pyridoxine 5'-phosphate synthase [Aeromonas veronii B565]
 gi|328803621|gb|AEB48820.1| Pyridoxine 5'-phosphate synthase [Aeromonas veronii B565]
          Length = 245

 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 80/249 (32%), Positives = 127/249 (51%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R 
Sbjct: 4   IYLGVNIDHIATLRNARGTQYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVEILR- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               Q  +  +N+E    E  + +  R KP  + LVP+   ++T++ G D     A +T 
Sbjct: 63  ----QTIQTRMNLEMAVTEEMIGIACRIKPHFVCLVPEKRTEVTTEGGLDVAGQLAKVTD 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VARL  +G+++SLF D   +   + AA  +GA  IE++TG Y     +  +      ++
Sbjct: 119 AVARLSAVGAQVSLFIDA--DPIQIDAAAESGAPFIEIHTGRYADATTD-AERNAEFKRI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A  A    L++NAGH L   N+   I AIP + E+++GHA    A   G+ +AV   
Sbjct: 176 AAGASYAAGKGLKVNAGHGLHYHNV-KAIAAIPELYELNIGHAIIGRAAFDGLAKAVSDM 234

Query: 243 RRACGQHLD 251
           R    +   
Sbjct: 235 RLLMQEARQ 243


>gi|330446944|ref|ZP_08310595.1| pyridoxal phosphate biosynthetic protein PdxJ [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491135|dbj|GAA05092.1| pyridoxal phosphate biosynthetic protein PdxJ [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 243

 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 74/249 (29%), Positives = 126/249 (50%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ VH  ++A ++GA G+T+H R D+RHI   D+  +R 
Sbjct: 4   ILLGVNIDHIATLRNARGTRYPDPVHAAEVAERAGADGITIHLREDRRHINDRDVRILR- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  +  +N+E    +  + +    KPE + LVP+   +LT++ G D       +  
Sbjct: 63  ----ETIQTRMNLEMAVTDEMIAIALEVKPEYVCLVPEKREELTTEGGLDVAGQLEKVKA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L   G ++SLF D +  +    AA   GA  IEL+TG Y        Q    L K+
Sbjct: 119 ATEKLTAAGIKVSLFIDADRAQI--DAAHACGAPFIELHTGQYAEATTEEAQ-LDELKKI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           +  A  A  + +++NAGH LT  N+   I A+P + E+++GH+    A+  G+++AV   
Sbjct: 176 SAGASYAHDLGIKVNAGHGLTYHNVKP-IAALPELYELNIGHSIMGRAMFDGLEKAVADM 234

Query: 243 RRACGQHLD 251
           R    +   
Sbjct: 235 RDLMQEARR 243


>gi|150003065|ref|YP_001297809.1| pyridoxine 5'-phosphate synthase [Bacteroides vulgatus ATCC 8482]
 gi|254882348|ref|ZP_05255058.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides sp.
           4_3_47FAA]
 gi|294775907|ref|ZP_06741406.1| pyridoxine 5'-phosphate synthase [Bacteroides vulgatus PC510]
 gi|319640600|ref|ZP_07995319.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_1_40A]
 gi|166219083|sp|A6KXM3|PDXJ_BACV8 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|149931489|gb|ABR38187.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides vulgatus
           ATCC 8482]
 gi|254835141|gb|EET15450.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides sp.
           4_3_47FAA]
 gi|294450276|gb|EFG18777.1| pyridoxine 5'-phosphate synthase [Bacteroides vulgatus PC510]
 gi|317387770|gb|EFV68630.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_1_40A]
          Length = 238

 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 141/246 (57%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    P++V +       GA G+TVHPRPD+RHIR +D+ E+R
Sbjct: 1   MTKLSVNINKVATLRNARGGNNPDVVKVALDCEAFGAEGITVHPRPDERHIRRSDVYELR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L+       E NIEGYP+  F++L  + KP Q+TLVPD P Q+TS+ GWD   N + LT
Sbjct: 61  PLLT-----TEFNIEGYPSPEFVDLVLKVKPHQVTLVPDAPDQITSNAGWDTKTNLSFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +      G R S+F     ++  ++ A   GAD +ELYT PY      P+     +  
Sbjct: 116 ELMDTFGQAGIRTSIFVG--TDKEMIEYAAKAGADRVELYTEPY--ATMYPRNPEAAIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A++ + + + +NAGHDL++ N+  +   IP++ E+S+GHA  + AL  G+K+ +  
Sbjct: 172 FIEAAKVTRSLGMGLNAGHDLSLVNLKYMHTHIPWLDEVSIGHALISDALYMGLKQTIEE 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKNCLR 237


>gi|71892312|ref|YP_278046.1| pyridoxine 5'-phosphate synthase [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|91207222|sp|Q492D2|PDXJ_BLOPB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|71796418|gb|AAZ41169.1| putative pyridoxal phosphate biosynthetic protein [Candidatus
           Blochmannia pennsylvanicus str. BPEN]
          Length = 244

 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 125/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN RN  +P+ ++   IA QSGA  +T+H R D+RHI   D+  +    
Sbjct: 6   LGVNIDHIATLRNARNTTYPDPIYAAFIAEQSGADSITIHLREDRRHITDRDVEMLC--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    +  +N+    KP    LVP+   +LT++ G D +     L   +
Sbjct: 63  --KTIQTSMNLEIAATDEMINIACTLKPHCCCLVPERRQELTTEGGLDIINKANKLQDII 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G R+SLF D N  + S+  A   GA  IEL+TG Y    +   Q  +   ++  
Sbjct: 121 FKLTEAGIRVSLFIDPNEQQISV--AYNIGAPYIELHTGMYSHATDATTQN-LEYKRIKK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
           + Q A    L++NAGH L   N+   I  +P I E+++GHA  + ++ CG+ +A+   ++
Sbjct: 178 SVQYAVNKGLKVNAGHGLNYYNVRP-IAMLPGIQELNIGHAIISRSIFCGLPKAIQDMKK 236

Query: 245 ACGQHLD 251
                  
Sbjct: 237 LIQDSRR 243


>gi|82702882|ref|YP_412448.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosospira
           multiformis ATCC 25196]
 gi|82410947|gb|ABB75056.1| pyridoxine 5'-phosphate synthase [Nitrosospira multiformis ATCC
           25196]
          Length = 265

 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 74/250 (29%), Positives = 119/250 (47%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR  R   +P+ +    IA  +GA  +T+H R D+RHI+  D+  +R
Sbjct: 25  MIKLGVNIDHVATLRQARGTTYPDPIEAALIAESAGADAITLHLREDRRHIQDRDVEILR 84

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     K  +N+E    +  +    R KP  I LVP+   +LT++ G D  ++   + 
Sbjct: 85  GAL-----KTRMNLESAVTDEMIGFALRIKPHDICLVPERREELTTEGGLDVARHFEQVQ 139

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           +   RL   G R+SLF D    +    A+   GA  IE++TG Y        +++  L +
Sbjct: 140 RACHRLAEAGIRVSLFVDAEPAQI--DASVEAGAPVIEIHTGHYADA-QTTDEQQGELER 196

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +           L +NAGH L   N+   I AIP +SE+++GHA  A AL  G + AV  
Sbjct: 197 VRAAVSKGLNHGLTVNAGHGLHYLNVQA-IAAIPGVSELNIGHAIVARALFVGFERAVRE 255

Query: 242 FRRACGQHLD 251
            +    +   
Sbjct: 256 MKNLMLEACK 265


>gi|269101849|ref|ZP_06154546.1| pyridoxine 5'-phosphate synthase [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268161747|gb|EEZ40243.1| pyridoxine 5'-phosphate synthase [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 243

 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 81/249 (32%), Positives = 127/249 (51%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ VH  +IA ++GA G+TVH R D+RHI   D+  +R 
Sbjct: 4   ILLGVNIDHVATLRNARGTRYPDPVHAAEIAERAGADGITVHLREDRRHITDRDVRILR- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  +  +N+E    +  + +    KPE + LVP+   +LT++ G D       +  
Sbjct: 63  ----ETIQTRMNLEMAVTDEMVAIALEIKPEYVCLVPEKREELTTEGGLDVAGQLEKVKS 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L   G ++SLF D +  +    AAK  GA  IEL+TG Y    N   ++   L K+
Sbjct: 119 ATEKLTAAGIKVSLFIDADRLQI--DAAKACGAPFIELHTGHYADATNEC-EQLAELKKI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A  A  + +++NAGH LT  N+   I AIP + E+++GH+    AL  G+  AV   
Sbjct: 176 AAAASYAADLGIKVNAGHGLTYHNVSA-IAAIPELYELNIGHSIMGRALFDGLSTAVADM 234

Query: 243 RRACGQHLD 251
           R+       
Sbjct: 235 RQLMLDARR 243


>gi|145300358|ref|YP_001143199.1| pyridoxine 5'-phosphate synthase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853130|gb|ABO91451.1| pyridoxal phosphate biosynthetic protein PdxJ [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 245

 Score =  260 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 78/249 (31%), Positives = 125/249 (50%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R 
Sbjct: 4   IYLGVNIDHIATLRNARGTQYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVEILR- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               Q  +  +N+E    E  + +  R KP  + LVP+   ++T++ G D       +T 
Sbjct: 63  ----QTIQTRMNLEMAVTEEMIGIACRIKPHFVCLVPEKRTEVTTEGGLDVAGQLDKITD 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G+++SLF D +  +    AA  +GA  IE++TG Y     +  +      ++
Sbjct: 119 AVTRLSAVGAQVSLFIDADPLQI--DAAADSGAPFIEIHTGRYADATTDTDRN-AEFKRI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A  A    L++NAGH L   N+   I AIP + E+++GHA    A   G+ +AV   
Sbjct: 176 AAGASYAAGKGLKVNAGHGLHYHNV-KAIAAIPELYELNIGHAIIGRAAFDGLTKAVSDM 234

Query: 243 RRACGQHLD 251
           R    +   
Sbjct: 235 RLLMQEVRQ 243


>gi|149185999|ref|ZP_01864314.1| pyridoxal phosphate biosynthesis protein [Erythrobacter sp. SD-21]
 gi|148830560|gb|EDL48996.1| pyridoxal phosphate biosynthesis protein [Erythrobacter sp. SD-21]
          Length = 246

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 75/251 (29%), Positives = 122/251 (48%), Gaps = 10/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R    P+ V   +I    G  G+T H R D+RHIR  DL  I 
Sbjct: 4   PLRLGVNIDHVATIRNARGGDHPDPVRAAEIVASVGGDGITAHLREDRRHIRDADLKRI- 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
               ++     LN+E    E  L +  R+ P    +VP+   + T++ G D       L 
Sbjct: 63  ----QEATDLPLNLEMAATEEMLEIALRHAPHAACIVPEKREERTTEGGLDAAGQHNTLA 118

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQQERIFL 179
             V +L + G R+SLF +G+  +  L AA   G   +E +TG Y   +   + ++    L
Sbjct: 119 PIVWKLRDNGIRVSLFIEGDERQ--LDAALRLGVPVVEFHTGEYAHAHLAGDSEKTAREL 176

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++A  + LA K  ++ +AGH LT +N+   I AIP ++E+++GH     A+  G++ AV
Sbjct: 177 KRIADMSALAAKNGIEPHAGHGLTYENVQP-IAAIPQLAELNIGHYLVGEAVFVGLENAV 235

Query: 240 FCFRRACGQHL 250
              R    +  
Sbjct: 236 RQMRELMDEAR 246


>gi|325105091|ref|YP_004274745.1| pyridoxine 5'-phosphate synthase [Pedobacter saltans DSM 12145]
 gi|324973939|gb|ADY52923.1| pyridoxine 5'-phosphate synthase [Pedobacter saltans DSM 12145]
          Length = 238

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 93/244 (38%), Positives = 137/244 (56%), Gaps = 10/244 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P+++ +     + GA G+TVHPRPD+RHIRY+D+ +I+
Sbjct: 1   MTKLSVNINKIATLRNSRGGNNPDVLKVALDCERFGAEGITVHPRPDERHIRYSDVYDIK 60

Query: 62  RLIDEQFPKAELNIEGYP-NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
                +  + E NIEG    E F+ L    KP+Q+TLVPD   Q+TS+HGWD ++NQ+ L
Sbjct: 61  -----KNIRTEFNIEGNCQEEKFVKLVLDNKPDQVTLVPDALGQITSNHGWDTVKNQSYL 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              +      G R+S+F D       ++AAK TG D IELYT  Y             ++
Sbjct: 116 QDIIGVFKEQGIRVSIFVDPV--LEMVEAAKTTGTDRIELYTEAY--AVGFKTDREEAIS 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
               +A+LA K+ L INAGHDL + N+      I  + E+S+GHA    AL  G++  + 
Sbjct: 172 PYVESARLANKLGLGINAGHDLDLDNLKYFSQNIEGLLEVSIGHALICDALYLGLENTIQ 231

Query: 241 CFRR 244
            + +
Sbjct: 232 QYLK 235


>gi|228469868|ref|ZP_04054807.1| pyridoxine 5'-phosphate synthase [Porphyromonas uenonis 60-3]
 gi|228308503|gb|EEK17291.1| pyridoxine 5'-phosphate synthase [Porphyromonas uenonis 60-3]
          Length = 242

 Score =  260 bits (664), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 96/243 (39%), Positives = 140/243 (57%), Gaps = 7/243 (2%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PN+V   +   + GA G+TVHPRPD+RHI Y D+ ++R
Sbjct: 1   MTRLSVNINKIATLRNARGGDTPNVVLAARRCQEFGAEGITVHPRPDERHITYQDVRDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    E NIEGYP+++FL+L    +PEQ+TLVPD P  LTSD GW     + LL 
Sbjct: 61  -----EVVTTEFNIEGYPSDSFLDLVCSVRPEQVTLVPDKPDALTSDSGWAVADCRDLLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V RL   G R+SLF   +      +AA   GAD +ELYT PY +        ++ +  
Sbjct: 116 PIVERLKQAGIRVSLFVGTDPRHI--EAAAEIGADRVELYTEPYASQMAQSGDPKVIVAP 173

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
            A  A++AQ++ L +NAGHDL   N+   +  +  + E+S+GHA  + AL  G++E +  
Sbjct: 174 FAEAARVAQRVGLGVNAGHDLNRDNLAYFVQHVTPLDEVSIGHALISDALYLGLEETIAQ 233

Query: 242 FRR 244
           + +
Sbjct: 234 YLK 236


>gi|299135105|ref|ZP_07028296.1| pyridoxal phosphate biosynthetic protein PdxJ [Afipia sp. 1NLS2]
 gi|298590082|gb|EFI50286.1| pyridoxal phosphate biosynthetic protein PdxJ [Afipia sp. 1NLS2]
          Length = 252

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 74/253 (29%), Positives = 122/253 (48%), Gaps = 9/253 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LRN R    P+ V    +A+++GA G+T H R D+RHIR TD+  ++
Sbjct: 5   PIRLGVNVDHVATLRNARGGLLPDPVRAALLAIEAGADGITAHLREDRRHIRDTDMARLK 64

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           R I +      LN E    +  + +    KP  + LVP+   +LT++ G D +  QA L 
Sbjct: 65  REISK-----PLNFEMAVTDEMVGIALATKPHAVCLVPERRMELTTEGGLDVVGQQATLA 119

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ-QERIFLN 180
             +A+ +  G R SLF   +  +   + A    A  IE++TG +         +      
Sbjct: 120 PAIAKFNEAGIRASLFISPDPAQI--EMAAQLKAPVIEIHTGTWCDALAERNSRSDAEWL 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++   A+LA  + L+++AGH L        I A+P I E+++GH     AL  G+ +A+ 
Sbjct: 178 RVVEGAKLAHSLGLEVHAGHGLDYAT-AETIAALPQIMELNIGHFLMGEALFVGLAQAIG 236

Query: 241 CFRRACGQHLDNT 253
             R A  +     
Sbjct: 237 TMRAAMARGRAKA 249


>gi|33863362|ref|NP_894922.1| pyridoxine 5'-phosphate synthase [Prochlorococcus marinus str. MIT
           9313]
 gi|81577360|sp|Q7V6Q5|PDXJ_PROMM RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|33640811|emb|CAE21266.1| Pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. MIT 9313]
          Length = 245

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 78/255 (30%), Positives = 127/255 (49%), Gaps = 10/255 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  DL  +R
Sbjct: 1   MASLGVNIDHIANVRQARQTVEPDPVPMALLAELGGADGITVHLREDRRHIQDRDLDLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   ++ LN+E       + +  + +P+ +TLVP+   ++T++ G D    Q  L 
Sbjct: 61  -----ATVRSRLNLEMAATAEMVGIALKIQPDMVTLVPERRQEVTTEGGLDVAAQQGSLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V +L   G  +SLF D    +  L+AA  +GA  +EL+TG Y         +   L +
Sbjct: 116 GMVDQLQVAGIPVSLFVDPVSQQ--LEAAFKSGARWVELHTGAYAEAC--WADQSFELAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L      A+ + L++NAGH LT QN+   + AI  I E+++GH   A ++  G+KEAV  
Sbjct: 172 LTEATARARSLGLRVNAGHGLTYQNV-EAVAAIEGIEELNIGHTIVARSIAVGLKEAVRE 230

Query: 242 FRRACGQHLDNTMRL 256
            +R         +  
Sbjct: 231 MKRLVQNPRREPLFG 245


>gi|149192070|ref|ZP_01870295.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio shilonii AK1]
 gi|148834095|gb|EDL51107.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio shilonii AK1]
          Length = 244

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 76/250 (30%), Positives = 128/250 (51%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + +N++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SILLGINIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  +++  + +PE + LVP+   +LT++ G D       + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMIDIALKTQPEFVCLVPEKREELTTEGGLDVKGQLEKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  IEL+TG Y        Q+   L K
Sbjct: 118 AATEKLSAAGIKVSLFIDADREQI--DAAKAAGAPFIELHTGHYADAETEEDQQ-DELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G+ +AV  
Sbjct: 175 IAAGASYAADIGITVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLHKAVAD 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKAVMESARR 243


>gi|269468623|gb|EEZ80267.1| pyridoxal phosphate biosynthesis protein [uncultured SUP05 cluster
           bacterium]
          Length = 248

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 73/250 (29%), Positives = 127/250 (50%), Gaps = 10/250 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MS  + VN++ +A +R  R   +P+ +    +  QSGA  +T+H R D+RHI+  D+  +
Sbjct: 1   MSIYLGVNIDHIATIRQARGTNYPSPIEGALLCEQSGADSITLHLREDRRHIQDLDVEIL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R  +       ++N+E    +  +N+  R KP+   LVP+   +LT++ G D     + +
Sbjct: 61  RDQLT-----TKMNLEMAATDEMVNIASRIKPQDCCLVPEKREELTTEGGLDVASKISRM 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T   A+L      +SLF D   ++    AAK  GA  IEL+TG Y     +  +++    
Sbjct: 116 TDVCAKLAESKVIVSLFIDAQKDQI--DAAKQCGAPVIELHTGHYADAMGD--EQKAEFE 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++   A  A  + LQ+NAGH LT++N    I  +P I E+++GH+  A A+  G++ A  
Sbjct: 172 RIKAMATYAHSIGLQVNAGHGLTMENTAE-IAKLPEIVELNIGHSIIARAVFVGLENATR 230

Query: 241 CFRRACGQHL 250
             +    +  
Sbjct: 231 EMKDLILKVR 240


>gi|291618443|ref|YP_003521185.1| PdxJ [Pantoea ananatis LMG 20103]
 gi|291153473|gb|ADD78057.1| PdxJ [Pantoea ananatis LMG 20103]
          Length = 243

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 77/247 (31%), Positives = 121/247 (48%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATVRNARGTHYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRDTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           +       +N+E    +  L +    KP    LVP+   ++T++ G D    Q  L   V
Sbjct: 66  E-----TRMNLEMAVTDEMLAIACEIKPHFCCLVPEKREEVTTEGGLDVAGQQEKLNAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G  +SLF D +  +   +AA  +GA  IE++TG Y             L ++  
Sbjct: 121 KQLSEAGILVSLFIDPDHRQI--EAAVTSGAPYIEIHTGAYAEA-PEGPARDAELARIRQ 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+ EAV   + 
Sbjct: 178 AATFAASRGLKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVMSGLPEAVKAMKA 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LLREARR 243


>gi|237724122|ref|ZP_04554603.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. D4]
 gi|265755208|ref|ZP_06089978.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_1_33FAA]
 gi|229437582|gb|EEO47659.1| pyridoxine 5'-phosphate synthase [Bacteroides dorei 5_1_36/D4]
 gi|263234350|gb|EEZ19940.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_1_33FAA]
          Length = 238

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 93/246 (37%), Positives = 141/246 (57%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    P++V +       GA G+TVHPRPD+RHIR +D+ E+R
Sbjct: 1   MTKLSVNINKVATLRNARGGNNPDVVKVALDCEAFGAEGITVHPRPDERHIRRSDVYELR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L+       E NIEGYP   F++L  + KP Q+TLVPD P Q+TS+ GWD   N + LT
Sbjct: 61  PLLT-----TEFNIEGYPAPEFVDLVLKVKPHQVTLVPDAPDQITSNAGWDTKANLSFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +      G R S+F     ++  ++ A   GAD +ELYT PY      PQ   + +  
Sbjct: 116 ELMDTFGQAGIRTSIFVG--TDKEMIEYAAKAGADRVELYTEPY--ATMYPQNPEVAIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A++ + + + +NAGHDL++ N+  +   IP++ E+S+GHA  + AL  G+K+ +  
Sbjct: 172 FIEAAKVTRSLGMGLNAGHDLSLVNLKYMHTHIPWLDEVSIGHALISDALYMGLKQTIEE 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKNCLR 237


>gi|261820522|ref|YP_003258628.1| pyridoxine 5'-phosphate synthase [Pectobacterium wasabiae WPP163]
 gi|261604535|gb|ACX87021.1| pyridoxal phosphate biosynthetic protein PdxJ [Pectobacterium
           wasabiae WPP163]
          Length = 243

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 76/247 (30%), Positives = 125/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGINIDHIATLRNARGTAYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    E  LN+    KP    LVP+   ++T++ G D    Q  +   V
Sbjct: 63  --ETLQTRMNLEMAVTEEMLNIACEVKPHFCCLVPEKRQEVTTEGGLDVAGQQEKIDNAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL      +SLF D +  +    AA  +GA  IE++TG Y    ++  ++     ++  
Sbjct: 121 ARLSQANILVSLFIDADKRQI--DAAVASGAPYIEIHTGAYADAPDDETRQ-HEFERIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+K+AV   + 
Sbjct: 178 AATYAAAQGLKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVMSGLKDAVAEMKS 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|260556586|ref|ZP_05828804.1| pyridoxal phosphate biosynthesis protein PdxJ [Acinetobacter
           baumannii ATCC 19606]
 gi|260409845|gb|EEX03145.1| pyridoxal phosphate biosynthesis protein PdxJ [Acinetobacter
           baumannii ATCC 19606]
          Length = 241

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 74/249 (29%), Positives = 123/249 (49%), Gaps = 9/249 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTAYPDPVEAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R        K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RP-----LLKTRMNLEMAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +    AA   GA  IEL+TG Y       +Q+   L 
Sbjct: 116 KAATQALAAIGCDVSLFIDADFAQI--DAAIACGAPTIELHTGAYADATTEQEQQ-EELA 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            +    + A    L +NAGH L ++NI   I AIP I E+++GH+  A ++  G+ +AV 
Sbjct: 173 LIVKGVEYAASKGLVVNAGHGLNLKNIAP-IAAIPQIHELNIGHSIIAESVFVGLVQAVK 231

Query: 241 CFRRACGQH 249
             + A    
Sbjct: 232 DMKTAIQAA 240


>gi|307823642|ref|ZP_07653871.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylobacter
           tundripaludum SV96]
 gi|307735627|gb|EFO06475.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylobacter
           tundripaludum SV96]
          Length = 248

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 76/252 (30%), Positives = 122/252 (48%), Gaps = 9/252 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P  V    +A Q+GA G+T H R D+RHI+  D+  ++ 
Sbjct: 6   ILLGVNIDHVATLRQARGTLYPEPVQAALVAEQAGADGITAHLREDRRHIQDRDIYLLK- 64

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +     LN+E    +  + +  + +P    LVP+   +LT++ G D   N   L  
Sbjct: 65  ----EMLHTRLNMEMAVTDEMVGIAVKVQPYACCLVPEKREELTTEGGLDVAGNLHRLQW 120

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L   G+ +SLF D   +E  + AA   GA  +EL+TG Y     N  Q+   L ++
Sbjct: 121 ACDKLAGAGAEVSLFIDP--DEMQIDAAVKAGAPVVELHTGCYAEA-GNRLQQAEELARI 177

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A  A    LQ+NAGH L   N+   I AIP I E+++GH+  A A+  G+ + V   
Sbjct: 178 RRAAVYAHSAGLQVNAGHGLNFYNV-EAICAIPEIVELNIGHSIIAQAVFSGLAQTVKDL 236

Query: 243 RRACGQHLDNTM 254
           ++        ++
Sbjct: 237 KQIMRNARLQSV 248


>gi|212691798|ref|ZP_03299926.1| hypothetical protein BACDOR_01293 [Bacteroides dorei DSM 17855]
 gi|237708610|ref|ZP_04539091.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides sp.
           9_1_42FAA]
 gi|212665699|gb|EEB26271.1| hypothetical protein BACDOR_01293 [Bacteroides dorei DSM 17855]
 gi|229457310|gb|EEO63031.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides sp.
           9_1_42FAA]
          Length = 238

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 93/246 (37%), Positives = 140/246 (56%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    P++V +       GA G+TVHPRPD+RHIR +D+ E+R
Sbjct: 1   MTKLSVNINKVATLRNARGGNNPDVVKVALDCEAFGAEGITVHPRPDERHIRRSDVYELR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L+       E NIEGYP   F++L  + KP Q+TLVPD P Q+TS+ GWD   N + LT
Sbjct: 61  PLLT-----TEFNIEGYPAPEFVDLVLKVKPHQVTLVPDAPDQITSNAGWDTKANLSFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +      G R S+F     ++  ++ A   GAD +ELYT PY      PQ     +  
Sbjct: 116 ELMDTFGQAGIRTSIFVG--TDKEMIEYAAKAGADRVELYTEPY--ATMYPQNPEAAIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A++ + + + +NAGHDL++ N+  +   IP++ E+S+GHA  + AL  G+K+ +  
Sbjct: 172 FIEAAKVTRSLGMGLNAGHDLSLVNLKYMHTHIPWLDEVSIGHALISDALYMGLKQTIEE 231

Query: 242 FRRACG 247
           ++    
Sbjct: 232 YKNCLR 237


>gi|209884972|ref|YP_002288829.1| pyridoxal phosphate biosynthetic protein PdxJ [Oligotropha
           carboxidovorans OM5]
 gi|209873168|gb|ACI92964.1| pyridoxal phosphate biosynthetic protein PdxJ [Oligotropha
           carboxidovorans OM5]
          Length = 256

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 73/253 (28%), Positives = 121/253 (47%), Gaps = 9/253 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LRN R    P+ V    +A+++GA G+T H R D+RHIR  D+  ++
Sbjct: 5   PLRLGVNVDHVATLRNARGGLLPDPVRAALLAIEAGADGITAHLREDRRHIRDDDMARLK 64

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           R I +      LN E       + +    KP  + LVP+   ++T++ G D +  Q  L 
Sbjct: 65  REISK-----PLNFEMGATGEMIGIALATKPHAVCLVPERRLEITTEGGLDVVGQQGTLA 119

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGAC-YNNPQQERIFLN 180
             +A+ +  G R SLF   +  +   + A    A  IEL+TG +         +      
Sbjct: 120 PAIAQFNAAGIRTSLFISPDREQI--EMAAQLKAPVIELHTGTWCDALIAGSSKADAEWK 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++   A+LA  + L+++AGH L   +    I A+P I E+++GH     AL  G+K+A+ 
Sbjct: 178 RIVEGAKLAHSLGLEVHAGHGLDYAS-AETIAALPQIVELNIGHFLMGEALFVGLKQAIG 236

Query: 241 CFRRACGQHLDNT 253
             R A  +     
Sbjct: 237 TMRAAMARGRAKA 249


>gi|311745579|ref|ZP_07719364.1| pyridoxine 5'-phosphate synthase [Algoriphagus sp. PR1]
 gi|126578140|gb|EAZ82360.1| pyridoxine 5'-phosphate synthase [Algoriphagus sp. PR1]
          Length = 238

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 98/243 (40%), Positives = 145/243 (59%), Gaps = 9/243 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PN+V +   A + GA G+TVHPRPD+RHIR+ D+ ++ 
Sbjct: 1   MTKLSVNINKIATLRNARGANNPNVVQVALDAERFGAEGITVHPRPDERHIRHQDVFDL- 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    E NIEGYP++ F++L +  KP Q TLVPD P+ +TS+ GWD + NQ +L 
Sbjct: 60  ----AKVVTTEFNIEGYPDQRFMDLVKEVKPAQATLVPDPPNAITSNTGWDTISNQGMLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V+ L   G R+S+F +        + AKLTG D +ELYT PY       Q +   +  
Sbjct: 116 DIVSELQEAGIRVSIFINP--EIKYFEPAKLTGTDRVELYTEPY--AVGFHQDKEKAVKA 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A++A+++ L +NAGHDL + N+  L  +IPY+ E+S+GHA    AL  G++  +  
Sbjct: 172 YVEVAEIAKELGLGLNAGHDLDLHNLAFLKKSIPYLDEVSIGHALVCDALYYGLENTIQM 231

Query: 242 FRR 244
           +RR
Sbjct: 232 YRR 234


>gi|85059762|ref|YP_455464.1| pyridoxal phosphate biosynthetic protein PdxJ [Sodalis glossinidius
           str. 'morsitans']
 gi|84780282|dbj|BAE75059.1| pyridoxal phosphate biosynthetic protein [Sodalis glossinidius str.
           'morsitans']
          Length = 243

 Score =  259 bits (663), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 73/246 (29%), Positives = 125/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R + WP+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGVAWPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVQLLR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    E  +++     P    LVP+   ++T++ G D       L + V
Sbjct: 63  --KTIQTRMNLEMAVTEEMISIACDVAPHFCCLVPEKRQEVTTEGGLDVAGQPDKLRQAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L   G ++SLF D +  + +  AA   GA  IE++TG Y    +   +  +   ++  
Sbjct: 121 TCLSAAGIQVSLFIDADERQIA--AAADVGAPYIEIHTGAYADATDEVSRA-VEFARIRQ 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A K+ L++NAGH L   N+   + A+  + E+++GHA  + A+  G+ +AV   +R
Sbjct: 178 GADFAVKLGLKVNAGHGLDYHNVKP-VAALAQMQELNIGHAIISRAVIGGLADAVRDMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMREAR 242


>gi|329297708|ref|ZP_08255044.1| pyridoxine 5'-phosphate synthase [Plautia stali symbiont]
          Length = 243

 Score =  259 bits (662), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 120/247 (48%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATVRNARGTNYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVRILRDTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   +N+E    +  + +    KP  + LVP+   ++T++ G D    Q  +   V
Sbjct: 66  -----HTRMNLEMAVTDEMVGIACDIKPHFVCLVPEKRQEVTTEGGLDVAGQQDKVKAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G  +SLF D +  +   +AA  +GA  IE++TG Y             L ++A 
Sbjct: 121 KQLSEAGILVSLFIDADQRQI--EAAVASGAPYIEIHTGAYAEA-PEGLARDAELARIAS 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GH     AL  G+  AV   + 
Sbjct: 178 AATFAASRGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHTIIGRALFSGLAAAVSDMKA 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|237746713|ref|ZP_04577193.1| pyridoxine 5-phosphate synthase [Oxalobacter formigenes HOxBLS]
 gi|229378064|gb|EEO28155.1| pyridoxine 5-phosphate synthase [Oxalobacter formigenes HOxBLS]
          Length = 262

 Score =  259 bits (662), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 71/251 (28%), Positives = 126/251 (50%), Gaps = 9/251 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ V    +A ++GA  +T+H R D+RHIR  D+  IR 
Sbjct: 11  IELGVNIDHIATLRNARGTSYPDPVVAALMAEEAGADAITLHLREDRRHIRDADVRAIRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+        +N+E       ++     +P+ + LVP+   +LT++ G D ++   ++  
Sbjct: 71  LLA-----TRMNLESAMTSEMIDFACDIRPQDVCLVPERREELTTEGGLDIVRYFDIVQS 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL   G R+SLF D +  +    A+   GA  IEL+TG Y   ++   +E   L ++
Sbjct: 126 AVERLTQAGIRVSLFIDPDEEQII--ASHEAGAPVIELHTGRYANAFDEASRE-HELERV 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               +      L++NAGH L  +N+   I  I  I+E+++GH+  + A+  G K+A+   
Sbjct: 183 RQGVKEGIGHGLKVNAGHGLHYENVVP-IAEIEGIAELNIGHSIVSRAVFTGWKKAIADM 241

Query: 243 RRACGQHLDNT 253
           +    +     
Sbjct: 242 KALIVEARRPA 252


>gi|209517219|ref|ZP_03266064.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           H160]
 gi|209502355|gb|EEA02366.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           H160]
          Length = 254

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 70/252 (27%), Positives = 120/252 (47%), Gaps = 9/252 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ +    +A ++GA  +T+H R D+RHI   D+ ++R 
Sbjct: 11  IDLGVNIDHVATLRNARGTSYPDPIRAALMAEEAGADAITLHLREDRRHIVDADVRKLRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
                  K  +N+E       L++    +P  + LVP+   +LT++ G D       +  
Sbjct: 71  -----LLKTRMNLECAVTPEMLDIACEVQPHDVCLVPEKREELTTEGGLDVAGQFEAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L +  SR+SLF D    +   +AA   GA  IEL+TG Y    ++  +++   +++
Sbjct: 126 ACKQLADANSRVSLFIDPEETQI--RAAHEAGAPVIELHTGRYAEA-HDAAEQQREYDRI 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               +    + L++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV   
Sbjct: 183 VRAVEFGATLGLKVNAGHGLHYTNVQQ-IAAIDGIVELNIGHAIVAHAIFAGWDNAVREM 241

Query: 243 RRACGQHLDNTM 254
           +           
Sbjct: 242 KAIMVAARLGAR 253


>gi|325123048|gb|ADY82571.1| pyridoxal phosphate biosynthetic protein PdxJ [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 241

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 73/249 (29%), Positives = 122/249 (48%), Gaps = 9/249 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  ++GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTTYPDPVEAALICEEAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R        K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RP-----LLKTRMNLELAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +    AA   GA  IEL+TG Y        Q+   L 
Sbjct: 116 KAATQTLAAIGCDVSLFIDADLAQI--DAAVACGAPTIELHTGAYADAETEQDQQ-AELE 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A    L +NAGH L + NI   I AIP I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIIKGVEYAASKGLVVNAGHGLNLINIAP-IAAIPQIHELNIGHSIIAESVFVGLVQAVK 231

Query: 241 CFRRACGQH 249
             + A    
Sbjct: 232 DMKTAIQAA 240


>gi|317491021|ref|ZP_07949457.1| pyridoxal phosphate biosynthesis protein PdxJ [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316920568|gb|EFV41891.1| pyridoxal phosphate biosynthesis protein PdxJ [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 243

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 125/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTQYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRLLR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  + +     P    LVP+   ++T++ G D       +   V
Sbjct: 63  --QTIQTRMNLEMAVTDEMIEIACELNPHFCCLVPEKRQEVTTEGGLDVAGQLDKMMVAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  +   +AA   GA  IE++TG Y    ++  + +    ++A 
Sbjct: 121 ERLTQAGILVSLFIDADPRQI--EAAVSVGAPYIEIHTGAYADAESD-LKRQAEFERIAH 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A +  L++NAGH LT  N+   I A+P + E+++GH+    A+  G+ EAV   ++
Sbjct: 178 AARFASERGLKVNAGHGLTYHNVLP-IAALPEMHELNIGHSIIGRAVMSGLPEAVNAMKQ 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMLEARR 243


>gi|30250249|ref|NP_842319.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosomonas
           europaea ATCC 19718]
 gi|81584556|sp|Q82SJ7|PDXJ_NITEU RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|30181044|emb|CAD86234.1| Pyridoxal phosphate biosynthetic protein PdxJ [Nitrosomonas
           europaea ATCC 19718]
          Length = 241

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 82/249 (32%), Positives = 123/249 (49%), Gaps = 9/249 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ VA +R  R   +P+ V    +A  +GA  +T+H R D+RHI+  D+  +R
Sbjct: 1   MIALGVNIDHVATVRQARGTTYPSPVEAALVAEVAGADAITLHLREDRRHIQENDVVILR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     K  +N+E    E  +    R KP  I LVP+   +LT++ G D +++   ++
Sbjct: 61  DRL-----KTRMNLESAVTEEMIAFACRIKPHDICLVPERREELTTEGGLDVIRHFQQVS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               RL   G R+SLF D    +    AA   GA  IEL+TG Y        Q+ + L  
Sbjct: 116 VACKRLAEAGIRVSLFVDAQAGQI--DAAVEAGAPVIELHTGRYADAATPEMQQ-VELET 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A  A    LQ+NAGH L  +N    I AIP +SE+++GHA  A AL  G  EAV  
Sbjct: 173 IRTMAAYAFGRGLQVNAGHGLHYENTVQ-IAAIPELSELNIGHAIVARALFVGFAEAVRE 231

Query: 242 FRRACGQHL 250
            +    Q  
Sbjct: 232 MKALLQQAR 240


>gi|254464761|ref|ZP_05078172.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodobacterales
           bacterium Y4I]
 gi|206685669|gb|EDZ46151.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodobacterales
           bacterium Y4I]
          Length = 251

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 70/249 (28%), Positives = 121/249 (48%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R   +P+ V   K+A ++GA G+T H R D+RHI   D+  +   
Sbjct: 7   RLGVNIDHVATVRNARGGAYPDPVRAAKLAEEAGADGITAHLREDRRHITDADIDGLM-- 64

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +     LN E    E    +  R+KP  + +VP+   + T++ G +  + +  L   
Sbjct: 65  ---EALSVPLNFEMAATEEMQKIALRHKPHAVCIVPEKREERTTEGGLEVAREENRLAHY 121

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ--QERIFLNK 181
           +A L   G R+S+F     +   ++AA   GA+ IEL+TG Y   +   +  +    L  
Sbjct: 122 IAPLREAGCRVSIFIAA--DRKQIEAAHRIGAEVIELHTGAYCDFHAEGKLAERDRELEA 179

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   +  A  + L+++AGH LT + +   + A P + E+++GH     A+  G+  AV  
Sbjct: 180 LRDMSAYAHSLGLEVHAGHGLTYETVQP-VAAFPEVRELNIGHFLIGEAIFRGLTPAVRE 238

Query: 242 FRRACGQHL 250
            RR   +  
Sbjct: 239 MRRLMDEAR 247


>gi|300724129|ref|YP_003713446.1| pyridoxine biosynthesis protein [Xenorhabdus nematophila ATCC
           19061]
 gi|297630663|emb|CBJ91328.1| carries out condensation and ring closure step after PdxA in
           pyridoxine biosynthesis [Xenorhabdus nematophila ATCC
           19061]
          Length = 243

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 122/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ +A +RN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +    
Sbjct: 6   LGINIDHIATVRNARGTQYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVQLL---- 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            E+  +  +N+E    +  + +  + KP    LVP+   ++T++ G D +  +A +   V
Sbjct: 62  -EKTIQTRMNLEMAVTDEMVGIAVQIKPVFCCLVPEKRQEVTTEGGLDVIGQKAHIAAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L   G  +SLF D +  +    AA   GA  IE++TG Y    +  QQE     ++  
Sbjct: 121 KTLSEAGILVSLFIDADPQQI--DAAVAVGAPFIEIHTGAYADAEDEIQQE-KEFLRIKE 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
               A    L++NAGH LT  N+   I A+P I E+++GHA    A+  G+  AV   + 
Sbjct: 178 AVTYASGKGLKVNAGHGLTYHNVQR-IAALPEIYELNIGHAIIGRAVFSGLSAAVADMKT 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LLREARR 243


>gi|317049177|ref|YP_004116825.1| pyridoxal phosphate biosynthetic protein PdxJ [Pantoea sp. At-9b]
 gi|316950794|gb|ADU70269.1| pyridoxal phosphate biosynthetic protein PdxJ [Pantoea sp. At-9b]
          Length = 243

 Score =  259 bits (662), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 121/247 (48%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    I+ Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATVRNARGTNYPDPVQAAFISEQAGADGITVHLREDRRHITDRDVRILRDTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +    KP    LVP+   ++T++ G D    Q  +   V
Sbjct: 66  -----QTRMNLEMAVTDEMVGIACDIKPHFCCLVPEKRQEVTTEGGLDVAGQQDKINAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L   G  +SLF D +  +   +AA  +GA  IE++TG Y             L ++  
Sbjct: 121 KLLSEAGILVSLFIDADHRQI--EAAVASGAPYIEIHTGAYAEA-PEGLARDAELERIRK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+ EAV   + 
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVMSGLAEAVKEMKL 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LLREARR 243


>gi|293394832|ref|ZP_06639122.1| pyridoxal phosphate biosynthetic protein PdxJ [Serratia odorifera
           DSM 4582]
 gi|291422583|gb|EFE95822.1| pyridoxal phosphate biosynthetic protein PdxJ [Serratia odorifera
           DSM 4582]
          Length = 243

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 76/247 (30%), Positives = 123/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V     A Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTQYPDPVQAAFSAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  L++    +P    LVP+   ++T++ G D       +T  V
Sbjct: 63  --QTIQTRMNLEMAVTDEMLDIACELRPHFCCLVPEKREEVTTEGGLDVAGQLDKMTLAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D +  +    AA   GA  IE++TG Y          +  L ++A 
Sbjct: 121 ERLTQAGIQVSLFIDPDHRQI--DAAVAVGAPYIEIHTGAYAQAQGE-LAVQAELKRIAQ 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A +  L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV   + 
Sbjct: 178 AARYAAQKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVIGGLSAAVSDMKL 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|325981702|ref|YP_004294104.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosomonas sp.
           AL212]
 gi|325531221|gb|ADZ25942.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosomonas sp.
           AL212]
          Length = 241

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 78/250 (31%), Positives = 132/250 (52%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR  R   +P+ +    IA  SGA  +T+H R D+RHI+  D+  +R
Sbjct: 1   MIELGVNIDHVATLRQARGTTYPDPIEAALIAESSGADAITLHLREDRRHIQDRDVEILR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +        +N+E    +  + +  R KP  I LVP+   +LT++ G D +++   + 
Sbjct: 61  NRLT-----TRMNLESAVTDEMIAIALRIKPHDICLVPERREELTTEGGLDVVKHFDQIR 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           +   +L + G R+SLF + +  + +  AA   GA  IE++TG Y   ++   QE+ FL +
Sbjct: 116 RACEKLGDAGIRVSLFINADALQIN--AAARAGASVIEIHTGSYADAHSFEAQEKHFL-E 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +     L + + L++NAGH L  +N+   I AIP ISE+++GHA  A A+  G K AV  
Sbjct: 173 VQEAVGLGRDLGLKVNAGHGLHYENVQA-IAAIPEISELNIGHAIVARAIFVGFKRAVQE 231

Query: 242 FRRACGQHLD 251
            ++   +   
Sbjct: 232 MKQLMLESRK 241


>gi|261855983|ref|YP_003263266.1| pyridoxal phosphate biosynthetic protein PdxJ [Halothiobacillus
           neapolitanus c2]
 gi|261836452|gb|ACX96219.1| pyridoxal phosphate biosynthetic protein PdxJ [Halothiobacillus
           neapolitanus c2]
          Length = 250

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 76/247 (30%), Positives = 123/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ VA LR  R   +P+ VH   +A QSGA  +T+H R D+RHI+  D+  +R ++
Sbjct: 12  LGLNIDHVATLRQARGTTYPDPVHAALLAEQSGADSITLHLREDRRHIQDRDVLRLRDML 71

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  +      KP    LVP+   +LT++ G D       +    
Sbjct: 72  -----QTRMNLEMAVTEEMIEFACLVKPHDCCLVPEKREELTTEGGLDVAGQIERIYSAC 126

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G R+SLF D +  +    AA    A  IEL+TG Y    ++  Q++I  + +  
Sbjct: 127 DRLRAAGIRVSLFIDADPRQI--DAAVACEAPVIELHTGHYADTMDDAGQKQILNDIIRS 184

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
               A  + LQ+NAGH L   N+   I AIP I E+++GHA  A ++  G+ +AV   ++
Sbjct: 185 ARD-ATDVGLQVNAGHGLHYHNVQA-IAAIPQIEELNIGHAIIARSIFTGLPQAVADMKK 242

Query: 245 ACGQHLD 251
              +   
Sbjct: 243 LMREARM 249


>gi|225847888|ref|YP_002728051.1| pyridoxine 5'-phosphate synthase [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643598|gb|ACN98648.1| pyridoxine 5'-phosphate synthase [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 244

 Score =  259 bits (661), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 69/249 (27%), Positives = 122/249 (48%), Gaps = 7/249 (2%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ +A LR  R    P+ V    IA+Q+GA  +T+H R D+RHI+  DL  ++  
Sbjct: 2   RLGVNIDHIATLREARKTVEPDPVKGALIAIQAGADQITLHLREDRRHIQDEDLLRLKCE 61

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           + +      +N+E  P +    +     P   TLVP+   ++T++ G D +  +  L   
Sbjct: 62  LKDST--IPINLEMAPTQEMKQIALETLPNTCTLVPEKRQEITTEGGLDVVSLKDYLKDY 119

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           +  L   G  +SLF D + ++    AA   G D IE++TG Y        ++ +   ++ 
Sbjct: 120 IKELKQAGIHVSLFIDPDLDQI--DAALEVGCDAIEIHTGEYANACGKSVEKELE--RIK 175

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A+ A++  L++ AGH L   N+   I  I  I E+++GH+  A A+  G+ EAV   +
Sbjct: 176 KAAKYAKEKGLKVYAGHGLNYDNVKE-IAKIKEIEELNIGHSIIANAVFLGLYEAVRRMK 234

Query: 244 RACGQHLDN 252
               +  + 
Sbjct: 235 EIIKKSREE 243


>gi|221135232|ref|ZP_03561535.1| pyridoxine 5'-phosphate synthase [Glaciecola sp. HTCC2999]
          Length = 254

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 78/246 (31%), Positives = 122/246 (49%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ VH   IA ++GA G+TVH R D+RHI   D+  +    
Sbjct: 9   LGVNIDHVATLRNARGTSYPDPVHAADIAERAGADGITVHLREDRRHINDRDVEIL---- 64

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +     +N+E    +  L + ++ +P    LVP+   +LT++ G +   N + +    
Sbjct: 65  -ARTLNTRMNLEMAVTDEMLAIAKKTQPAFCCLVPEKRAELTTEGGLNVAGNLSRMQDAC 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G  +SLF D    +    AA       IE++TG Y     + +Q+   L KL  
Sbjct: 124 GQLAEQGILVSLFIDAEPEQI--DAAVACDVPYIEIHTGQYADA-TSIKQQTQELAKLKA 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             Q A +  LQ+NAGH L   N+   I AIP I E+++GHA  A A+  G+ +AV   R 
Sbjct: 181 GIQFAHQRGLQVNAGHGLHYHNVKP-IAAIPEIVELNIGHAIMARAMFDGLGKAVSDMRA 239

Query: 245 ACGQHL 250
              +  
Sbjct: 240 LMQEAR 245


>gi|170749858|ref|YP_001756118.1| pyridoxine 5'-phosphate synthase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656380|gb|ACB25435.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylobacterium
           radiotolerans JCM 2831]
          Length = 249

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 72/251 (28%), Positives = 126/251 (50%), Gaps = 10/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R   +P+ V    +A+++GA G+T H R D+RHIR TD+  ++
Sbjct: 5   KLRLGVNIDHVATVRNARGGDYPDPVRAALLAVEAGADGITAHLREDRRHIRDTDIAALK 64

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           R +        LN E    +  + +    +P    LVP+   + T++ G D +  +  L 
Sbjct: 65  RGLS-----VPLNFEMAATDEMVAIALDTRPHAACLVPEKREERTTEGGLDIVGGREHLA 119

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGAC--YNNPQQERIFL 179
             +  L   G R+SLF +       + AA+  GA  +EL+TG Y      ++  +    L
Sbjct: 120 PRIRALAEAGIRVSLFVEPEPA--IMDAARALGAPVVELHTGSYCEAALEDDDARTAREL 177

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++   A+    + L+I+AGH LT+ ++   + A+P I E+++GH+  A A+  G+  AV
Sbjct: 178 ARIRRAAEHGDGLGLEIHAGHGLTLGSVGP-VAALPQIRELNIGHSLIADAIFVGLDRAV 236

Query: 240 FCFRRACGQHL 250
              R A  +  
Sbjct: 237 RDMRAAMDRAR 247


>gi|213158238|ref|YP_002320289.1| pyridoxal phosphate biosynthetic protein PdxJ [Acinetobacter
           baumannii AB0057]
 gi|301345820|ref|ZP_07226561.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii AB056]
 gi|301594768|ref|ZP_07239776.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii AB059]
 gi|213057398|gb|ACJ42300.1| pyridoxal phosphate biosynthetic protein PdxJ [Acinetobacter
           baumannii AB0057]
          Length = 241

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 74/249 (29%), Positives = 124/249 (49%), Gaps = 9/249 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGNAYPDPVEAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R        K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RP-----LLKTRMNLEMAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +    AA   GA  IEL+TG Y       +Q+   L 
Sbjct: 116 KAATQALAAIGCDVSLFIDADFAQI--DAAIACGAPTIELHTGAYADATTEQEQQ-EELA 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A    L +NAGH L ++NI   I AIP I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIVKGVEYAASKGLVVNAGHGLNLKNIAP-IAAIPQIHELNIGHSIIAESVFVGLVQAVK 231

Query: 241 CFRRACGQH 249
             + A    
Sbjct: 232 DMKTAIQAA 240


>gi|332299679|ref|YP_004441600.1| Pyridoxine 5'-phosphate synthase [Porphyromonas asaccharolytica DSM
           20707]
 gi|332176742|gb|AEE12432.1| Pyridoxine 5'-phosphate synthase [Porphyromonas asaccharolytica DSM
           20707]
          Length = 242

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 93/243 (38%), Positives = 137/243 (56%), Gaps = 7/243 (2%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PN+V   +   + GA G+TVHPRPD+RHI Y D+ ++R
Sbjct: 1   MTRLSVNINKIATLRNARGGDTPNVVLAARRCQEFGAEGITVHPRPDERHITYQDVRDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    E NIEGYP+++FL+L    +PEQ+TLVPD P  LTSD GW     +  L 
Sbjct: 61  -----EVVTTEFNIEGYPSDSFLDLVCSVRPEQVTLVPDKPDALTSDSGWAVDDRRDFLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             + RL   G R+SLF   +      +AA   GAD +ELYT PY +        ++ +  
Sbjct: 116 PIIERLKQAGIRVSLFVGTDPRHI--EAAAEIGADRVELYTEPYASQMAQSGDPKMIVAP 173

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               AQ+A ++ L +NAGHDL   N+   +  +  + E+S+GHA  + AL  G++E +  
Sbjct: 174 FVEAAQVAHRVGLGVNAGHDLNRDNLAYFVQHVTPLDEVSIGHALISDALYLGLEETIAQ 233

Query: 242 FRR 244
           + +
Sbjct: 234 YLK 236


>gi|50085652|ref|YP_047162.1| pyridoxine 5'-phosphate synthase [Acinetobacter sp. ADP1]
 gi|91207272|sp|Q3V7G6|PDXJ_ACIAD RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|49531628|emb|CAG69340.1| pyridoxal phosphate biosynthetic protein [Acinetobacter sp. ADP1]
          Length = 241

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 72/250 (28%), Positives = 123/250 (49%), Gaps = 9/250 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    +  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTRYPDPVSAALVCEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R        K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D +     +
Sbjct: 61  RP-----LLKTRMNLELAVTDEMIAFAKEIQPQHVCFVPERRQEVTTEGGLDVVGQFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +    AA   GA  IEL+TG Y       +Q++  L 
Sbjct: 116 KAATQTLAAVGCDVSLFIDADLAQI--DAAIACGAPTIELHTGAYADAETE-EQQQAELQ 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A    L +NAGH L + NI   I AIP I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIIEGVEYAASKGLVVNAGHGLNLDNITP-IAAIPQIHELNIGHSIIADSVFVGLAQAVQ 231

Query: 241 CFRRACGQHL 250
             + A     
Sbjct: 232 HMKAAIQAAR 241


>gi|226951496|ref|ZP_03821960.1| pyridoxal phosphate biosynthesis protein [Acinetobacter sp. ATCC
           27244]
 gi|294651018|ref|ZP_06728358.1| pyridoxine 5'-phosphate synthase [Acinetobacter haemolyticus ATCC
           19194]
 gi|226837789|gb|EEH70172.1| pyridoxal phosphate biosynthesis protein [Acinetobacter sp. ATCC
           27244]
 gi|292823119|gb|EFF81982.1| pyridoxine 5'-phosphate synthase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 242

 Score =  259 bits (661), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 72/251 (28%), Positives = 127/251 (50%), Gaps = 9/251 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    +  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAAILGVNIDHVATLRQARGTVYPDPVQAALVCEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R        K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + +   +
Sbjct: 61  RP-----LLKTRMNLELAVTDEMVAFAQEIQPQHVCFVPERRQEVTTEGGLDVVGHFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +GS +SLF D +  +    AA   GA  IE++TG Y     + +Q++  L 
Sbjct: 116 KAATEALKAIGSDVSLFIDADLAQI--DAAVACGAPTIEIHTGAYADAETD-EQQQAELA 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++   A+ A    L +NAGH L + N+   I AIP I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIIKGAEYAASKGLVVNAGHGLNLNNVAP-IAAIPQIHELNIGHSIIADSVFVGLAQAVK 231

Query: 241 CFRRACGQHLD 251
             + A      
Sbjct: 232 DMKAAIQAAAR 242


>gi|327394838|dbj|BAK12260.1| pyridoxal phosphate biosynthetic protein PdxJ [Pantoea ananatis
           AJ13355]
          Length = 243

 Score =  258 bits (660), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 78/247 (31%), Positives = 120/247 (48%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATVRNARGTHYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRDTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           +       +N+E    E  L +    KP    LVP+   ++T+  G D    Q  L   V
Sbjct: 66  E-----TRMNLEMAVTEEMLAIACEIKPHFCCLVPEKREEVTTVGGLDVAGQQEKLNAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G  +SLF D +  +   +AA  +GA  IE++TG Y             L ++  
Sbjct: 121 KQLSEAGILVSLFIDPDHRQI--EAAVTSGAPYIEIHTGAYAEA-PEGPARDAELARIRQ 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+ EAV   + 
Sbjct: 178 AATFAASRGLKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVMSGLPEAVKAMKA 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LLREARR 243


>gi|313886188|ref|ZP_07819918.1| pyridoxine 5'-phosphate synthase [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|312924367|gb|EFR35146.1| pyridoxine 5'-phosphate synthase [Porphyromonas asaccharolytica
           PR426713P-I]
          Length = 242

 Score =  258 bits (660), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 94/243 (38%), Positives = 138/243 (56%), Gaps = 7/243 (2%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PN+V   +   + GA G+TVHPRPD+RHI Y D+ ++R
Sbjct: 1   MTRLSVNINKIATLRNARGGDTPNVVLAARRCQEFGAEGITVHPRPDERHITYQDVRDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    E NIEGYP+++FL+L    +PEQ+TLVPD P  LTSD GW     + LL 
Sbjct: 61  -----EVVTTEFNIEGYPSDSFLDLVCSVRPEQVTLVPDKPDALTSDSGWAVADCRDLLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             + RL   G R+SLF   +      +AA   GAD +ELYT PY +        ++ +  
Sbjct: 116 PIIERLKQAGIRVSLFVGTDPRHI--EAAAEIGADRVELYTEPYASQMAQSGDPKMIVAP 173

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               AQ+A ++ L +NAGHDL   N+   +  +  + E+S+GHA  + AL  G++E +  
Sbjct: 174 FVEAAQVAHRVGLGVNAGHDLNRDNLAYFVQHVTPLDEVSIGHALISDALYLGLEETIAQ 233

Query: 242 FRR 244
           + +
Sbjct: 234 YLK 236


>gi|89075085|ref|ZP_01161526.1| pyridoxal phosphate biosynthetic protein [Photobacterium sp. SKA34]
 gi|89049172|gb|EAR54737.1| pyridoxal phosphate biosynthetic protein [Photobacterium sp. SKA34]
          Length = 243

 Score =  258 bits (660), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 75/248 (30%), Positives = 127/248 (51%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ VH  ++A ++GA G+T+H R D+RHI   D+  +R 
Sbjct: 4   ILLGVNIDHIATLRNARGTSYPDPVHAAEVAERAGADGITIHLREDRRHINDRDVRILR- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  +  +N+E    +  + +    KPE + LVP+   +LT++ G D       +  
Sbjct: 63  ----ETIQTRMNLEMAVTDEMVAIALDVKPEYVCLVPEKREELTTEGGLDVSGQLEKVKA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L   G ++SLF D +  +    AA   GA  IEL+TG Y        Q    L K+
Sbjct: 119 ATEKLTAAGIKVSLFIDADRAQI--DAAHACGAPFIELHTGQYAEAKTEEAQ-LDELKKV 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A  A  + +++NAGH LT  N+  LI A+P + E+++GH+    A+  G++++V   
Sbjct: 176 AAGASYAHNLGIKVNAGHGLTYHNV-KLIAALPELYELNIGHSIMGRAMFDGLEKSVADM 234

Query: 243 RRACGQHL 250
           R    +  
Sbjct: 235 RLLMQEAR 242


>gi|332308046|ref|YP_004435897.1| pyridoxal phosphate biosynthetic protein PdxJ [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332175375|gb|AEE24629.1| pyridoxal phosphate biosynthetic protein PdxJ [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 245

 Score =  258 bits (660), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 83/248 (33%), Positives = 124/248 (50%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ VH   IA ++GA G+TVH R D+RHI   D+  +R 
Sbjct: 4   ILLGVNIDHIATLRNARGTQYPDPVHAADIAERAGADGITVHLREDRRHIVDRDVALLR- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               Q     LN+E    +  L++  + KPE   LVP+   +LT++ G D   NQ  + +
Sbjct: 63  ----QTINTRLNLEMAVTDEMLDIALKTKPEFCCLVPEKREELTTEGGLDVAGNQQKIAQ 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L   G  +SLF D +  +    AA    A  IE++TG Y    N   ++   L KL
Sbjct: 119 ACKQLAEAGILVSLFIDADFAQI--DAAVACNAPYIEIHTGQYAEAKNE-LEQEAELAKL 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               + A    L++NAGH L   N+   I AI  I E+++GHA  A A   G+ +AV   
Sbjct: 176 VAGIEYADAKGLKVNAGHGLHYHNVKP-IAAIEQIIELNIGHAIIARAAFDGLDKAVADM 234

Query: 243 RRACGQHL 250
           RR   +  
Sbjct: 235 RRLMLEAR 242


>gi|255019672|ref|ZP_05291751.1| Pyridoxine 5'-phosphate synthase [Acidithiobacillus caldus ATCC
           51756]
 gi|254970895|gb|EET28378.1| Pyridoxine 5'-phosphate synthase [Acidithiobacillus caldus ATCC
           51756]
          Length = 241

 Score =  258 bits (660), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 83/249 (33%), Positives = 130/249 (52%), Gaps = 9/249 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ VA LR  R   +P+ +    +A + GA  +T H R D+RH++  D+  +R
Sbjct: 1   MVALGVNIDHVATLRQARGTIYPDPLEAAFVAERFGADAITAHLREDRRHMQERDIRLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           + +     +  LN+E   +E  L L E  +P    LVP+   +LT++ G D  Q +  + 
Sbjct: 61  QCL-----RTRLNLEMAVSEDILGLAEELQPSDCCLVPERRAELTTEGGLDVCQGRERIG 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
              ARL  +G R+SLF D    +  L+AA   GA  +EL+TGPY        Q+R  L K
Sbjct: 116 LACARLAAVGVRVSLFVDPERRQ--LEAAAEVGAPVVELHTGPYANA-CTRAQQRDELAK 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   AQ A  + L+++AGH L   N+   + AIP + E+++GHA  A AL  G+  AV  
Sbjct: 173 LREAAQHAAGLGLRVHAGHGLDYPNVQA-VAAIPEVRELNIGHAIVAHALFVGLGPAVAE 231

Query: 242 FRRACGQHL 250
            +R   +  
Sbjct: 232 MKRLLREAR 240


>gi|78485082|ref|YP_391007.1| pyridoxal phosphate biosynthetic protein PdxJ [Thiomicrospira
           crunogena XCL-2]
 gi|91207572|sp|Q31HP0|PDXJ_THICR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|78363368|gb|ABB41333.1| pyridoxal phosphate biosynthetic protein PdxJ [Thiomicrospira
           crunogena XCL-2]
          Length = 248

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 76/252 (30%), Positives = 125/252 (49%), Gaps = 9/252 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + +N++ VA LR  R   +P+ V     A  +GA  +T+H R D+RHI+  D+  + 
Sbjct: 3   PIFLGLNIDHVATLRQARGTRYPDPVKAALDAEMAGADSITLHLREDRRHIQDADVYRLS 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  + ++N+E    +  L +  + +PE + LVP+   +LT++ G D    +A LT
Sbjct: 63  -----ELRQTKINLEMAATQEMLEIALKCQPEDVCLVPEKREELTTEGGLDVASQKAWLT 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
              A+L    +R+SLF D +  +    AAK  GA  IE++TG Y     +P   +  L +
Sbjct: 118 DYCAQLAENKTRVSLFIDADDAQIH--AAKEVGAPVIEIHTGTYAEL-TDPAAIKTELER 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +     LA  + L +NAGH L   N+   I AI  I E+++GHA  A A+  G+ +AV  
Sbjct: 175 IRKATDLAVSLGLTVNAGHGLHYHNVQA-IAAIKEIEELNIGHAIIAQAIFSGLPDAVSE 233

Query: 242 FRRACGQHLDNT 253
            +R         
Sbjct: 234 MKRLMVDARQQA 245


>gi|300023752|ref|YP_003756363.1| pyridoxal phosphate biosynthetic protein PdxJ [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525573|gb|ADJ24042.1| pyridoxal phosphate biosynthetic protein PdxJ [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 272

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 75/258 (29%), Positives = 124/258 (48%), Gaps = 10/258 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LRN R    P+ +    +A++ GA G+T H R D+RHI  TD+  ++
Sbjct: 19  PLRLGVNIDHVATLRNARGGVHPDPLRAAHLAIEGGADGITAHLREDRRHISDTDITRLK 78

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +        LN+E    +  L +  R+ P    LVP+   + T++ G D   +   L 
Sbjct: 79  NELTR-----PLNLEMAATDEMLKIAIRHVPNACCLVPERREERTTEGGLDVRGSVKTLK 133

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE--RIFL 179
             VA+L + G R+SLF +   +  +++AA   GAD +EL+TG Y               +
Sbjct: 134 PFVAKLQDAGIRVSLFIEP--DIKTIEAAAKVGADIVELHTGRYCNLALEHDAAGVAREI 191

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            + A  A+ A    L+++AGH LT   +   I  +P I E+++GH     A+  G+  AV
Sbjct: 192 ERHATAARAAAAAGLEVHAGHGLTYNTVKP-IAEMPEIVELNIGHFLIGEAIFGGLSGAV 250

Query: 240 FCFRRACGQHLDNTMRLT 257
              R    +  D+ +R  
Sbjct: 251 RRMRLLMDEARDDVLRSG 268


>gi|270265297|ref|ZP_06193558.1| pyridoxine 5'-phosphate synthase [Serratia odorifera 4Rx13]
 gi|270040701|gb|EFA13804.1| pyridoxine 5'-phosphate synthase [Serratia odorifera 4Rx13]
          Length = 243

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 78/247 (31%), Positives = 124/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTQYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  L++    KP+   LVP+   ++T++ G D    Q  +   V
Sbjct: 63  --QTIQTRMNLEMAVTDEMLDIAIELKPQFCCLVPEKREEVTTEGGLDVAGQQDKMAVAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  +    AA   GA  IE++TG Y          +  L+++A+
Sbjct: 121 ERLAQAGILVSLFIDPDHRQI--DAAVAVGAPYIEIHTGAYAEATGE-LAVKAELHRIAV 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV   + 
Sbjct: 178 AATYAAGKGLKVNAGHGLTYHNVQP-IAALPEMYELNIGHAIIGQAVMSGLPAAVADMKL 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|145588596|ref|YP_001155193.1| pyridoxal phosphate biosynthetic protein PdxJ [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047002|gb|ABP33629.1| pyridoxine 5'-phosphate synthase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 248

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 75/248 (30%), Positives = 133/248 (53%), Gaps = 10/248 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ VA LRN R   +P+ +   ++A  +GA  +T+H R D+RHI+  DL  +R   
Sbjct: 9   LGINIDHVATLRNARGTIYPDPLRAAQLAESAGADLITLHLREDRRHIKDADLFALRP-- 66

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E       +++  + KP  + LVP+   ++T++ G D + +   +    
Sbjct: 67  ---LIKTRMNLECAVTPEMIDIACKVKPHDVCLVPEKREEVTTEGGLDVVGHYEAVKAAT 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ++L N G R+SLF D    E  +QAAK  GA  +EL+TG Y     +  ++ + L ++  
Sbjct: 124 SQLKNAGIRVSLFIDP--EEKQIQAAKDIGATVVELHTGRY--ADLSGSEQVVELERIRK 179

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+  + + L++NAGH L   N+  +  AI  +SE+++GHA  A AL  G ++A+   + 
Sbjct: 180 AAKFGKSIGLRVNAGHGLHEGNVMPM-AAIDELSELNIGHAIVAEALFKGWQKAITDMKA 238

Query: 245 ACGQHLDN 252
              Q  +N
Sbjct: 239 LMVQGRNN 246


>gi|332977453|gb|EGK14228.1| pyridoxal phosphate biosynthetic protein PdxJ [Psychrobacter sp.
           1501(2011)]
          Length = 253

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 82/247 (33%), Positives = 130/247 (52%), Gaps = 12/247 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R + +P+ V    +  Q+GA G+T+H R D+RHI+  D+  ++   
Sbjct: 14  LGVNIDHVATLRQARGVNYPDPVEAALLCEQAGADGITLHLREDRRHIQDDDVYRMKP-- 71

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E    E  LN+    KPE I LVP+   +LT++ G D       + + +
Sbjct: 72  ---LLKTRMNLEMATTEEMLNIALEVKPEWICLVPEKREELTTEGGLDVASQVENIKRYI 128

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY----NNPQQERIFLN 180
           A LH +GS++SLF D   +   + AA    AD IEL+TG Y        +   +  +   
Sbjct: 129 ASLHQVGSKVSLFIDP--DAKQIDAAIACKADAIELHTGQYAEATLAKESTAIEHELNRI 186

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           K A    L+Q+  L +NAGH LT  N+   I  IP I E+++GHA  A ++  G+++AV 
Sbjct: 187 KSATKYALSQQETLIVNAGHGLTRDNVSA-IARIPGIYELNIGHALIADSVFMGLEKAVA 245

Query: 241 CFRRACG 247
             ++A  
Sbjct: 246 TMKQAMQ 252


>gi|71279180|ref|YP_270774.1| pyridoxine 5'-phosphate synthase [Colwellia psychrerythraea 34H]
 gi|91207229|sp|Q47WP8|PDXJ_COLP3 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|71144920|gb|AAZ25393.1| pyridoxal phosphate biosynthetic protein PdxJ [Colwellia
           psychrerythraea 34H]
          Length = 246

 Score =  258 bits (660), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 73/246 (29%), Positives = 124/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R   +P+ V+   +A  +GA G+TVH R D+RHI+  D+  ++   
Sbjct: 6   LGVNVDHIATLRQARGTNYPDPVYAASVAEHAGADGITVHLREDRRHIQDRDIHVLK--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N E    +  + +    KP    LVP+   +LT++ G D +     +TK  
Sbjct: 63  --QTLHTRMNFEMAVTDEMIAIACDVKPVFCCLVPEKREELTTEGGLDVVGQLDKITKAT 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G  +SLF D +  +    AA  + A  IE++TG Y    +  +++ I L +L +
Sbjct: 121 EQLTAAGIAVSLFIDADKAQI--DAAVASKAPYIEIHTGHYADLSSE-EEQLIELERLTV 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             + A  + L++NAGH L   N+   I AI  I E+++GHA  A A   G+ +AV   ++
Sbjct: 178 GIKYAHNLGLKVNAGHGLNYFNVKP-IAAIKEIIELNIGHAIIARAAIDGLDKAVRDMKQ 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|291613752|ref|YP_003523909.1| pyridoxal phosphate biosynthetic protein PdxJ [Sideroxydans
           lithotrophicus ES-1]
 gi|291583864|gb|ADE11522.1| pyridoxal phosphate biosynthetic protein PdxJ [Sideroxydans
           lithotrophicus ES-1]
          Length = 238

 Score =  258 bits (659), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 75/246 (30%), Positives = 129/246 (52%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + +N++ VA LR  R   +PNL+    I  ++GA  +T+H R D+RHI+  D+  +R
Sbjct: 1   MIKLGLNIDHVATLRQARGSRYPNLMRAALICEEAGADAITIHLREDRRHIQDADVDILR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++     +  +N+E    +  +    R KP  I LVP+   +LT++ G D +++   + 
Sbjct: 61  GML-----QTRMNLECAVTDEMIANALRVKPHDICLVPEKREELTTEGGLDVVKHFDAVQ 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           +   R    G R+SLF D   ++  L AAK  GA  IE++TG YG   ++       L +
Sbjct: 116 RATQRCTEAGIRVSLFVDA--DDKQLDAAKKAGAPVIEIHTGKYGDA-DSVPAREQELAR 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A  A  + LQ+NAGH L   N+  ++  IP+I+E+++GHA  + A+  G+ +AV  
Sbjct: 173 IQRAAVYAHSLGLQVNAGHGLNYHNVRPIVA-IPHIAELNIGHAIISEAVFIGLDQAVKN 231

Query: 242 FRRACG 247
            +    
Sbjct: 232 MKALLA 237


>gi|254507464|ref|ZP_05119598.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio
           parahaemolyticus 16]
 gi|219549534|gb|EED26525.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio
           parahaemolyticus 16]
          Length = 243

 Score =  258 bits (659), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 77/250 (30%), Positives = 126/250 (50%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  ++A ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEVAERAGADGITIHLREDRRHINDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +    +PE + LVP+   +LT++ G D +     + 
Sbjct: 63  -----ETIQTRMNLEMAVTDEMVEIALNTQPEYVCLVPEKREELTTEGGLDVVGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AAK  GA  IEL+TG Y        Q+   L K
Sbjct: 118 AATQKLSEAGIKVSLFIDADREQI--DAAKACGAPFIELHTGHYADAETEEDQQ-DELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GH+    A   G+ +AV  
Sbjct: 175 IAAGASYAADLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHSIIGRAAFDGLHKAVAD 233

Query: 242 FRRACGQHLD 251
            +        
Sbjct: 234 MKAQMVLARK 243


>gi|298207453|ref|YP_003715632.1| putative pyridoxine biosynthesis protein [Croceibacter atlanticus
           HTCC2559]
 gi|83850089|gb|EAP87957.1| putative pyridoxine biosynthesis protein [Croceibacter atlanticus
           HTCC2559]
          Length = 237

 Score =  258 bits (659), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 141/246 (57%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R   +PN+V + K   + G  G+TVHPRPD+RHIRY D+ ++ 
Sbjct: 1   MTKLSVNINKIATLRNSRGGNYPNVVQVAKDVERFGGQGITVHPRPDERHIRYQDVRDLA 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++       E NIEG PN  F++L  + KP Q+TLVPD    +TS+ GWD ++++  LT
Sbjct: 61  PIVT-----TEFNIEGNPNPKFIDLVLQNKPTQVTLVPDAVDAITSNAGWDTVKHKDFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + ++   N G R S+F D        + A   GAD IELYT  +   +    +E   +  
Sbjct: 116 EIISEFKNNGIRTSVFVDPVAAMI--EGASKIGADRIELYTEAFADKFTISPEE--AVRP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
              +A LA  ++L INAGHDL+++NI      +PY+ E+S+GHA    +L  G++  +  
Sbjct: 172 YTESAMLAHSLNLGINAGHDLSLKNIAYFKEKVPYLLEVSIGHALIGESLYLGLETVISN 231

Query: 242 FRRACG 247
           + +A  
Sbjct: 232 YLKALK 237


>gi|307730524|ref|YP_003907748.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           CCGE1003]
 gi|307585059|gb|ADN58457.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           CCGE1003]
          Length = 254

 Score =  258 bits (659), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 72/252 (28%), Positives = 122/252 (48%), Gaps = 9/252 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ +    +A ++GA  +T+H R D+RHI   D+  +R 
Sbjct: 11  IDLGVNIDHVATLRNARGTSYPDPIRAALMAEEAGADAITLHLREDRRHIVDADVRALRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
                  K  +N+E    +  L++    +P  + LVP+   +LT++ G D       +  
Sbjct: 71  -----LLKTRMNLECAVTQEMLDIACEVQPHDVCLVPEKRQELTTEGGLDVAGQFEAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L +  SR+SLF D +  +   +AA   GA  +EL+TG Y    ++P Q++    ++
Sbjct: 126 ACRQLADANSRVSLFIDPDETQI--RAAHEAGAPVVELHTGRYAEA-HDPAQQQREYERV 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A+    + +++NAGH L   N+   I AI  I E+++GHA  A AL  G   AV   
Sbjct: 183 VRAAEFGATLGIKVNAGHGLHYTNVQQ-IAAIDGIVELNIGHAIVAHALFAGWDNAVREM 241

Query: 243 RRACGQHLDNTM 254
           +           
Sbjct: 242 KAIMVAARLGAR 253


>gi|37527213|ref|NP_930557.1| pyridoxal phosphate biosynthetic protein PdxJ [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|81572413|sp|Q7N1X8|PDXJ_PHOLL RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|36786647|emb|CAE15711.1| Pyridoxal phosphate biosynthetic protein PdxJ (PNP synthase)
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 243

 Score =  258 bits (659), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 124/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A Q+GA G+T+H R D+RHI   D+  ++   
Sbjct: 6   LGVNIDHIATVRNARGTHYPDPVQAAFVAEQAGADGITIHLREDRRHITDRDVELLK--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    +  +++  R KPE   LVP+   ++T++ G D +  +  +   V
Sbjct: 63  --KTIQTRMNLEMAVTDEMVDIACRIKPEFCCLVPEKRQEVTTEGGLDVIGQKDKVAAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D    +    AA   GA  IE++TG Y    N   ++    +++  
Sbjct: 121 KRLSDAGILVSLFIDAEHRQI--DAANEVGAPFIEIHTGAYADAKNE-VEQEKEFHRIKA 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L +NAGH LT  N+   I A+P I E+++GHA    A+  G+  AV   + 
Sbjct: 178 AATYAASKGLTVNAGHGLTYHNVQR-IAALPEIYELNIGHAIIGRAVFSGLTAAVADMKT 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 QMRKARR 243


>gi|262373074|ref|ZP_06066353.1| pyridoxal phosphate biosynthesis protein PdxJ [Acinetobacter junii
           SH205]
 gi|262313099|gb|EEY94184.1| pyridoxal phosphate biosynthesis protein PdxJ [Acinetobacter junii
           SH205]
          Length = 242

 Score =  258 bits (659), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 72/247 (29%), Positives = 124/247 (50%), Gaps = 9/247 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  ++GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAAILGVNIDHVATLRQARGTTYPDPVQAALICEEAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R        K  +N+E    +  +   +  KP+ +  VP+   ++T++ G D + +   +
Sbjct: 61  RP-----LLKTRMNLELAVTDEMVEFAKEIKPQHVCFVPERRQEVTTEGGLDVVGHFDKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +GS +SLF D +  +    AA   GA  IE++TG Y        ++   L 
Sbjct: 116 KAATEALKAIGSDVSLFIDADFAQI--DAAVACGAPTIEIHTGAYADAETE-AEQHAELE 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++   A+ A    L +NAGH L + N+   I AIP I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIIKGAEYAAAKGLVVNAGHGLNLNNVAP-IAAIPQIHELNIGHSIIADSIFVGLAQAVK 231

Query: 241 CFRRACG 247
             + A  
Sbjct: 232 DMKAAIQ 238


>gi|90580328|ref|ZP_01236135.1| pyridoxal phosphate biosynthetic protein [Vibrio angustum S14]
 gi|90438630|gb|EAS63814.1| pyridoxal phosphate biosynthetic protein [Vibrio angustum S14]
          Length = 243

 Score =  258 bits (659), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 74/248 (29%), Positives = 126/248 (50%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ VH  ++A ++GA G+T+H R D+RHI   D+  +R 
Sbjct: 4   ILLGVNIDHIATLRNARGTRYPDPVHAAEVAERAGADGITIHLREDRRHINDRDVRILR- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  +  +N+E    +  + +    KPE + LVP+   +LT++ G D       +  
Sbjct: 63  ----ETIQTRMNLEMAVTDEMVAIALDVKPEYVCLVPEKREELTTEGGLDVAGQLEKVKA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L   G ++SLF D +  +    AA   GA  IEL+TG Y        Q    L K+
Sbjct: 119 ATEKLTAAGIKVSLFIDADRAQI--DAAHACGAPFIELHTGQYAEATTEEAQ-SDELKKV 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A  A  + +++NAGH LT  N+   I A+P + E+++GH+    A+  G++++V   
Sbjct: 176 AAGASYAHNLGIKVNAGHGLTYHNVKP-IAALPELYELNIGHSIMGRAMFDGLEKSVADM 234

Query: 243 RRACGQHL 250
           R    +  
Sbjct: 235 RLLMQEAR 242


>gi|317970356|ref|ZP_07971746.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. CB0205]
          Length = 249

 Score =  258 bits (659), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 79/256 (30%), Positives = 130/256 (50%), Gaps = 10/256 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MASLGVNIDHIANVRQARRTVEPDPVSYALLAELGGADGITVHLREDRRHIQDRDVELLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  ++ LN+E         +  R KP+ +TLVP+   ++T++ G D       + 
Sbjct: 61  -----QVVRSRLNLEMAATAEMEAIALRIKPDMVTLVPEKREEVTTEGGLDVASQLTTIK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               RL + G  +SLF D   ++  L+A + +GA  +EL+TG Y     N QQ+   L +
Sbjct: 116 GISGRLQDAGIGVSLFVDAEASQ--LEACQASGARWVELHTGTYAEA--NWQQQAKELAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +     +A+ + L++NAGH LT QN+   I AI  + E+++GH   A AL  G++EAV  
Sbjct: 172 ITEGTFIARSLGLRVNAGHGLTYQNVEP-IAAIEGMEELNIGHTIVARALAVGLEEAVRQ 230

Query: 242 FRRACGQHLDNTMRLT 257
            +          +  +
Sbjct: 231 MKALVQNPRREPLFGS 246


>gi|304398617|ref|ZP_07380489.1| pyridoxal phosphate biosynthetic protein PdxJ [Pantoea sp. aB]
 gi|304353828|gb|EFM18203.1| pyridoxal phosphate biosynthetic protein PdxJ [Pantoea sp. aB]
          Length = 243

 Score =  258 bits (659), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 123/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATVRNARGTNYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRDTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +    +P    LVP+   ++T++ G D    Q  +   V
Sbjct: 66  -----QTRMNLEMAVTDEMIGIACDIQPHFCCLVPEKRQEVTTEGGLDVAGQQEKMNAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G  +SLF D +  +   +AA  TGA  IE++TG Y             L ++  
Sbjct: 121 RLLKDAGILVSLFIDADHRQI--EAAVATGAPYIEIHTGAYAEA-PEGLARDAELARIRH 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+ +AV   ++
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVMSGLPDAVKEMKQ 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LLREARR 243


>gi|262278200|ref|ZP_06055985.1| pyridoxal phosphate biosynthetic protein [Acinetobacter
           calcoaceticus RUH2202]
 gi|262258551|gb|EEY77284.1| pyridoxal phosphate biosynthetic protein [Acinetobacter
           calcoaceticus RUH2202]
          Length = 241

 Score =  258 bits (659), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 122/247 (49%), Gaps = 9/247 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTTYPDPVEAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R        K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RP-----LLKTRMNLELAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +    AA   GA  IEL+TG Y        Q+   L 
Sbjct: 116 KAATQTLAAIGCDVSLFIDADLAQI--DAAVACGAPTIELHTGAYADAATEQDQQ-AELA 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A    L +NAGH L ++NI   I AI  I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIIKGVEYAASKGLVVNAGHGLNLKNIAP-IAAISQIHELNIGHSIIAESIFVGLVQAVK 231

Query: 241 CFRRACG 247
             + A  
Sbjct: 232 DMKAAIQ 238


>gi|110639772|ref|YP_679982.1| pyridoxine 5'-phosphate synthase [Cytophaga hutchinsonii ATCC
           33406]
 gi|122966509|sp|Q11PM4|PDXJ_CYTH3 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|110282453|gb|ABG60639.1| pyridoxine 5'-phosphate synthase [Cytophaga hutchinsonii ATCC
           33406]
          Length = 238

 Score =  258 bits (659), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 89/247 (36%), Positives = 138/247 (55%), Gaps = 9/247 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A +RN R    P+L+ +     + GA G+T+HPRPD+RHIRY D  +++
Sbjct: 1   MTRLSVNINKIATIRNARGGNNPDLLKVALDCERFGAEGITIHPRPDERHIRYQDAYDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    E NIEG P   F+ L E  KP+Q+TLVPD  + +TS+ GWD + +Q+ LT
Sbjct: 61  -----KIVTTEFNIEGNPEGEFIALVENIKPDQVTLVPDAVNAITSNAGWDTITHQSFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + ++     G R+S+F D       ++ A   GAD +ELYT PY    +    +   + +
Sbjct: 116 EIISNFKKAGIRVSVFVDPVTA--MVEGAAKAGADRVELYTEPY--ATSFHSNKEAAIKE 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A  A+ + L INAGHDL + N+  L   IP++ E+S+GHA    AL  G++  +  
Sbjct: 172 YIEAAAAAKSLGLGINAGHDLDLFNLNYLKKNIPFLDEVSIGHALICDALYYGLENTIQL 231

Query: 242 FRRACGQ 248
           + R   +
Sbjct: 232 YLRELKK 238


>gi|290476131|ref|YP_003469031.1| carries out condensation and ring closure step after PdxA in
           pyridoxine biosynthesis [Xenorhabdus bovienii SS-2004]
 gi|289175464|emb|CBJ82267.1| carries out condensation and ring closure step after PdxA in
           pyridoxine biosynthesis [Xenorhabdus bovienii SS-2004]
          Length = 243

 Score =  258 bits (659), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 73/246 (29%), Positives = 124/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ +A +RN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +    
Sbjct: 6   LGINIDHIATVRNARGTQYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVQLL---- 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    +  +++  + KP    LVP+   ++T++ G D L  +  +   V
Sbjct: 62  -AKTIQTRMNLEMAVTDEMIDIACQIKPVFCCLVPEKRQEVTTEGGLDVLGQKVHIAAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  + +  AA   GA  IE++TG Y    N+ QQE     ++  
Sbjct: 121 KRLSEAGIFVSLFIDADHQQIA--AAAEVGAPFIEIHTGAYADAENDIQQE-QEFLRIKE 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
               A    +++NAGH LT  N+   I A+P I E+++GHA    A+  G+  AV   + 
Sbjct: 178 AVTYAAGKGIKVNAGHGLTYHNVQR-IAALPEIYELNIGHAIIGRAVFSGLSAAVADMKT 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LLREAR 242


>gi|148239707|ref|YP_001225094.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp. WH
           7803]
 gi|166219115|sp|A5GLI2|PDXJ_SYNPW RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|147848246|emb|CAK23797.1| Pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp. WH
           7803]
          Length = 247

 Score =  258 bits (658), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 77/256 (30%), Positives = 132/256 (51%), Gaps = 10/256 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MASLGVNIDHIANVRQARRTVEPDPVPMALLAELGGADGITVHLREDRRHIQDRDVDLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  ++ LN+E    E  + +  R +P+ +TLVP+   ++T++ G D    +  LT
Sbjct: 61  -----QTVRSRLNLEMAATEDMVLIALRVQPDMVTLVPERREEVTTEGGLDVSSQRVDLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             ++RL + G  +SLF D    +  L+A +   A  +EL+TG Y         +   L +
Sbjct: 116 SKISRLQDAGIPVSLFVDPERGQ--LEACRDCRARWVELHTGTYAEA--KWTDQPSELAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L     LA+ M L++NAGH LT QN+   + AI  + E+++GH   A A+  G+++AV  
Sbjct: 172 LTEATALARAMGLRVNAGHGLTYQNVEP-VAAIEGMEELNIGHTIVARAVAVGLQQAVRE 230

Query: 242 FRRACGQHLDNTMRLT 257
            +        + +  +
Sbjct: 231 MKALVQNPRRDPLFGS 246


>gi|159028896|emb|CAO90701.1| pdxJ [Microcystis aeruginosa PCC 7806]
          Length = 240

 Score =  258 bits (658), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 76/246 (30%), Positives = 122/246 (49%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ VA +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MLTLGVNIDHVATIRQARRTVEPDPVAAAVLAEIGGADGITVHLREDRRHIQDRDVRLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  +  LN+E  P E  + +    KP+ +TLVP+   ++T++ G D L N     
Sbjct: 61  -----QTVRTHLNLEMAPTEEMIAIALDLKPDYVTLVPEKREEVTTEGGIDMLGNFDRFC 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V  L +    +S F D +  +   QAA  TGA  IEL+TG Y          +  L  
Sbjct: 116 RVVECLQSANIPVSWFIDADFAQI--QAAANTGAKFIELHTGQYAEA-QEESDCQAALTI 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L    + A  + L++NAGH LT  N+   +  +P + E+++GH   + A+  G++ AV  
Sbjct: 173 LKEGCEYASSLGLRVNAGHGLTYWNV-YAVACLPNMEELNIGHTIISRAVLVGLERAVRE 231

Query: 242 FRRACG 247
            + A  
Sbjct: 232 MKLAMR 237


>gi|209363807|ref|YP_001423906.2| pyridoxine 5'-phosphate synthase [Coxiella burnetii Dugway
           5J108-111]
 gi|212219217|ref|YP_002306004.1| pyridoxine 5'-phosphate synthase [Coxiella burnetii CbuK_Q154]
 gi|215919198|ref|NP_820477.2| pyridoxine 5'-phosphate synthase [Coxiella burnetii RSA 493]
 gi|206584082|gb|AAO90991.2| pyridoxal phosphate biosynthetic protein [Coxiella burnetii RSA
           493]
 gi|207081740|gb|ABS77445.2| pyridoxal phosphate biosynthetic protein [Coxiella burnetii Dugway
           5J108-111]
 gi|212013479|gb|ACJ20859.1| pyridoxal phosphate biosynthetic protein [Coxiella burnetii
           CbuK_Q154]
          Length = 251

 Score =  258 bits (658), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 82/249 (32%), Positives = 130/249 (52%), Gaps = 9/249 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ +A LR  R + +P+ V    +A+++GA G+T+H R D+RHI+  D+  ++
Sbjct: 12  MVRLGVNIDHIATLRQARGVDYPDPVEAAMMAIEAGADGITLHLREDRRHIQDDDVRNLK 71

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           R +        +N+E    E  +   E  KPE   LVP+   +LT++ G D    Q  L 
Sbjct: 72  RKLT-----VPMNLEMATAEDIIQFAEEIKPEHCCLVPEKREELTTEGGLDVAGQQNTLK 126

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           K  ARL  +G  +SLF D    E  + AAK  GA  IE++TG Y     +  +    L +
Sbjct: 127 KVCARLAKVGIEVSLFIDP--EEKQIDAAKAAGAPVIEIHTGHYANAKTDH-EHNQQLKR 183

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + L +NAGH LTI N+ + I AIP I+E+++GH+  +  +  G+ EAV  
Sbjct: 184 IADAAAYADSLGLTVNAGHGLTIHNVQS-IAAIPVINELNIGHSIISRGVLIGLAEAVKE 242

Query: 242 FRRACGQHL 250
            +       
Sbjct: 243 MKTLIAGAQ 251


>gi|318040192|ref|ZP_07972148.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. CB0101]
          Length = 249

 Score =  258 bits (658), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 80/256 (31%), Positives = 129/256 (50%), Gaps = 10/256 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V    +A   GA G+TVH R D+RHI   D+  +R
Sbjct: 1   MASLGVNIDHIANVRQARRTVEPDPVSYALLAELGGADGITVHLREDRRHIHDRDVELLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  ++ LN+E         +  R KP+ +TLVP+   ++T++ G D       L 
Sbjct: 61  -----QVVRSRLNLEMAATPEMEAIALRIKPDMVTLVPEKREEVTTEGGLDVAGQLEPLQ 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V RL   G  +SLF D    +  L+A +  GA  +EL+TG Y     + QQ+ + L +
Sbjct: 116 GLVGRLQEAGIGVSLFVDAEPTQ--LEACRAAGARWVELHTGTYAEA--DWQQQPLELAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   + +A+ + L++NAGH LT QN+   + AI  + E+++GH   A AL  G++EAV  
Sbjct: 172 LTEGSFIARSLGLRVNAGHGLTYQNVEP-VAAIEGMEELNIGHTIVARALAVGLEEAVRQ 230

Query: 242 FRRACGQHLDNTMRLT 257
            +          +  +
Sbjct: 231 MKALVQNPRGEPLFGS 246


>gi|114331753|ref|YP_747975.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosomonas
           eutropha C91]
 gi|122313496|sp|Q0AF72|PDXJ_NITEC RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|114308767|gb|ABI60010.1| pyridoxine 5'-phosphate synthase [Nitrosomonas eutropha C91]
          Length = 241

 Score =  258 bits (658), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 81/249 (32%), Positives = 125/249 (50%), Gaps = 9/249 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ VA LR  R   +P+ +    +A +SGA  +T+H R D+RHI+  D+  +R
Sbjct: 1   MIALGVNIDHVATLRQARGTDYPSPIKAALVAEESGADAITLHLREDRRHIQEEDVIILR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  K  +N+E    E  ++   R KP  I LVP+   +LT++ G D +++   ++
Sbjct: 61  -----ERLKTRMNLESAVTEEMISFACRIKPHDICLVPERREELTTEGGLDVIRHFDQVS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               RL   G R+SLF D   ++    AA   GA  IEL+TG Y     +  Q+   L  
Sbjct: 116 AACKRLTEAGIRVSLFVDARADQI--DAAIRVGAPVIELHTGHYADAATSEAQQ-AELET 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A  A    LQ+NAGH L  QN    I  IP I+E+++GHA  A AL  G  +AV  
Sbjct: 173 IRSMAAYAFSRGLQVNAGHSLHYQNTTP-IAFIPEITELNIGHAIVARALFIGFAQAVRE 231

Query: 242 FRRACGQHL 250
            +    +  
Sbjct: 232 MKTLMQEAR 240


>gi|255320776|ref|ZP_05361951.1| pyridoxine 5'-phosphate synthase [Acinetobacter radioresistens
           SK82]
 gi|262379448|ref|ZP_06072604.1| pyridoxal phosphate biosynthesis protein PdxJ [Acinetobacter
           radioresistens SH164]
 gi|255302153|gb|EET81395.1| pyridoxine 5'-phosphate synthase [Acinetobacter radioresistens
           SK82]
 gi|262298905|gb|EEY86818.1| pyridoxal phosphate biosynthesis protein PdxJ [Acinetobacter
           radioresistens SH164]
          Length = 241

 Score =  258 bits (658), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 75/250 (30%), Positives = 126/250 (50%), Gaps = 9/250 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V+   I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTVYPDPVNAALICEQAGAEGITLHLREDRRHIQDGDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R  +     K  +N+E       +   +  +P+ +  VP+   +LT++ G D + N   +
Sbjct: 61  RPAL-----KTRMNLEIAVTNEMVEFAKEIRPQHVCFVPEKRQELTTEGGLDVVTNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +    AA   GA  IE++TG Y   +N   +++  L 
Sbjct: 116 KAATQALLQVGCDVSLFIDADLAQI--DAAIACGAPTIEIHTGAYADAHNE-AEQQAELE 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A    L +NAGH L I N+   I AIP I E+++GH+  A +L  G+ +AV 
Sbjct: 173 RIIKGTEYAAGKGLVVNAGHGLNIDNVTP-IAAIPQIHELNIGHSIIADSLFIGLAQAVQ 231

Query: 241 CFRRACGQHL 250
             + A     
Sbjct: 232 QMKAAIKAAR 241


>gi|299769161|ref|YP_003731187.1| pyridoxine 5'-phosphate synthase [Acinetobacter sp. DR1]
 gi|298699249|gb|ADI89814.1| pyridoxine 5'-phosphate synthase [Acinetobacter sp. DR1]
          Length = 241

 Score =  258 bits (658), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 122/247 (49%), Gaps = 9/247 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTTYPDPVEAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R        K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RP-----LLKTRMNLELAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +    AA   GA  IEL+TG Y        Q+   L 
Sbjct: 116 KAATQTLAAIGCDVSLFIDADLAQI--DAAVACGAPTIELHTGAYADAATEQDQQ-AELA 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A    L +NAGH L ++NI   I AI  I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIIKGVEYAASKGLVVNAGHGLNLKNIAP-IAAISQIHELNIGHSIIADSVFVGLVQAVK 231

Query: 241 CFRRACG 247
             + A  
Sbjct: 232 DMKAAIQ 238


>gi|212212140|ref|YP_002303076.1| pyridoxine 5'-phosphate synthase [Coxiella burnetii CbuG_Q212]
 gi|212010550|gb|ACJ17931.1| pyridoxal phosphate biosynthetic protein [Coxiella burnetii
           CbuG_Q212]
          Length = 251

 Score =  258 bits (658), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 82/249 (32%), Positives = 130/249 (52%), Gaps = 9/249 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ +A LR  R + +P+ V    +A+++GA G+T+H R D+RHI+  D+  ++
Sbjct: 12  MVRLGVNIDHIATLRQARGVDYPDPVEAAMMAIEAGADGITLHLREDRRHIQDDDVRNLK 71

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           R +        +N+E    E  +   E  KPE   LVP+   +LT++ G D    Q  L 
Sbjct: 72  RKLT-----VPMNLEMATAEDIIQFAEEIKPEHCCLVPEKREELTTEGGLDVAGQQNTLK 126

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           K  ARL  +G  +SLF D    E  + AAK  GA  IE++TG Y     +  +    L +
Sbjct: 127 KICARLAKVGIEVSLFIDP--EEKQIDAAKAAGAPVIEIHTGHYANAKTDH-EHNQQLKR 183

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + L +NAGH LTI N+ + I AIP I+E+++GH+  +  +  G+ EAV  
Sbjct: 184 IADAAAYADSLGLTVNAGHGLTIHNVQS-IAAIPVINELNIGHSIISRGVLIGLAEAVKE 242

Query: 242 FRRACGQHL 250
            +       
Sbjct: 243 MKTLIAGAQ 251


>gi|148652189|ref|YP_001279282.1| pyridoxine 5'-phosphate synthase [Psychrobacter sp. PRwf-1]
 gi|148571273|gb|ABQ93332.1| pyridoxal phosphate biosynthetic protein PdxJ [Psychrobacter sp.
           PRwf-1]
          Length = 255

 Score =  258 bits (658), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 79/245 (32%), Positives = 126/245 (51%), Gaps = 11/245 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R + +P+ V    +  ++GA G+T+H R D+RHI+  D+  +R L+
Sbjct: 14  LGVNIDHVATLRQARGVAYPDPVEAALLCEKAGADGITLHLREDRRHIQDADVYRMRPLL 73

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   +N+E    +  L++    KP+ + LVP+   +LT++ G D       L   V
Sbjct: 74  T-----TRMNLEMATTQEMLSIALEVKPQWVCLVPEKREELTTEGGLDVAAQVDGLKHYV 128

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ---QERIFLNK 181
           A L   G+++SLF D       + AA   GAD IEL+TG Y       +   Q+ +   +
Sbjct: 129 ASLQQNGTKVSLFIDP--EPIQIDAAIACGADAIELHTGQYSEATLTSEPSTQKELLRIQ 186

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
            A    LA    L +NAGH LT  N+   I AI  I E+++GHA  A ++  G++ AV  
Sbjct: 187 QATAYALAANNKLIVNAGHGLTRDNVGP-IAAIDGIYELNIGHALIADSIFMGLESAVKA 245

Query: 242 FRRAC 246
            ++A 
Sbjct: 246 MKQAI 250


>gi|51597203|ref|YP_071394.1| pyridoxine 5'-phosphate synthase [Yersinia pseudotuberculosis IP
           32953]
 gi|186896300|ref|YP_001873412.1| pyridoxine 5'-phosphate synthase [Yersinia pseudotuberculosis
           PB1/+]
 gi|91207578|sp|Q3V7P0|PDXJ_YERPS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|51590485|emb|CAH22125.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia
           pseudotuberculosis IP 32953]
 gi|186699326|gb|ACC89955.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia
           pseudotuberculosis PB1/+]
          Length = 243

 Score =  258 bits (658), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 77/247 (31%), Positives = 125/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  +++    KP    LVP+   ++T++ G D       +T  V
Sbjct: 63  --QTIQTRMNLEMAVTDEMVDIACDIKPHFCCLVPEKRQEVTTEGGLDVAGQVDKMTLVV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL ++G  +SLF D +  +    AA   GA  IE++TG Y    +   + +  L ++A 
Sbjct: 121 GRLADVGILVSLFIDADFRQI--DAAVAAGAPYIEIHTGAYADA-STVLERQAELMRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV   + 
Sbjct: 178 AATYAAGKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMTGLATAVTDMKV 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|238793770|ref|ZP_04637391.1| Pyridoxine 5'-phosphate synthase [Yersinia intermedia ATCC 29909]
 gi|238726834|gb|EEQ18367.1| Pyridoxine 5'-phosphate synthase [Yersinia intermedia ATCC 29909]
          Length = 243

 Score =  258 bits (658), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 123/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  +++    +P    LVP+   ++T++ G D       +T  V
Sbjct: 63  --QTIQTRMNLEMAVTDEMVDIACELQPHFCCLVPEKRQEVTTEGGLDVAGQLDKMTIAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G  +SLF D +  +    AA   GA  IE++TG Y     +  ++   L ++  
Sbjct: 121 SRLSEAGILVSLFIDPDMRQI--DAAVAVGAPYIEIHTGAYADATTDLVRQ-AELVRITK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV   + 
Sbjct: 178 AATYAAGKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMTGLAAAVTDMKV 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|237748850|ref|ZP_04579330.1| pyridoxine 5-phosphate synthase [Oxalobacter formigenes OXCC13]
 gi|229380212|gb|EEO30303.1| pyridoxine 5-phosphate synthase [Oxalobacter formigenes OXCC13]
          Length = 254

 Score =  258 bits (658), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 77/248 (31%), Positives = 126/248 (50%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ V    +A Q+GA  +T+H R D+RHI+  D+  IR 
Sbjct: 11  IELGVNIDHIATLRNARGTTYPDPVKAAVMAEQAGADAITLHLREDRRHIKDADVRAIRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+        +N+E       ++     KP  + LVP+   +LT++ G D +++  ++  
Sbjct: 71  LLV-----TRMNLESAITPEMIDFACDIKPHDVCLVPERREELTTEGGLDVVRSFDIVAS 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL + G R+SLF D    +    AA  TGA  IEL+TG Y   ++        L ++
Sbjct: 126 AVERLTDAGIRVSLFIDPEEEQII--AAHETGAPVIELHTGRYANAFDESSLR-HELERV 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               +   K  L++NAGH L   N+   I AI  I+E+++GHA  A A+  G ++A+   
Sbjct: 183 KAGVEEGIKNGLKVNAGHGLHYANVLP-IAAIDGIAELNIGHAIVAQAVFDGWEKAIRDM 241

Query: 243 RRACGQHL 250
           +    Q  
Sbjct: 242 KALLVQAR 249


>gi|251788701|ref|YP_003003422.1| pyridoxal phosphate biosynthetic protein PdxJ [Dickeya zeae
           Ech1591]
 gi|247537322|gb|ACT05943.1| pyridoxal phosphate biosynthetic protein PdxJ [Dickeya zeae
           Ech1591]
          Length = 243

 Score =  257 bits (657), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 124/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ +    +A QSGA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPIQAAFVAEQSGADGITVHLREDRRHITDRDVRLLR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  L +    KP    LVP+   ++T++ G D     + +T  V
Sbjct: 63  --QTIQTRMNLEMAVTDEMLAIACELKPHFCCLVPEKRQEVTTEGGLDVAGQLSRITAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G ++SLF D +  +    AA  +GA  IE++TG Y    N+  ++     ++  
Sbjct: 121 TQLREAGIQVSLFIDADRAQI--DAAVASGAPYIEIHTGAYADAENDVARQ-HEFERIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    +++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV   + 
Sbjct: 178 AATYAASCGIKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVMSGLALAVAEMKN 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|153948330|ref|YP_001400120.1| pyridoxine 5'-phosphate synthase [Yersinia pseudotuberculosis IP
           31758]
 gi|152959825|gb|ABS47286.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia
           pseudotuberculosis IP 31758]
          Length = 243

 Score =  257 bits (657), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 77/247 (31%), Positives = 125/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  +++    KP    LVP+   ++T++ G D       +T  V
Sbjct: 63  --QTIQTRMNLEMAVTDEMVDIACDIKPHFCCLVPEKRQEVTTEGGLDVAGQVDKMTLAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL ++G  +SLF D +  +    AA   GA  IE++TG Y    +   + +  L ++A 
Sbjct: 121 GRLADVGILVSLFIDADFRQI--DAAVAAGAPYIEIHTGAYADA-STVLERQAELMRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV   + 
Sbjct: 178 AATYAAGKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMTGLATAVTDMKV 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|308187803|ref|YP_003931934.1| Pyridoxine 5'-phosphate synthase [Pantoea vagans C9-1]
 gi|308058313|gb|ADO10485.1| Pyridoxine 5'-phosphate synthase [Pantoea vagans C9-1]
          Length = 243

 Score =  257 bits (657), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 124/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATVRNARGTNYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRDTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +    +P    LVP+   ++T++ G D    Q  +   V
Sbjct: 66  -----QTRMNLEMAVTDEMIGIACDIQPHFCCLVPEKRQEVTTEGGLDVAGQQEKMNAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G  +SLF D +  +   +AA  TGA  IE++TG Y       +     L ++  
Sbjct: 121 RLLRDAGILVSLFIDADHRQI--EAAVATGAPYIEIHTGAYAEA-PEGRARDAELARIRH 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+ +AV   ++
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVMSGLPDAVKEMKQ 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LLREARR 243


>gi|163733866|ref|ZP_02141308.1| pyridoxal phosphate biosynthetic protein PdxJ [Roseobacter
           litoralis Och 149]
 gi|161392977|gb|EDQ17304.1| pyridoxal phosphate biosynthetic protein PdxJ [Roseobacter
           litoralis Och 149]
          Length = 250

 Score =  257 bits (657), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 67/251 (26%), Positives = 124/251 (49%), Gaps = 10/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R   +P+ +   +IA ++GA G+T H R D+RHI   D+  + 
Sbjct: 7   KLRLGVNIDHVATVRNARGGAYPDPLRAARIAEEAGADGITAHLREDRRHISDADIEGLM 66

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++        LN E    +    +  R+KP  + +VP+   + T++ G +  + + +L 
Sbjct: 67  DVLS-----VPLNFEMAATDEMQQIALRHKPHAVCIVPEKREERTTEGGLEVAREENVLA 121

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQQERIFL 179
             +A L   G R+S+F      +   +AA   GA+ IEL+TG Y   +   + ++    L
Sbjct: 122 HFIAPLREAGCRVSIFIAAEKRQI--EAAHRIGAEVIELHTGAYCDAHAEGDFERRDSEL 179

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            +L   A  A  + L+++AGH LT   +   + A P + E+++GH     ++  G++ A+
Sbjct: 180 ARLRDMAGFAHSLGLEVHAGHGLTYDTVQP-VAAFPEVLELNIGHFLIGESIFLGLEPAI 238

Query: 240 FCFRRACGQHL 250
              RR   +  
Sbjct: 239 AEMRRLMDEAR 249


>gi|153208694|ref|ZP_01946941.1| pyridoxal phosphate biosynthetic protein PdxJ [Coxiella burnetii
           'MSU Goat Q177']
 gi|161830213|ref|YP_001597339.1| pyridoxine 5'-phosphate synthase [Coxiella burnetii RSA 331]
 gi|165919311|ref|ZP_02219397.1| pyridoxal phosphate biosynthetic protein PdxJ [Coxiella burnetii
           RSA 334]
 gi|81628700|sp|Q83BL1|PDXJ_COXBU RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|189036746|sp|A9KFA7|PDXJ_COXBN RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|189036747|sp|A9N936|PDXJ_COXBR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|120575805|gb|EAX32429.1| pyridoxal phosphate biosynthetic protein PdxJ [Coxiella burnetii
           'MSU Goat Q177']
 gi|161762080|gb|ABX77722.1| pyridoxal phosphate biosynthetic protein PdxJ [Coxiella burnetii
           RSA 331]
 gi|165916971|gb|EDR35575.1| pyridoxal phosphate biosynthetic protein PdxJ [Coxiella burnetii
           RSA 334]
          Length = 240

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 82/249 (32%), Positives = 130/249 (52%), Gaps = 9/249 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ +A LR  R + +P+ V    +A+++GA G+T+H R D+RHI+  D+  ++
Sbjct: 1   MVRLGVNIDHIATLRQARGVDYPDPVEAAMMAIEAGADGITLHLREDRRHIQDDDVRNLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           R +        +N+E    E  +   E  KPE   LVP+   +LT++ G D    Q  L 
Sbjct: 61  RKLT-----VPMNLEMATAEDIIQFAEEIKPEHCCLVPEKREELTTEGGLDVAGQQNTLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           K  ARL  +G  +SLF D    E  + AAK  GA  IE++TG Y     +  +    L +
Sbjct: 116 KVCARLAKVGIEVSLFIDP--EEKQIDAAKAAGAPVIEIHTGHYANAKTDH-EHNQQLKR 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A  + L +NAGH LTI N+ + I AIP I+E+++GH+  +  +  G+ EAV  
Sbjct: 173 IADAAAYADSLGLTVNAGHGLTIHNVQS-IAAIPVINELNIGHSIISRGVLIGLAEAVKE 231

Query: 242 FRRACGQHL 250
            +       
Sbjct: 232 MKTLIAGAQ 240


>gi|300771582|ref|ZP_07081457.1| pyridoxine 5'-phosphate synthase [Sphingobacterium spiritivorum
           ATCC 33861]
 gi|300761571|gb|EFK58392.1| pyridoxine 5'-phosphate synthase [Sphingobacterium spiritivorum
           ATCC 33861]
          Length = 238

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 95/247 (38%), Positives = 140/247 (56%), Gaps = 10/247 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P+++       + GA G+TVHPRPD+RHIRYTD+ +++
Sbjct: 1   MTRLSVNINKIATLRNSRGGNNPSVLAAALACERFGAQGITVHPRPDERHIRYTDVYDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNET-FLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
                +    E NIEG   E  F++L    KP Q+TLVPD+  Q+TS+HGWD +++QA L
Sbjct: 61  -----ENITTEFNIEGNCREQKFVDLVLANKPAQVTLVPDEEGQITSNHGWDTIKHQAYL 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            +      + G R+S+F D   +   ++AA  TG D IELYT  Y   + +  +    + 
Sbjct: 116 KEMCTLFKDHGIRVSIFVDP--DPEMVEAAAETGTDRIELYTEAYATAFLD--EREAAIQ 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
                AQ A ++ L INAGHDL + N+      IP + E+S+GHA  A AL  G++E + 
Sbjct: 172 PYFKAAQKANEVGLGINAGHDLDLNNLTYFNQHIPGLLEVSIGHALIADALYLGLEETIK 231

Query: 241 CFRRACG 247
            +  A  
Sbjct: 232 RYLAALK 238


>gi|33240539|ref|NP_875481.1| pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus subsp. marinus str. CCMP1375]
 gi|81664417|sp|Q7VBK3|PDXJ_PROMA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|33238067|gb|AAQ00134.1| Pyridoxal phosphate biosynthesis protein [Prochlorococcus marinus
           subsp. marinus str. CCMP1375]
          Length = 246

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 78/256 (30%), Positives = 130/256 (50%), Gaps = 10/256 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            TS+ VN++ +A +R  R    P+ V +  +A   GA G+T+H R D+RHI+  DL  +R
Sbjct: 1   MTSLGVNIDHIANIRQARLANEPDPVQMALLAELGGADGITIHLREDRRHIQDRDLKLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  K+ LN+E       + +    KP+ ITLVP+   ++T++ G D   N   L 
Sbjct: 61  -----ETIKSRLNLEMAATTEMIEIALDLKPDMITLVPERREEITTEGGLDVASNAKSLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V ++ +     SLF D   N   L+A+   GA  +EL+TGPY     + + + +   K
Sbjct: 116 EIVTKMESCCIPTSLFVDA--NSKQLEASSKIGATWVELHTGPYARA--SWKNQPLEFAK 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           ++     A+ + L++NAGH LT QN+   I +I  + E+++GH   A A+  G+KEAV  
Sbjct: 172 ISEGVARARNLGLRVNAGHGLTYQNVEP-IASITEMEELNIGHTIIARAIAIGLKEAVKE 230

Query: 242 FRRACGQHLDNTMRLT 257
            +             +
Sbjct: 231 MKELIKNPRHEPFFGS 246


>gi|291287213|ref|YP_003504029.1| pyridoxal phosphate biosynthetic protein PdxJ [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290884373|gb|ADD68073.1| pyridoxal phosphate biosynthetic protein PdxJ [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 244

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 70/253 (27%), Positives = 129/253 (50%), Gaps = 10/253 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +R  R    P+ VH   +A   GA  +TVH R D+RHI   DL  +R
Sbjct: 1   MIRLGVNIDHVATVRQARLGVEPDPVHAAVLAELGGADQITVHLREDRRHINDRDLRVLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  K  LN+E       + +    +P+ +TLVP+   +LT++ G D ++N   + 
Sbjct: 61  -----ETIKTRLNLEMACTPEMVEIALETEPDMVTLVPEKRQELTTEGGLDVIKNFETIN 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V+ L + G  +SLF D   +   + A+  T A  +EL+TG Y         +R  L++
Sbjct: 116 DAVSTLKSAGIFVSLFVDP--DNKQIDASAETHASAVELHTGAYADA--KGAAQREELSR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +    + ++++ L +N+GH L  +N+  ++  IP + E+++GH+  + A+  G+++AV  
Sbjct: 172 IMFAGEKSRELGLVLNSGHGLNYRNVGEIVC-IPGMYEVNIGHSIISRAIYVGLEKAVRE 230

Query: 242 FRRACGQHLDNTM 254
            +    + L +  
Sbjct: 231 MKDIIHRALMDAR 243


>gi|169632757|ref|YP_001706493.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii SDF]
 gi|169151549|emb|CAP00316.1| pyridoxal phosphate biosynthetic protein [Acinetobacter baumannii]
          Length = 241

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 73/249 (29%), Positives = 123/249 (49%), Gaps = 9/249 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTAYPDPVEAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R        K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RP-----LLKTRMNLEMAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +    AA   GA  IEL+TG Y       +Q+   L 
Sbjct: 116 KAATQALAAIGCDVSLFIDADFAQI--DAAIACGAPTIELHTGAYTDATTEQEQQ-EELA 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A    L +NAGH L ++NI   I AIP I  +++GH+  A ++  G+ +AV 
Sbjct: 173 RIVKGVEYAASKGLVVNAGHGLNLKNIAP-IAAIPQIHALNIGHSIIAESVFVGLVQAVK 231

Query: 241 CFRRACGQH 249
             + A    
Sbjct: 232 DMKTAIQAA 240


>gi|284039837|ref|YP_003389767.1| pyridoxal phosphate biosynthetic protein PdxJ [Spirosoma linguale
           DSM 74]
 gi|283819130|gb|ADB40968.1| pyridoxal phosphate biosynthetic protein PdxJ [Spirosoma linguale
           DSM 74]
          Length = 245

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 93/247 (37%), Positives = 137/247 (55%), Gaps = 9/247 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A +RN R    P+LV +     + GA G+TVHPRPD+RHIRY D+ ++ 
Sbjct: 1   MTRLSVNINKIATIRNARGGNNPDLVKVALDCERFGAQGITVHPRPDERHIRYQDVLDL- 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    E NIEG P+E F+ L +R KP Q+TLVPD    +TS+ GWD +++   L 
Sbjct: 60  ----HEVVTTEFNIEGNPDERFIELVKRVKPAQVTLVPDAVDAITSNAGWDTIRHADHLR 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           K V      G R+S+F D +     ++ AK  G D IELYT PY A Y         +  
Sbjct: 116 KLVDTFKADGIRVSIFVDADER--MVEGAKAVGTDRIELYTEPYAAHYAE--NREAAVAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               AQ A ++ L +NAGHDL+++N+      +P + E+S+GHA    AL  G++  +  
Sbjct: 172 FVRAAQRANQLGLGLNAGHDLSLENLRFFDEQVPGLEEVSIGHALVCDALYFGLENTIQM 231

Query: 242 FRRACGQ 248
           + R   +
Sbjct: 232 YLRCLDR 238


>gi|194290149|ref|YP_002006056.1| pyridoxine 5'-phosphate synthase [Cupriavidus taiwanensis LMG
           19424]
 gi|238692742|sp|B3R1Z6|PDXJ_CUPTR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|193223984|emb|CAQ69993.1| Pyridoxal phosphate biosynthetic protein [Cupriavidus taiwanensis
           LMG 19424]
          Length = 260

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 76/248 (30%), Positives = 125/248 (50%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ +    +A Q+GA  +T+H R D+RHIR  D+  +R 
Sbjct: 10  IDLGVNIDHVATLRNARGTVYPDPIRAALLAEQAGADLITLHLREDRRHIRDADVRALRP 69

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +        +N+E    +  L++    +P+ + LVP+   ++T++ G D      L+  
Sbjct: 70  QLA-----TRMNLECAITQEMLDIACEIRPQDVCLVPERREEVTTEGGLDVAGRFELVKA 124

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
             A+L   G R+SLF D + ++ +  A    GA  IEL+TG Y    + P ++     ++
Sbjct: 125 ACAQLAGAGIRVSLFIDPDADQIAAAA--ACGAPVIELHTGRYADA-HTPAEQAAEFRRI 181

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A   QK  L +NAGH L   N+   I A+P I E+++GHA  A A+  G + AV   
Sbjct: 182 ADGADAGQKHGLVVNAGHGLHYTNVQP-IAALPGIKELNIGHAIVAHAVFTGWENAVREM 240

Query: 243 RRACGQHL 250
           +       
Sbjct: 241 KAIMVAAR 248


>gi|186475609|ref|YP_001857079.1| pyridoxine 5'-phosphate synthase [Burkholderia phymatum STM815]
 gi|184192068|gb|ACC70033.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           phymatum STM815]
          Length = 254

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 70/252 (27%), Positives = 121/252 (48%), Gaps = 9/252 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ +     A ++GA  +T+H R D+RHI   D+  +R 
Sbjct: 11  IDLGVNIDHVATLRNARGTSYPDPIRAALQAEEAGADAITLHLREDRRHIVDADVRALRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +        +N+E    +  L++    +P  + LVP+   +LT++ G D   +   +  
Sbjct: 71  QLT-----TRMNLECAVTQEMLDIACEVQPHDVCLVPEKRQELTTEGGLDVAGHFEAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L + GSR+SLF D +  +   +AA   GA  IEL+TG Y    ++  +++    ++
Sbjct: 126 ACKQLADAGSRVSLFIDADEAQI--RAAHEAGAPVIELHTGAYAEA-HDASEQQREYERI 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               +    + L++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV   
Sbjct: 183 VRGVEFGASLGLKVNAGHGLHYTNVQQ-IAAIEGIVELNIGHAIVAHAIFAGWDNAVREM 241

Query: 243 RRACGQHLDNTM 254
           +           
Sbjct: 242 KAIMVAARLAAR 253


>gi|254490833|ref|ZP_05104016.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylophaga
           thiooxidans DMS010]
 gi|224464005|gb|EEF80271.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylophaga
           thiooxydans DMS010]
          Length = 243

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 76/251 (30%), Positives = 124/251 (49%), Gaps = 9/251 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MS  + VN++ +A LR  R   +P+ +     A Q+GA  +T+H R D+RHI+  D+  +
Sbjct: 1   MSIFLGVNIDHIATLRQARGTRYPDPIQAAIEAEQAGADSITLHLREDRRHIQERDVAML 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
                    + ++N+E    E  L + E+Y+PE   LVP+   +LT++ G D       +
Sbjct: 61  -----TDILQTKMNLEMAVTEEMLAIAEKYQPEDCCLVPEKREELTTEGGLDVAGQLERM 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            +   RL +   ++SLF D +  +    AA   G   +EL+TG Y     + +  R    
Sbjct: 116 KQACQRLADANIKVSLFIDPDLRQI--DAAIACGVPIVELHTGRYAEAETDAEAARELAI 173

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            ++  A+ A    LQ+NAGH L   N    I AIP + E+++GHA  A +L  G+KEAV 
Sbjct: 174 -ISEAAEQAHARGLQVNAGHGLHYHNTAP-IAAIPQLVELNIGHAIIARSLFTGLKEAVR 231

Query: 241 CFRRACGQHLD 251
             ++       
Sbjct: 232 EMKQLMQDARR 242


>gi|227535781|ref|ZP_03965830.1| pyridoxine 5'-phosphate synthase [Sphingobacterium spiritivorum
           ATCC 33300]
 gi|227244269|gb|EEI94284.1| pyridoxine 5'-phosphate synthase [Sphingobacterium spiritivorum
           ATCC 33300]
          Length = 238

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 95/247 (38%), Positives = 140/247 (56%), Gaps = 10/247 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P+++       + GA G+TVHPRPD+RHIRYTD+ +++
Sbjct: 1   MTRLSVNINKIATLRNSRGGNNPSVLAAALACERFGAQGITVHPRPDERHIRYTDVYDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNET-FLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
                +    E NIEG   E  F++L    KP Q+TLVPD+  Q+TS+HGWD +++QA L
Sbjct: 61  -----ENITTEFNIEGNCREQKFVDLVLANKPAQVTLVPDEEGQITSNHGWDTIKHQAYL 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            +      + G R+S+F D   +   ++AA  TG D IELYT  Y   + +  +    + 
Sbjct: 116 KEMCKLFKDHGIRVSIFVDP--DPEMVEAAAETGTDRIELYTEAYATAFLD--EREAAIQ 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
                AQ A ++ L INAGHDL + N+      IP + E+S+GHA  A AL  G++E + 
Sbjct: 172 PYFKAAQKANEVGLGINAGHDLDLNNLTYFNQHIPGLLEVSIGHALIADALYLGLEETIK 231

Query: 241 CFRRACG 247
            +  A  
Sbjct: 232 RYLAALK 238


>gi|294637608|ref|ZP_06715888.1| pyridoxine 5'-phosphate synthase [Edwardsiella tarda ATCC 23685]
 gi|291089238|gb|EFE21799.1| pyridoxine 5'-phosphate synthase [Edwardsiella tarda ATCC 23685]
          Length = 243

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 75/249 (30%), Positives = 127/249 (51%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ +    +A Q+GA G+TVH R D+RHI   D+  +R 
Sbjct: 4   ILLGVNIDHIATLRNARGTLYPDPLQAAFVAEQAGADGITVHLREDRRHITDRDVRLLR- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               Q  +  +N+E    +  L++    +P    LVP+   ++T++ G D    +  +  
Sbjct: 63  ----QTIQTRMNLEMAVTDEMLDIACELRPHFCCLVPEKRQEVTTEGGLDVAGQRDKMAA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VARL   G ++SLF D +  +   +AA   GA  IE++TG Y    N   Q    L ++
Sbjct: 119 AVARLSAAGIQVSLFIDPDERQI--EAAVAVGAPYIEIHTGAYADAENALVQA-AELARI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A+ A+ A    L++NAGH LT  N    + A+P + E+++GH+    A+  G+  AV   
Sbjct: 176 AVAARFAAGRGLKVNAGHGLTYHN-AQAVAALPEMHELNIGHSIIGRAVIDGLSTAVRDM 234

Query: 243 RRACGQHLD 251
           ++   +   
Sbjct: 235 KQLLLEARR 243


>gi|34497525|ref|NP_901740.1| pyridoxine 5'-phosphate synthase [Chromobacterium violaceum ATCC
           12472]
 gi|81655791|sp|Q7NWC0|PDXJ_CHRVO RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|34103380|gb|AAQ59742.1| pyridoxal phosphate biosynthetic protein pdxJ [Chromobacterium
           violaceum ATCC 12472]
          Length = 242

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 73/251 (29%), Positives = 119/251 (47%), Gaps = 9/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR  R   +P+ V    +A  SGA  +T+H R D+RHI+  D+  +R
Sbjct: 1   MILLGVNIDHVATLRQARGTRYPSPVEAALVAESSGADLITLHLREDRRHIQDADVKAMR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++     K  +N+E       L    +  PE + LVP+   ++T++ G D   + A + 
Sbjct: 61  PVL-----KTRMNLEMAMTPEMLAHALQVAPEDVCLVPEKREEVTTEGGLDVRGHYADVK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G R+S+F D +  +     A   GA  IEL+TG Y    +   +    L +
Sbjct: 116 HYTGKLTEAGIRVSIFIDPDREQIQK--AFDAGARVIELHTGAYADAPH-ASEREAELAR 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A+    + + +NAGH L   N+   I AIP I+E+++GHA  A AL  G  +AV  
Sbjct: 173 IREAAEFGASLGMVVNAGHGLNYHNVKP-IAAIPQIAELNIGHAIVAHALFVGFPQAVRE 231

Query: 242 FRRACGQHLDN 252
            +         
Sbjct: 232 MKALMESARAR 242


>gi|116072442|ref|ZP_01469709.1| pyridoxal phosphate biosynthetic protein [Synechococcus sp. BL107]
 gi|116064964|gb|EAU70723.1| pyridoxal phosphate biosynthetic protein [Synechococcus sp. BL107]
          Length = 249

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 79/256 (30%), Positives = 134/256 (52%), Gaps = 10/256 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MASLGVNIDHIANIREARRTVEPDPVPMAMLAELGGADGITVHLREDRRHIQDRDVELLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  ++ LN+E    +  + +  + KP+ +TLVP+   ++T++ G D +   + LT
Sbjct: 61  -----QTVRSRLNLEMAATDEMVAIALKVKPDMVTLVPEHRQEVTTEGGLDVVAQLSELT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V+RL + G  +SLF D    +  LQ    +GA  +EL+TG Y     N  ++   L +
Sbjct: 116 GMVSRLQSNGIPVSLFVDPAATQ--LQGCIDSGARWVELHTGRYAEASWN--EQPHELAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L      A+ M L++NAGH LT QN+   + AIP + E+++GH   A A+  G+++AV  
Sbjct: 172 LTEGTATARAMGLRVNAGHGLTYQNVEP-VAAIPGMEELNIGHTIVARAVVVGLQQAVRE 230

Query: 242 FRRACGQHLDNTMRLT 257
            +        + +   
Sbjct: 231 MKALVQNPRRDPLFGQ 246


>gi|215261426|pdb|3F4N|A Chain A, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein Pdxj From Yersinia Pestis
 gi|215261427|pdb|3F4N|B Chain B, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein Pdxj From Yersinia Pestis
 gi|215261428|pdb|3F4N|C Chain C, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein Pdxj From Yersinia Pestis
 gi|215261429|pdb|3F4N|D Chain D, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein Pdxj From Yersinia Pestis
 gi|215261430|pdb|3F4N|E Chain E, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein Pdxj From Yersinia Pestis
 gi|215261431|pdb|3F4N|F Chain F, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein Pdxj From Yersinia Pestis
 gi|215261432|pdb|3F4N|G Chain G, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein Pdxj From Yersinia Pestis
 gi|215261433|pdb|3F4N|H Chain H, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein Pdxj From Yersinia Pestis
          Length = 246

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 77/247 (31%), Positives = 125/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 9   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  +++    KP    LVP+   ++T++ G D       +T  V
Sbjct: 66  --QTIQTRMNLEMAVTDEMVDIACDIKPHFCCLVPEKRQEVTTEGGLDVAGQVDKMTLAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL ++G  +SLF D +  +    AA   GA  IE++TG Y    +   + +  L ++A 
Sbjct: 124 GRLADVGILVSLFIDADFRQI--DAAVAAGAPYIEIHTGAYADA-STVLERQAELMRIAK 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV   + 
Sbjct: 181 AATYAAGKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMTGLAAAVTDMKV 239

Query: 245 ACGQHLD 251
              +   
Sbjct: 240 LMREARR 246


>gi|157371901|ref|YP_001479890.1| pyridoxine 5'-phosphate synthase [Serratia proteamaculans 568]
 gi|157323665|gb|ABV42762.1| pyridoxal phosphate biosynthetic protein PdxJ [Serratia
           proteamaculans 568]
          Length = 243

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 78/247 (31%), Positives = 124/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTQYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  L++    KP    LVP+   ++T++ G D    Q  +   V
Sbjct: 63  --QTIQTRMNLEMAVTDEMLDIAIELKPHFCCLVPEKREEVTTEGGLDVAGQQDKMAVAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G  +SLF D +  +    AA   GA  IE++TG Y          +  L ++A+
Sbjct: 121 EQLAKAGILVSLFIDPDHRQI--DAAVAVGAPYIEIHTGAYAEAEGE-LAVKAELRRIAV 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A +  L++NAGH LT  N+   I A+P + E+++GHA    A+ CG+  AV   + 
Sbjct: 178 AATYAAEKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMCGLPAAVTDMKL 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|298372203|ref|ZP_06982193.1| pyridoxine 5'-phosphate synthase [Bacteroidetes oral taxon 274 str.
           F0058]
 gi|298275107|gb|EFI16658.1| pyridoxine 5'-phosphate synthase [Bacteroidetes oral taxon 274 str.
           F0058]
          Length = 238

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 97/245 (39%), Positives = 146/245 (59%), Gaps = 9/245 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              +SVN+N +A LRN R    PN++ +     + GA G+TVHPRPD+RHIRY+D+  ++
Sbjct: 1   MIKLSVNVNKIATLRNSRGGDVPNVLKVALDCEKFGADGITVHPRPDERHIRYSDVYVLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I       E NIEG P   F++L ER KP Q+TLVPD P  LTS+ GWD +++ + L+
Sbjct: 61  SNIT-----TEFNIEGNPVNKFIDLIERIKPTQVTLVPDAPDALTSNAGWDCIEHFSYLS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V     LG R+S+F     +  +++AA  T  D IELYT PY + Y +  +  I    
Sbjct: 116 DLVTHFKELGVRVSIFVG--TDIKNIEAAAKTDTDRIELYTEPYASLYRSNPEAAIKDFV 173

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           LA   ++A+K  L++NAGHDL+++N+      IP +SE+S+GHA  A AL  G+ + +  
Sbjct: 174 LA--TEVARKCGLKVNAGHDLSLENLKYFAGNIPMLSEVSIGHALIADALYLGLAKTIAE 231

Query: 242 FRRAC 246
           +++  
Sbjct: 232 YKKCL 236


>gi|323526856|ref|YP_004229009.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           CCGE1001]
 gi|323383858|gb|ADX55949.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           CCGE1001]
          Length = 254

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 70/252 (27%), Positives = 120/252 (47%), Gaps = 9/252 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ +    +A ++GA  +T+H R D+RHI   D+  +R 
Sbjct: 11  IDLGVNIDHVATLRNARGTSYPDPIRAALMAEEAGADAITLHLREDRRHIVDADVRALRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
                  K  +N+E    +  L++    +P  + LVP+   +LT++ G D       +  
Sbjct: 71  -----LLKTRMNLECAVTQEMLDIACEVQPHDVCLVPEKRQELTTEGGLDVAGQFEAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L +  SR+SLF D +  +   +AA   GA  IEL+TG Y     +P +++    ++
Sbjct: 126 ACRQLADANSRVSLFIDPDETQI--RAAHEAGAPVIELHTGRYAEA-RDPAEQQREYERV 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               +    + +++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV   
Sbjct: 183 VRAVEFGATLGIKVNAGHGLHYTNVQQ-IAAIDGIVELNIGHAIVAHAIFAGWDNAVREM 241

Query: 243 RRACGQHLDNTM 254
           +           
Sbjct: 242 KAIMVAARLGAR 253


>gi|238784190|ref|ZP_04628203.1| Pyridoxine 5'-phosphate synthase [Yersinia bercovieri ATCC 43970]
 gi|238714899|gb|EEQ06898.1| Pyridoxine 5'-phosphate synthase [Yersinia bercovieri ATCC 43970]
          Length = 243

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 76/247 (30%), Positives = 122/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  + +    +P    LVP+   ++T++ G D       +T  V
Sbjct: 63  --QTIQTRMNLEMAVTDEMVGIACELQPHFCCLVPEKRQEVTTEGGLDVAGQIDKMTVAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G  +SLF D +  +    AA   GA  IE++TG Y     +  ++   L ++  
Sbjct: 121 SRLAEAGILVSLFIDADMRQI--DAAVTVGAPYIEIHTGAYADATTDLARQ-AELVRITK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P I E+++GHA    A+  G+  AV   + 
Sbjct: 178 AATYAASKGLKVNAGHGLTYHNVQP-IAALPEIHELNIGHAIIGQAVMTGLAAAVSEMKV 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|22125200|ref|NP_668623.1| pyridoxine 5'-phosphate synthase [Yersinia pestis KIM 10]
 gi|45442307|ref|NP_993846.1| pyridoxine 5'-phosphate synthase [Yersinia pestis biovar Microtus
           str. 91001]
 gi|108808363|ref|YP_652279.1| pyridoxine 5'-phosphate synthase [Yersinia pestis Antiqua]
 gi|108811372|ref|YP_647139.1| pyridoxine 5'-phosphate synthase [Yersinia pestis Nepal516]
 gi|145598834|ref|YP_001162910.1| pyridoxine 5'-phosphate synthase [Yersinia pestis Pestoides F]
 gi|149365385|ref|ZP_01887420.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           CA88-4125]
 gi|162421936|ref|YP_001607938.1| pyridoxine 5'-phosphate synthase [Yersinia pestis Angola]
 gi|165928251|ref|ZP_02224083.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165939268|ref|ZP_02227818.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166008092|ref|ZP_02228990.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166212341|ref|ZP_02238376.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167398788|ref|ZP_02304312.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167421352|ref|ZP_02313105.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167423609|ref|ZP_02315362.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|167467709|ref|ZP_02332413.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           FV-1]
 gi|170023438|ref|YP_001719943.1| pyridoxine 5'-phosphate synthase [Yersinia pseudotuberculosis
           YPIII]
 gi|218929985|ref|YP_002347860.1| pyridoxine 5'-phosphate synthase [Yersinia pestis CO92]
 gi|229838514|ref|ZP_04458673.1| pyridoxine 5'-phosphate synthase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229895520|ref|ZP_04510691.1| pyridoxine 5'-phosphate synthase [Yersinia pestis Pestoides A]
 gi|229899083|ref|ZP_04514227.1| pyridoxine 5'-phosphate synthase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229901622|ref|ZP_04516744.1| pyridoxine 5'-phosphate synthase [Yersinia pestis Nepal516]
 gi|270489811|ref|ZP_06206885.1| pyridoxine 5'-phosphate synthase [Yersinia pestis KIM D27]
 gi|294504514|ref|YP_003568576.1| pyridoxal phosphate biosynthetic protein [Yersinia pestis Z176003]
 gi|20139009|sp|Q8ZCP4|PDXJ_YERPE RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|21958065|gb|AAM84874.1|AE013732_6 pyridoxine biosynthesis [Yersinia pestis KIM 10]
 gi|45437171|gb|AAS62723.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Microtus str. 91001]
 gi|108775020|gb|ABG17539.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           Nepal516]
 gi|108780276|gb|ABG14334.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           Antiqua]
 gi|115348596|emb|CAL21538.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           CO92]
 gi|145210530|gb|ABP39937.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           Pestoides F]
 gi|149291798|gb|EDM41872.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           CA88-4125]
 gi|162354751|gb|ABX88699.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           Angola]
 gi|165912868|gb|EDR31495.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165919758|gb|EDR37091.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165992474|gb|EDR44775.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166206272|gb|EDR50752.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166960841|gb|EDR56862.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167051292|gb|EDR62700.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167057779|gb|EDR67525.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|169749972|gb|ACA67490.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia
           pseudotuberculosis YPIII]
 gi|229681551|gb|EEO77645.1| pyridoxine 5'-phosphate synthase [Yersinia pestis Nepal516]
 gi|229688028|gb|EEO80100.1| pyridoxine 5'-phosphate synthase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229694880|gb|EEO84927.1| pyridoxine 5'-phosphate synthase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229701326|gb|EEO89354.1| pyridoxine 5'-phosphate synthase [Yersinia pestis Pestoides A]
 gi|262362494|gb|ACY59215.1| pyridoxal phosphate biosynthetic protein [Yersinia pestis D106004]
 gi|262366501|gb|ACY63058.1| pyridoxal phosphate biosynthetic protein [Yersinia pestis D182038]
 gi|270338315|gb|EFA49092.1| pyridoxine 5'-phosphate synthase [Yersinia pestis KIM D27]
 gi|294354973|gb|ADE65314.1| pyridoxal phosphate biosynthetic protein [Yersinia pestis Z176003]
 gi|320016072|gb|ADV99643.1| pyridoxine 5'-phosphate synthase [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 243

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 77/247 (31%), Positives = 125/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  +++    KP    LVP+   ++T++ G D       +T  V
Sbjct: 63  --QTIQTRMNLEMAVTDEMVDIACDIKPHFCCLVPEKRQEVTTEGGLDVAGQVDKMTLAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL ++G  +SLF D +  +    AA   GA  IE++TG Y    +   + +  L ++A 
Sbjct: 121 GRLADVGILVSLFIDADFRQI--DAAVAAGAPYIEIHTGAYADA-STVLERQAELMRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV   + 
Sbjct: 178 AATYAAGKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMTGLAAAVTDMKV 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|258543241|ref|YP_003188674.1| pyridoxine 5'-phosphate synthase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634319|dbj|BAI00295.1| pyridoxal phosphate biosynthetic protein PdxJ [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256637377|dbj|BAI03346.1| pyridoxal phosphate biosynthetic protein PdxJ [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256640429|dbj|BAI06391.1| pyridoxal phosphate biosynthetic protein PdxJ [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643486|dbj|BAI09441.1| pyridoxal phosphate biosynthetic protein PdxJ [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646541|dbj|BAI12489.1| pyridoxal phosphate biosynthetic protein PdxJ [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649594|dbj|BAI15535.1| pyridoxal phosphate biosynthetic protein PdxJ [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652582|dbj|BAI18516.1| pyridoxal phosphate biosynthetic protein PdxJ [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655638|dbj|BAI21565.1| pyridoxal phosphate biosynthetic protein PdxJ [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 240

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 78/247 (31%), Positives = 123/247 (49%), Gaps = 14/247 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA +RN R   +P+ V    +A+Q+GA G+T H R D+RHIR  DL  +R 
Sbjct: 5   IRLGVNIDHVATIRNARGGTYPDPVAAALLAIQAGADGITAHLREDRRHIRDKDLQRLRA 64

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            I      A LN+E    E  + +    +P    LVP+   +LT++ G +       LT 
Sbjct: 65  EIA-----APLNMEMAATEEMVGIALGLRPHACCLVPERREELTTEGGLNVAGQLETLTP 119

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V +L   G R+SLF D +  +   +AA  TGA  +EL+TG Y             L +L
Sbjct: 120 KVQKLAQAGIRVSLFIDPSSAQI--EAAAKTGAQVVELHTGAYAEGKAE------ELERL 171

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A  A  + L+++AGH LT +N+   I ++P + E+++GH     A+  G+   V   
Sbjct: 172 RAAATQAAALGLEVHAGHGLTFENVGP-IASLPELRELNIGHFLIGQAIFDGLAAVVQNM 230

Query: 243 RRACGQH 249
           +R   + 
Sbjct: 231 KRHIAEG 237


>gi|187924872|ref|YP_001896514.1| pyridoxine 5'-phosphate synthase [Burkholderia phytofirmans PsJN]
 gi|187716066|gb|ACD17290.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           phytofirmans PsJN]
          Length = 254

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 69/252 (27%), Positives = 123/252 (48%), Gaps = 9/252 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ +    +A ++GA  +T+H R D+RHI   D+ ++R 
Sbjct: 11  IDLGVNIDHVATLRNARGTSYPDPIRAALMAEEAGADVITLHLREDRRHIVDADVRKLRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
                  +  +N+E    +  L++    +P  + LVP+   +LT++ G D       +  
Sbjct: 71  -----LLQTRMNLECAVTQEMLDIASEVQPHDVCLVPEKRQELTTEGGLDVAGQFEAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L +  SR+SLF D +  +   +AA   GA  IEL+TG Y    ++P +++    ++
Sbjct: 126 ACKQLADANSRVSLFIDPDETQI--RAAHEAGAPVIELHTGRYAEA-HDPAEQQREFERV 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               +  + + +++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV   
Sbjct: 183 VRAVEFGRTLGIKVNAGHGLHYTNVQQ-IAAIEGIDELNIGHAIVAHAIFAGWDNAVREM 241

Query: 243 RRACGQHLDNTM 254
           +           
Sbjct: 242 KAIMVAARLGAR 253


>gi|332140214|ref|YP_004425952.1| pyridoxine 5'-phosphate synthase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327550236|gb|AEA96954.1| pyridoxine 5'-phosphate synthase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 245

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 80/248 (32%), Positives = 122/248 (49%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ VH   IA ++GA G+TVH R D+RHI+  D+  +  
Sbjct: 4   ILLGVNIDHIATLRNARGTHYPDPVHAADIAERAGADGITVHLREDRRHIKDRDVRIL-- 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               Q     LN+E    +  L + E  KP    LVP+   +LT++ G D   N   +  
Sbjct: 62  ---AQTINTRLNLEMAVTDEMLAIAEEVKPVFCCLVPEKREELTTEGGLDVAGNVDNIKA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              RL N    +SLF D +  +    AA    A  IE++TG Y    +   Q+   L +L
Sbjct: 119 ACDRLANANILVSLFIDADKAQI--DAAAACNAPYIEIHTGQYAEATSEEAQQ-EELARL 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               + A  + L++NAGH L   N+   I AIP + E+++GHA  A A   G+ +AV   
Sbjct: 176 VEGIEYADSLGLKVNAGHGLHYHNVKP-IAAIPQLIELNIGHAIIARAAFDGLHKAVADM 234

Query: 243 RRACGQHL 250
           R+   +  
Sbjct: 235 RKLMLEAR 242


>gi|254476778|ref|ZP_05090164.1| pyridoxal phosphate biosynthetic protein PdxJ [Ruegeria sp. R11]
 gi|214031021|gb|EEB71856.1| pyridoxal phosphate biosynthetic protein PdxJ [Ruegeria sp. R11]
          Length = 253

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 71/249 (28%), Positives = 121/249 (48%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R    P+ V   K+A ++GA G+T H R D+RHI  TD+  +   
Sbjct: 12  RLGVNIDHVATVRNARGGQTPDPVRAAKLAEEAGADGITAHLREDRRHITDTDIDALM-- 69

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +     LN E    E    +  R+KP  + +VP+   + T++ G +  +++  L   
Sbjct: 70  ---EALNVPLNFEMAATEEMQKIALRHKPHAVCIVPEKREERTTEGGLEVARDENKLAHF 126

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ--QERIFLNK 181
           +A L + G R+S+F   +  +   +AA   GA+ IEL+TG Y   +      +    L  
Sbjct: 127 IAPLRDAGCRVSIFIAADQRQI--EAAHRIGAEVIELHTGAYCDAHAEGDLAKRDAELAA 184

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   +  A  + L+++AGH LT + +   I A P + E+++GH     A+  G+  A+  
Sbjct: 185 LREMSSFAHSLGLEVHAGHGLTYETVQP-IAAFPEVRELNIGHFLIGEAIFRGLTPAIAE 243

Query: 242 FRRACGQHL 250
            RR      
Sbjct: 244 MRRLMDDAR 252


>gi|86140711|ref|ZP_01059270.1| pyridoxal phosphate biosynthetic protein [Leeuwenhoekiella
           blandensis MED217]
 gi|85832653|gb|EAQ51102.1| pyridoxal phosphate biosynthetic protein [Leeuwenhoekiella
           blandensis MED217]
          Length = 251

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 96/245 (39%), Positives = 142/245 (57%), Gaps = 9/245 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P+L+   K     GA G+T+HPRPD+RHIRY D  +++
Sbjct: 15  MTKLSVNVNKIATLRNARGGNVPDLIKTVKDIESFGAQGITIHPRPDERHIRYQDARDLK 74

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++     K ELNIEG P E F+NL    +P+Q+TLVPD    +TS+ GWD ++N+  L 
Sbjct: 75  GVV-----KTELNIEGNPVEKFINLVLEVQPDQVTLVPDSVDAITSNAGWDTIKNRLFLK 129

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +A   + G R S+F D       ++ AK TG D IELYT  +   +         +  
Sbjct: 130 EVIAEFKSHGIRTSIFVDPV--AEMIEGAKETGTDRIELYTEAFAEGFKEGH--PNAVKP 185

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A LAQ +DL +NAGHDL+++NI    ++IP + E+S+GHA  A AL  G+++ +  
Sbjct: 186 YVDAALLAQDLDLGLNAGHDLSLENIKFFADSIPGLLEVSIGHALIAEALYDGLEKTIQS 245

Query: 242 FRRAC 246
           +  A 
Sbjct: 246 YLEAL 250


>gi|170695425|ref|ZP_02886570.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           graminis C4D1M]
 gi|170139616|gb|EDT07799.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           graminis C4D1M]
          Length = 254

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 70/252 (27%), Positives = 121/252 (48%), Gaps = 9/252 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ +    +A ++GA  +T+H R D+RHI   D+  +R 
Sbjct: 11  IDLGVNIDHVATLRNARGTSYPDPIRAALMAEEAGADAITLHLREDRRHIVDADVRALRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
                  K  +N+E    +  L++    +P  + LVP+   +LT++ G D       +  
Sbjct: 71  -----LLKTRMNLECAVTQEMLDIACDVQPHDVCLVPEKRQELTTEGGLDVAGQFEAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L +  SR+SLF D +  +   +AA   GA  IEL+TG Y    ++P +++    ++
Sbjct: 126 ACRQLADANSRVSLFIDPDETQI--RAAHEAGAPVIELHTGRYAEA-HDPAEQQREYERV 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               +    + +++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV   
Sbjct: 183 VRAVEFGATLGIKVNAGHGLHYTNVQQ-IAAIDGIVELNIGHAIVAHAIFAGWDNAVREM 241

Query: 243 RRACGQHLDNTM 254
           +           
Sbjct: 242 KAIMVAARLGAR 253


>gi|312132170|ref|YP_003999510.1| pyridoxine 5'-phosphate synthase [Leadbetterella byssophila DSM
           17132]
 gi|311908716|gb|ADQ19157.1| pyridoxine 5'-phosphate synthase [Leadbetterella byssophila DSM
           17132]
          Length = 238

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 94/247 (38%), Positives = 143/247 (57%), Gaps = 10/247 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PN++ +     + GA G+TVHPRPD+RHIRY D+ +++
Sbjct: 1   MTKLSVNINKIATLRNSRGGDVPNVLQVALDCEKFGAQGITVHPRPDERHIRYQDVFDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNE-TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
             I       E NIEG P E  F  +  +  P Q+TLVPD  + +TS+ GWD +++QA L
Sbjct: 61  EKIC-----TEFNIEGNPTEGRFEEVVLKTVPAQVTLVPDALNAITSNAGWDTVRHQAQL 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            + V +  N G R+S+F D   +   ++AA  TG D IELYT  Y   Y + +++ I   
Sbjct: 116 KELVKKYKNAGIRVSIFVDA--DPIMVEAAAETGTDRIELYTESYAKGYPSDREKAIA-- 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
              + A+ A ++ L +NAGHDL+++N+      IP + E+S+GHA  A AL  G++  + 
Sbjct: 172 PFVVAAEKALEVGLGLNAGHDLSLENLAYFKQNIPGLLEVSIGHALIADALYYGLENTIQ 231

Query: 241 CFRRACG 247
            + R   
Sbjct: 232 MYLRQLQ 238


>gi|296158231|ref|ZP_06841063.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           Ch1-1]
 gi|295891567|gb|EFG71353.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           Ch1-1]
          Length = 254

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 71/252 (28%), Positives = 121/252 (48%), Gaps = 9/252 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ +    +A ++GA  +T+H R D+RHI   D+ ++R 
Sbjct: 11  IDLGVNIDHVATLRNARGTSYPDPIRAALMAEEAGADVITLHLREDRRHIVDADVRKLRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
                  K  +N+E    +  L++    +P  + LVP+   +LT++ G D       +  
Sbjct: 71  -----LLKTRMNLECAVTQEMLDIACEVQPHDVCLVPEKRQELTTEGGLDVAGQFEAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L    SR+SLF D +  +   +AA    A  IEL+TG Y    ++P Q++    ++
Sbjct: 126 ACRQLAEANSRVSLFIDPDEAQI--RAAHEAAAPVIELHTGRYAEA-HDPAQQQREFERV 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               +   K+ +++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV   
Sbjct: 183 VRAVEFGAKLGIKVNAGHGLHYTNVQQ-IAAIEGIDELNIGHAIVAHAIFAGWDNAVREM 241

Query: 243 RRACGQHLDNTM 254
           +           
Sbjct: 242 KAIMVAARLGAR 253


>gi|167752330|ref|ZP_02424457.1| hypothetical protein ALIPUT_00574 [Alistipes putredinis DSM 17216]
 gi|167660571|gb|EDS04701.1| hypothetical protein ALIPUT_00574 [Alistipes putredinis DSM 17216]
          Length = 238

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 88/243 (36%), Positives = 136/243 (55%), Gaps = 9/243 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +AV+RN R    P++V       + GA G+TVHPRPD RHIRY+D+ +++
Sbjct: 1   MTKLSVNINKIAVVRNSRGGNLPDVVRAALDCERFGAQGITVHPRPDARHIRYSDVRDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           +++       E NIEG P  +F  L    +P Q+TLVPD  + +TS+ GW+ ++ +  L 
Sbjct: 61  KVLT-----TEFNIEGNPIPSFRELVLEVRPAQVTLVPDAENAITSNAGWNTVKYRDFLR 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           +  A     G R+S+F D       +  AK  GAD +ELYT  Y   +   ++  I    
Sbjct: 116 EVTAEFQAGGIRVSIFVDPV--AEMVAGAKECGADRVELYTEAYARDFAAGRERAIE--P 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+ A++  L +NAGHDL ++N+   +  IP+  E+S+GHA    AL  G++  V  
Sbjct: 172 YVRAAEEARRCGLGLNAGHDLNLENLRYFVERIPWTDEVSIGHALICDALYYGLENTVRL 231

Query: 242 FRR 244
           +RR
Sbjct: 232 YRR 234


>gi|153005194|ref|YP_001379519.1| pyridoxine 5'-phosphate synthase [Anaeromyxobacter sp. Fw109-5]
 gi|152028767|gb|ABS26535.1| pyridoxal phosphate biosynthetic protein PdxJ [Anaeromyxobacter sp.
           Fw109-5]
          Length = 242

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 74/251 (29%), Positives = 127/251 (50%), Gaps = 9/251 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   + VN++ VA LR  R   +P+ V    +A  +GA  +T+H R D+RHI+  DL  +
Sbjct: 1   MPARLGVNVDHVATLRQSRRTTYPDPVAAVVLAELAGADQITIHLREDRRHIQERDLQIL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           RR +       +LN+E    +  + +    KP+ +TLVP+   +LT++ G D    +  +
Sbjct: 61  RRTVA-----TKLNLEMAATQEMVKIAYEVKPDVVTLVPERREELTTEGGLDVFGGRENV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            K V  L +   ++SLF D + ++  ++AA    A  +E +TG Y        +    L+
Sbjct: 116 RKVVKTLRDADIKVSLFIDPDLDQ--VKAAHRAEAATVEFHTGRYCDARLASDRR-KELS 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +L    + A K+ L++ AGH L  QN+   + AIP I E+++GH+    A+  G++ AV 
Sbjct: 173 RLVDACKAAAKLGLEVAAGHGLNYQNVVP-VAAIPEIEELNIGHSIVGRAVLVGMERAVR 231

Query: 241 CFRRACGQHLD 251
             R    +   
Sbjct: 232 EMRELIAKARP 242


>gi|311693678|gb|ADP96551.1| pyridoxal phosphate biosynthetic protein PdxJ [marine bacterium
           HP15]
          Length = 246

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 78/248 (31%), Positives = 128/248 (51%), Gaps = 9/248 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V    +A ++GA G+T+HPR D+RHI+  D+  ++   
Sbjct: 7   LGVNIDHVATLRQARGTRYPDPVQAALMAEEAGADGITIHPREDRRHIQDRDVLLLK--- 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  + ++N+E    +  L   E+ +PE + LVP+   +LT++ G D    ++ + K  
Sbjct: 64  --EVLQTKMNLEMAVTDAMLAFAEQVRPECVCLVPEKREELTTEGGLDVEGQESRVAKAC 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G+ +SLF D +  +    AA   GA  +EL+TG Y        +   F   +A 
Sbjct: 122 ERLARIGAEVSLFIDPDPVQI--DAAVRCGAPVVELHTGEYAEAETPDAENAAFKT-IAD 178

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
               A+K  L +NAGH L   N    + AI  I+E+++GHA  A A+  G+KEAV   + 
Sbjct: 179 AVAYARKKGLIVNAGHGLHYHN-TERVAAIHGINELNIGHAIIARAVFTGLKEAVRDMKA 237

Query: 245 ACGQHLDN 252
              Q    
Sbjct: 238 IIDQARSR 245


>gi|239996015|ref|ZP_04716539.1| pyridoxine 5'-phosphate synthase [Alteromonas macleodii ATCC 27126]
          Length = 245

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 80/248 (32%), Positives = 122/248 (49%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ VH   IA ++GA G+TVH R D+RHI+  D+  +  
Sbjct: 4   ILLGVNIDHIATLRNARGTHYPDPVHAADIAERAGADGITVHLREDRRHIKDRDVRIL-- 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               Q     LN+E    E  L + E  KP    LVP+   +LT++ G D   N   +  
Sbjct: 62  ---AQTINTRLNLEMAVTEEMLAIAEEVKPVFCCLVPEKREELTTEGGLDVAGNFENIKA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              RL N    +SLF D +  +    AA    A  IE++TG Y    +  +++   L +L
Sbjct: 119 ACERLANANILVSLFIDADKAQI--DAAAACNAPYIEIHTGQYAEATSE-EEQHKELARL 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               + A  + L++NAGH L   N+   I AIP + E+++GHA  A A   G+  AV   
Sbjct: 176 VEGIEYADSLGLKVNAGHGLHYHNVKP-IAAIPQLIELNIGHAIIARAAFDGLHTAVADM 234

Query: 243 RRACGQHL 250
           R+   +  
Sbjct: 235 RKLMLEAR 242


>gi|304310582|ref|YP_003810180.1| Pyridoxal phosphate biosynthetic protein [gamma proteobacterium
           HdN1]
 gi|301796315|emb|CBL44523.1| Pyridoxal phosphate biosynthetic protein [gamma proteobacterium
           HdN1]
          Length = 246

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 78/248 (31%), Positives = 126/248 (50%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNVDHVATLRQARGTRFPDPVQAALDAEEAGADGITVHLREDRRHIQDRDVLILKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N+E    +  L + ER KP    LVP+   + T++ G D +  +  +  
Sbjct: 67  VL-----QTRMNLEMAVTDEMLAIAERVKPPHCCLVPERREERTTEGGLDVVSQRERVRH 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              RL   G   SLF   +  +   QAA   GA  IEL+TG Y     + ++ +    ++
Sbjct: 122 ACERLRAAGIEASLFIAPDKAQI--QAAFDVGAPVIELHTGHYADA-LSAEETKTAYGQI 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               Q A+ + L +NAGH L  QN+   I AI  I+E+++GH+  A A+  G+KEAV   
Sbjct: 179 VEAVQYARSLGLIVNAGHGLHYQNVEP-IAAIKGINELNIGHSIVARAVFTGLKEAVREM 237

Query: 243 RRACGQHL 250
           +R   Q  
Sbjct: 238 KRIMVQAR 245


>gi|85705107|ref|ZP_01036207.1| pyridoxal phosphate biosynthetic protein [Roseovarius sp. 217]
 gi|85670429|gb|EAQ25290.1| pyridoxal phosphate biosynthetic protein [Roseovarius sp. 217]
          Length = 250

 Score =  256 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 68/252 (26%), Positives = 120/252 (47%), Gaps = 10/252 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R   +P+ +   K+A ++GA G+T H R D+RHI   D+  + 
Sbjct: 6   KLRLGVNIDHVATVRNARGGAYPDPLRAAKLAEEAGADGITAHLREDRRHISDADIDGLM 65

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +     LN E    E    +  R+KP  + +VP+   + T++ G +  + +  L 
Sbjct: 66  -----EVLTVPLNFEMAATEEMQRIALRHKPHAVCIVPEKREERTTEGGLEVAREENRLA 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFL 179
             +A L   G R+S+F   +  +    AA   GA+ IEL+TG Y   +     +     L
Sbjct: 121 HYLAPLRAAGCRVSIFIAADKRQI--DAAHRIGAEVIELHTGAYCDAHAEGHFEARDREL 178

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             L   +  A  + L+++AGH L  + +   + A P + E+++GH     A+  G++ A+
Sbjct: 179 EGLREMSAYAHSLGLEVHAGHGLNYETVKP-VAAFPEVMELNIGHFLIGEAIFRGLQSAI 237

Query: 240 FCFRRACGQHLD 251
              RR   +  D
Sbjct: 238 SEMRRLMDEARD 249


>gi|87302324|ref|ZP_01085149.1| pyridoxal phosphate biosynthetic protein [Synechococcus sp. WH
           5701]
 gi|87283249|gb|EAQ75205.1| pyridoxal phosphate biosynthetic protein [Synechococcus sp. WH
           5701]
          Length = 249

 Score =  256 bits (654), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 78/253 (30%), Positives = 130/253 (51%), Gaps = 10/253 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MASLGVNIDHIANVRQARRALEPDPVTLALLAELGGADGITVHLREDRRHIQERDVELLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   ++ LN+E         +  R +P+ +TLVP+   ++T++ G D +     L 
Sbjct: 61  -----ATVRSRLNLEMAATPEMEAIALRIRPDMVTLVPEHRQEVTTEGGLDVVSQLGTLQ 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V RL   G  +SLF D    +  L+A++ +GA  +EL+TG Y     +  ++   L +
Sbjct: 116 ALVGRLQGSGIPVSLFVDPEVTQ--LEASRASGARWVELHTGAYAEA--DWAEQPRELAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   + +A+ + L++NAGH LT QN+   I AI  I E+++GH   A AL  G++ AV  
Sbjct: 172 LEEGSFVARSLGLRVNAGHGLTYQNVEP-IAAIEGIEELNIGHTIVARALAVGLQSAVRE 230

Query: 242 FRRACGQHLDNTM 254
            R        + +
Sbjct: 231 MRSLIQNPRRDPL 243


>gi|197335650|ref|YP_002156883.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio fischeri
           MJ11]
 gi|197317140|gb|ACH66587.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio fischeri
           MJ11]
          Length = 243

 Score =  256 bits (654), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 79/250 (31%), Positives = 128/250 (51%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA+G+T+H R D+RHI+  D+  +R
Sbjct: 3   SILLGVNIDHVATLRNARGTKYPDPVHAAEIAERAGAAGITIHLREDRRHIKDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +    KPE + LVP+   +LT++ G +       + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMVGIALETKPEFVCLVPEKREELTTEGGLNVSGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D   ++  + AA   GA  IEL+TG Y        Q+   L K
Sbjct: 118 AATQKLTEAGIKVSLFIDA--DKKQIDAAVECGAPFIELHTGAYADAETEEAQQ-DELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A    L +NAGH LT  N+   I A+P I E+++GH+    A+  G+++AV  
Sbjct: 175 IAAGASYAASKGLIVNAGHGLTYHNV-EAIAALPEIYELNIGHSIMGRAMFDGLEKAVSD 233

Query: 242 FRRACGQHLD 251
             R       
Sbjct: 234 MHRIMLGARK 243


>gi|238788221|ref|ZP_04632016.1| Pyridoxal phosphate biosynthetic protein [Yersinia frederiksenii
           ATCC 33641]
 gi|238723808|gb|EEQ15453.1| Pyridoxal phosphate biosynthetic protein [Yersinia frederiksenii
           ATCC 33641]
          Length = 243

 Score =  256 bits (654), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 76/247 (30%), Positives = 125/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  +++    +P    LVP+   ++T++ G D       +T  V
Sbjct: 63  --QTIQTRMNLEMAVTDEMVDIACELQPHFCCLVPEKRQEVTTEGGLDVAGQIDKMTIAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G  +SLF D +  +    AA   GA  IE++TG Y    ++  ++   L ++A 
Sbjct: 121 SRLSEAGILVSLFIDADMRQI--DAAVTVGAPYIEIHTGAYADATSDLARQ-AELVRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV   + 
Sbjct: 178 AATYAAGKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMSGLATAVTEMKV 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|188533141|ref|YP_001906938.1| pyridoxine 5'-phosphate synthase [Erwinia tasmaniensis Et1/99]
 gi|188028183|emb|CAO96041.1| Pyridoxal phosphate biosynthetic protein (PNP synthase) [Erwinia
           tasmaniensis Et1/99]
          Length = 243

 Score =  256 bits (654), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 74/246 (30%), Positives = 122/246 (49%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R   +P+ V    ++ Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHVATVRNARGTNYPDPVQAAFVSEQAGADGITVHLREDRRHINDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  +++    +P    LVP+   ++T++ G D       +T  V
Sbjct: 63  --QTIQTRMNLEMAVTDEMVDIACEIQPHFCCLVPEKREEVTTEGGLDVAGQLDKVTAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL++ G  +SLF D +  +    AA   GA  IE++TG Y             L ++A 
Sbjct: 121 KRLNDAGVLVSLFIDADRGQI--DAAVAAGAPYIEIHTGAYAEA-PEGLARDTELARIAA 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV   ++
Sbjct: 178 AATYAAGKGLKVNAGHGLTYHNVLP-IAALPEMVELNIGHAIIGRAVFSGLAAAVQEMKQ 236

Query: 245 ACGQHL 250
                 
Sbjct: 237 LLRAAR 242


>gi|329114064|ref|ZP_08242828.1| Pyridoxine 5'-phosphate synthase [Acetobacter pomorum DM001]
 gi|326696603|gb|EGE48280.1| Pyridoxine 5'-phosphate synthase [Acetobacter pomorum DM001]
          Length = 240

 Score =  256 bits (654), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 78/247 (31%), Positives = 124/247 (50%), Gaps = 14/247 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA +RN R   +P+ V    +A+Q+GA G+T H R D+RHIR  DL  +R 
Sbjct: 5   IRLGVNIDHVATIRNARGGTYPDPVAAALLAIQAGADGITAHLREDRRHIRDKDLERLRA 64

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            I      A LN+E    E  + +    +P    LVP+   +LT++ G +       LT 
Sbjct: 65  EIA-----APLNMEMAATEEMVGIALGLRPHACCLVPERREELTTEGGLNIAGQLETLTP 119

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V +L   G R+SLF D +  +   +AA  TGA  +EL+TG Y         +   L +L
Sbjct: 120 KVQKLAQAGIRVSLFIDPSPAQI--EAAAKTGAQVVELHTGAYAEG------KAGELERL 171

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A  A  + L+++AGH LT +N+   I ++P + E+++GH     A+  G+   V   
Sbjct: 172 RAAAMQAASLGLEVHAGHGLTFENVGP-IASLPELRELNIGHFLIGQAIFDGLAAVVQSM 230

Query: 243 RRACGQH 249
           +R   + 
Sbjct: 231 KRHIAEG 237


>gi|33865444|ref|NP_897003.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. WH 8102]
 gi|81574817|sp|Q7U7S1|PDXJ_SYNPX RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|33632613|emb|CAE07425.1| Pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp. WH
           8102]
          Length = 249

 Score =  256 bits (654), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 77/255 (30%), Positives = 131/255 (51%), Gaps = 10/255 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MASLGVNIDHIANIRQARRTVEPDPVPFAMLAELGGADGITVHLREDRRHIQDRDVQLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  ++ LN+E    +  + +    +P+ +TLVP+   ++T++ G D     + LT
Sbjct: 61  -----QTVRSRLNLEMAATQEMVEIALAVEPDMVTLVPEKREEVTTEGGLDVAAQLSGLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V RL   G  +SLF D    +  L+A + +GA  +EL+TG Y     +   +   L +
Sbjct: 116 PMVERLQQRGIPVSLFVDAETTQ--LEACRNSGAHWVELHTGTYADA--SWADQPGQLAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A  A+ + L++NAGH LT QN+   I AIP + E+++GH   A A+  G+++AV  
Sbjct: 172 ITEGAATARHLGLRVNAGHGLTYQNVEP-IAAIPGMEELNIGHTIVARAVAVGLQQAVRE 230

Query: 242 FRRACGQHLDNTMRL 256
            +        + +  
Sbjct: 231 MKALIQNPRLDPLFG 245


>gi|255038473|ref|YP_003089094.1| pyridoxine 5'-phosphate synthase [Dyadobacter fermentans DSM 18053]
 gi|254951229|gb|ACT95929.1| pyridoxal phosphate biosynthetic protein PdxJ [Dyadobacter
           fermentans DSM 18053]
          Length = 239

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 93/244 (38%), Positives = 146/244 (59%), Gaps = 10/244 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PN++ +     + GA G+TVHPRPD+RHIRY D+ ++R
Sbjct: 1   MTRLSVNINKIATLRNSRGGDNPNVLKVALDCERFGAQGITVHPRPDERHIRYQDVYDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNE-TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
                +    E NIEG P+E  F+ L    KP+Q+TLVPD    +TS+ GWD + ++++L
Sbjct: 61  -----ELVTTEFNIEGNPSEKKFVELVLANKPDQVTLVPDALGAITSNAGWDTITHRSVL 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  V    + G R+S+F D + +   ++ AK+ GAD +ELYT P+ A Y      +  + 
Sbjct: 116 TDLVGTFKSAGIRVSVFVDPDED--MVEGAKICGADRVELYTEPFAAGYFE--NRQKAVL 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
                A+ A+++ L +NAGHDL++ N+  L  +IP++ E+S+GHA    AL  G++  + 
Sbjct: 172 PFVKAAEKAREVGLGLNAGHDLSLDNLHFLKQSIPWMDEVSIGHALICDALYIGLENTIQ 231

Query: 241 CFRR 244
            + R
Sbjct: 232 MYLR 235


>gi|91784704|ref|YP_559910.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           xenovorans LB400]
 gi|91688658|gb|ABE31858.1| pyridoxine 5'-phosphate synthase [Burkholderia xenovorans LB400]
          Length = 254

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 70/252 (27%), Positives = 121/252 (48%), Gaps = 9/252 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ +    +A ++GA  +T+H R D+RHI   D+ ++R 
Sbjct: 11  IDLGVNIDHVATLRNARGTSYPDPIRAALMAEEAGADVITLHLREDRRHIVDADVRKLRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
                  K  +N+E       L++    +P  + LVP+   +LT++ G D       +  
Sbjct: 71  -----LLKTRMNLECAVTREMLDIACEVQPHDVCLVPEKRQELTTEGGLDVAGQFEAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L    SR+SLF D +  +   +AA   GA  IEL+TG Y    ++P +++    ++
Sbjct: 126 ACRQLAEANSRVSLFIDPDETQI--RAAHEAGAPVIELHTGRYAEA-HDPAEQQREFERV 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               +  + + +++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV   
Sbjct: 183 VHAVEFGRTLGIKVNAGHGLHYTNVQQ-IAAIEGIDELNIGHAIVAHAIFAGWDNAVREM 241

Query: 243 RRACGQHLDNTM 254
           +           
Sbjct: 242 KAIMVAARLGAR 253


>gi|238762800|ref|ZP_04623769.1| Pyridoxal phosphate biosynthetic protein [Yersinia kristensenii
           ATCC 33638]
 gi|238699105|gb|EEP91853.1| Pyridoxal phosphate biosynthetic protein [Yersinia kristensenii
           ATCC 33638]
          Length = 243

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 78/247 (31%), Positives = 126/247 (51%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  +++    KP    LVP+   ++T++ G D       +T  V
Sbjct: 63  --QTIQTRMNLEMAVTDEMVDIACEIKPHFCCLVPEKRQEVTTEGGLDVAGQVDKMTIAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL + G  ISLF D +  +    AA   GA  IE++TG Y    ++  ++   L ++A 
Sbjct: 121 SRLSDAGILISLFIDADMRQI--DAAVAVGAPYIEIHTGAYADASSDLARQ-AELMRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV   + 
Sbjct: 178 AATYAASKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMSGLAAAVTDMKV 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|254486425|ref|ZP_05099630.1| pyridoxal phosphate biosynthetic protein PdxJ [Roseobacter sp.
           GAI101]
 gi|214043294|gb|EEB83932.1| pyridoxal phosphate biosynthetic protein PdxJ [Roseobacter sp.
           GAI101]
          Length = 250

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 70/253 (27%), Positives = 123/253 (48%), Gaps = 10/253 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R   +P+ +   ++A ++GA G+T H R D+RHI   D+  + 
Sbjct: 6   KLRLGVNIDHVATVRNARGGAYPDPLRAARVAQEAGADGITAHLREDRRHITDADIEGL- 64

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +     LN E    +    +  R+KP  + +VP+   + T++ G +  + +  L 
Sbjct: 65  ----LEVLTVPLNFEMAATDEMQKIALRHKPHAVCIVPEKREERTTEGGLEVAREENKLA 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFL 179
             +A L   G R+S+F      +   +AA   GA+ IEL+TG Y   +     ++ +  L
Sbjct: 121 HFIAPLREAGCRVSIFIAAEQRQI--EAANRIGAEVIELHTGAYCDAFAEGHWEEAQKEL 178

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            KL   AQ   ++ L+I+AGH LT   + + I + P + E+++GH     A+  G+  A+
Sbjct: 179 QKLEEMAQYGHELGLEIHAGHGLTYDTVSS-IASFPQVKELNIGHFLVGEAIFLGLGPAI 237

Query: 240 FCFRRACGQHLDN 252
              RR      D 
Sbjct: 238 HEMRRLMDSARDA 250


>gi|188994535|ref|YP_001928787.1| pyridoxine 5'-phosphate synthase [Porphyromonas gingivalis ATCC
           33277]
 gi|238691468|sp|B2RIJ5|PDXJ_PORG3 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|188594215|dbj|BAG33190.1| putative pyridoxal phosphate biosynthetic protein [Porphyromonas
           gingivalis ATCC 33277]
          Length = 238

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 95/243 (39%), Positives = 138/243 (56%), Gaps = 9/243 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P+++ +     + GA G+TVHPRPD+RHIR +D+ +++
Sbjct: 1   MTRLSVNVNKIATLRNARGGNVPDVLRVALDCERFGAQGITVHPRPDERHIRRSDVYDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           + +       E NIEG P+E F+ L E  +PEQ+T+VPD P  LTS+ GWD  +N   L 
Sbjct: 61  KALT-----TEFNIEGNPDERFIRLIEEIRPEQVTMVPDAPDVLTSNAGWDVARNYDHLC 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V + H  G R S+F D + +      A  TG D IELYT PY A Y+        +  
Sbjct: 116 RLVEQFHAWGIRTSIFIDTDLDNI--SWAAKTGTDRIELYTEPYAAAYHKDM--AAAVQP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               +  A  + L INAGHDL + N+      +PY+ E+S+GHA  A AL  G++E +  
Sbjct: 172 YVKASAHAHSLGLGINAGHDLNLDNLRYFAERLPYLDEVSIGHALIADALYLGLEETIRQ 231

Query: 242 FRR 244
           +R 
Sbjct: 232 YRD 234


>gi|330991240|ref|ZP_08315192.1| Pyridoxine 5'-phosphate synthase [Gluconacetobacter sp. SXCC-1]
 gi|329761733|gb|EGG78225.1| Pyridoxine 5'-phosphate synthase [Gluconacetobacter sp. SXCC-1]
          Length = 249

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 73/249 (29%), Positives = 124/249 (49%), Gaps = 9/249 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R    P+ V    +A +SGA G+T H R D+RHIR  DL  +R
Sbjct: 8   PVRLGVNIDHVATVRNARGGTHPDPVLAALLAQESGADGITAHLREDRRHIRDADLERLR 67

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +        LN+E    E    +  R +P    LVP+   ++T++ G D     A L 
Sbjct: 68  AALA-----IPLNMEMAATEEMTTIATRLRPHACCLVPERRQEVTTEGGLDVRGQAASLA 122

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             + R+ + G R+SLF D +  +   +AA   GA  +EL+TG Y    +   +  + L +
Sbjct: 123 PRITRMRDAGIRVSLFIDPDAAQI--EAAAQLGAAVVELHTGAYADAVDEAARA-VELGR 179

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           LA+ A+ A +  L+++AGH L+ +N+   + A+P + E+++GH     A+  G+   +  
Sbjct: 180 LAMGAEHAARCGLEVHAGHGLSYENVSP-VAALPQVMELNIGHFLIGQAIFDGLPAVIRH 238

Query: 242 FRRACGQHL 250
            +       
Sbjct: 239 MKAVMAAAR 247


>gi|118602617|ref|YP_903832.1| pyridoxine 5'-phosphate synthase [Candidatus Ruthia magnifica str.
           Cm (Calyptogena magnifica)]
 gi|118567556|gb|ABL02361.1| pyridoxine 5'-phosphate synthase [Candidatus Ruthia magnifica str.
           Cm (Calyptogena magnifica)]
          Length = 241

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 67/250 (26%), Positives = 121/250 (48%), Gaps = 10/250 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MS  + +N++ +A +R  R   +P+L+    +  +SGA  +T+H R D+RHI+  D+  +
Sbjct: 1   MSIYLGINIDHIATIRQVRGTNYPSLIEAALLCEKSGADSITLHLREDRRHIQDADVEIL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
              +       ++N+E       + +  + KP+   LVP+   +LT++ G D     + +
Sbjct: 61  CNQLT-----TKMNLEMAATNEMITIASKIKPQDCCLVPEKREELTTEGGLDVASQISRM 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                RL      +SLF D   ++    AA+   A  IEL+TG Y    N    + +   
Sbjct: 116 KDVCLRLSESKIIVSLFIDAQKDQI--DAARECSAPVIELHTGHYVNATNEM--QLVEFE 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           K+      A  + LQ+NAGH LT++N  + I  +P I E+++GH+  A A+  G++ A  
Sbjct: 172 KIKTMTTYAHSIGLQVNAGHGLTLENTTS-IAKLPEIVELNIGHSIIARAVFVGLEVATR 230

Query: 241 CFRRACGQHL 250
             +    +  
Sbjct: 231 EMKTLMLEAR 240


>gi|163783865|ref|ZP_02178843.1| pyridoxal phosphate biosynthetic protein [Hydrogenivirga sp.
           128-5-R1-1]
 gi|159880862|gb|EDP74388.1| pyridoxal phosphate biosynthetic protein [Hydrogenivirga sp.
           128-5-R1-1]
          Length = 241

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 77/247 (31%), Positives = 129/247 (52%), Gaps = 9/247 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ +A +R  R    P+ V    IA +SGA  +T+H R D+RHI+  DL  I+  
Sbjct: 2   KLGVNIDHIATIREARKTFEPDPVKGALIAQESGADQITLHLREDRRHIQDEDLFRIK-- 59

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
                 K  +N+E  P E    +    KP +ITLVP+   ++T++ G D   N   +   
Sbjct: 60  --VNITKIPINLEMAPTEEMKRIAIDVKPNRITLVPEKREEITTEGGLDVAGNLEYIKNF 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V  +   G  ++LF D + N+    A+  TGAD +EL+TG Y   + N  +    L +L 
Sbjct: 118 VKEVKETGINVALFIDPDTNQI--DASLETGADAVELHTGEYANAFGN--RIIKELERLQ 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A+ A++  L++ AGH LT +N+ + +  IP I E+++GH+  A ++  G+ +AV   +
Sbjct: 174 FAAKYAKEKGLKVFAGHGLTYENVKS-VAEIPEIEELNIGHSIIANSVFLGLDKAVEKMK 232

Query: 244 RACGQHL 250
           R   +  
Sbjct: 233 RLILEAR 239


>gi|59712691|ref|YP_205467.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio fischeri
           ES114]
 gi|75431523|sp|Q5E317|PDXJ_VIBF1 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|59480792|gb|AAW86579.1| pyridoxine 5'-phosphate synthase [Vibrio fischeri ES114]
          Length = 243

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 79/250 (31%), Positives = 127/250 (50%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA+G+T+H R D+RHI+  D+  +R
Sbjct: 3   SILLGVNIDHVATLRNARGTKYPDPVHAAEIAERAGAAGITIHLREDRRHIKDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +    KPE + LVP+   +LT++ G +       + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMVGIALETKPEFVCLVPEKREELTTEGGLNVSGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +    AA   GA  IEL+TG Y        Q+   L K
Sbjct: 118 AATQKLTEAGIKVSLFIDADKEQI--DAAVECGAPFIELHTGAYADAETEEAQQ-DELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A    L +NAGH LT  N+   I A+P I E+++GH+    A+  G+++AV  
Sbjct: 175 IAAGASYAASKGLIVNAGHGLTYHNV-EAIAALPEIYELNIGHSIMGRAMFDGLEKAVAD 233

Query: 242 FRRACGQHLD 251
             R       
Sbjct: 234 MHRIMLGARK 243


>gi|109900010|ref|YP_663265.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudoalteromonas
           atlantica T6c]
 gi|109702291|gb|ABG42211.1| pyridoxine 5'-phosphate synthase [Pseudoalteromonas atlantica T6c]
          Length = 245

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 79/248 (31%), Positives = 122/248 (49%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ VH   IA ++GA G+T+H R D+RHI   D+  +R 
Sbjct: 4   ILLGVNIDHIATLRNARGTSYPDPVHAADIAERAGADGITIHLREDRRHIMDRDVALLR- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               Q     LN+E    +  + +    +PE   LVP+   +LT++ G D + NQ  +  
Sbjct: 63  ----QTINTRLNLEMAVTDEMVEIALNTQPEFCCLVPEKREELTTEGGLDVVGNQQKIAD 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L + G  +SLF D +  +    AA    A  IE++TG Y    N   ++   L KL
Sbjct: 119 ACKQLSDAGILVSLFIDADFAQI--DAAVACNAPYIEIHTGQYAEAKNE-AEQEAELAKL 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               + A    L++NAGH L   N+   I AI  I E+++GHA  A A   G+ +AV   
Sbjct: 176 VAGIEYADAKGLKVNAGHGLHYHNVKP-IAAIKQIIELNIGHAIIARAAFDGLDKAVSDM 234

Query: 243 RRACGQHL 250
           R    +  
Sbjct: 235 RSLMLEAR 242


>gi|297539121|ref|YP_003674890.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylotenera sp.
           301]
 gi|297258468|gb|ADI30313.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylotenera sp.
           301]
          Length = 242

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 122/247 (49%), Gaps = 9/247 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +R  R   +P++V     A QSGA  +T+H R D+RH++  D+  +R
Sbjct: 1   MIKLGVNIDHVATIRQARGTKYPSVVQAALRAEQSGADSITLHLREDRRHMQDADVHALR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   +  +N+E    +  +++     P+ + LVP+   + T++ G D + N A + 
Sbjct: 61  -----NLLQTRMNLECAVTDEMIDIALEVSPQDVCLVPERREERTTEGGLDVIGNFANVQ 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           K V +L + G R+SLF   +  +    AAK  GA  IEL+TG +     NP  +   L +
Sbjct: 116 KAVKKLSDAGIRVSLFIGPDAAQI--DAAKKAGAPVIELHTGTFADA-ENPVDKDRELQR 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +        K+ L +NAGH L   N+   I +I  I E+++GHA  A AL  G   AV  
Sbjct: 173 IKDAVNHGLKLGLVVNAGHGLHYHNVHE-IASIEGIDELNIGHAIVAHALFVGWDNAVRE 231

Query: 242 FRRACGQ 248
            +    +
Sbjct: 232 MKALVKE 238


>gi|126728507|ref|ZP_01744323.1| pyridoxal phosphate biosynthetic protein [Sagittula stellata E-37]
 gi|126711472|gb|EBA10522.1| pyridoxal phosphate biosynthetic protein [Sagittula stellata E-37]
          Length = 249

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 70/249 (28%), Positives = 121/249 (48%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R   +P+ +   ++A ++GA G+T H R D+RHI   D+  +   
Sbjct: 8   RLGVNIDHVATVRNARGSAYPDPIRAAQLAEEAGADGITAHLREDRRHISDGDIERLMDT 67

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +        LN E         +  R+KP  + +VP+   + T++ G +  + +  L   
Sbjct: 68  LT-----LPLNFEMAATPEMQAIALRHKPHAVCIVPEKREERTTEGGLEVAREENKLAHF 122

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFLNK 181
           +A L   G R+S+F   +  +   +AA   GA  IEL+TG Y   +      Q    L +
Sbjct: 123 IAPLREAGCRVSIFIAADRRQI--EAAHRIGAQVIELHTGAYCDFHAEGAFDQRDAELER 180

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A LA  + L+++AGH LT + +   I A P + E+++GH     A+  G+K A+  
Sbjct: 181 MREMAGLAHSLGLEVHAGHGLTYETVKP-IAAFPEVMELNIGHFLIGEAIFLGLKPAIAE 239

Query: 242 FRRACGQHL 250
            RR   +  
Sbjct: 240 MRRLMDEAR 248


>gi|238692027|sp|B3DF93|PDXJ_MICAN RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|190192143|dbj|BAG48278.1| pyridoxal phosphate biosynthetic protein PdxJ [Microcystis
           aeruginosa NIES-843]
          Length = 240

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 76/246 (30%), Positives = 123/246 (50%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ VA +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MLTLGVNIDHVATIRQARRTVEPDPVAAAVLAEIGGADGITVHLREDRRHIQDRDVRILR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  +  LN+E  P E  + +    KP+ +TLVP+   ++T++ G D L N     
Sbjct: 61  -----QTVRTHLNLEMAPTEEMIAIALDIKPDYVTLVPEKRQEVTTEGGIDMLGNFDRFC 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V RL      +S F D +  +   QAA  TGA  IEL+TG Y        ++ +    
Sbjct: 116 RVVERLQAANIPVSWFIDADFAQI--QAAANTGAKFIELHTGQYAEAQQESDRQALLTI- 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L    + A  + L++NAGH LT  N+   +  +P + E+++GH   + A+  G++ AV  
Sbjct: 173 LKEGCEYASSLGLRVNAGHGLTYGNV-YAVACLPNMEELNIGHTIISRAVLVGLERAVRE 231

Query: 242 FRRACG 247
            + A  
Sbjct: 232 MKLAMR 237


>gi|332878834|ref|ZP_08446549.1| pyridoxine 5'-phosphate synthase [Capnocytophaga sp. oral taxon 329
           str. F0087]
 gi|332683185|gb|EGJ56067.1| pyridoxine 5'-phosphate synthase [Capnocytophaga sp. oral taxon 329
           str. F0087]
          Length = 238

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 94/242 (38%), Positives = 134/242 (55%), Gaps = 9/242 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P+L+ + K A Q GA G+T+HPRPD+RHIRY D  ++ 
Sbjct: 1   MTKLSVNINKIATLRNARGGNMPDLLQVAKDAQQFGAEGITIHPRPDERHIRYQDAFDL- 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    E NIEG P   F++L  + KP Q+TLVPD    +TS+ GWD ++++  LT
Sbjct: 60  ----LKVVTTEYNIEGNPIPKFVDLVLQVKPTQVTLVPDAEDAITSNAGWDTVKHKDFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + VA     G R SLF D      +  AA  TGAD +ELYT  Y          +  +  
Sbjct: 116 EVVAEFKRNGIRTSLFVDPVEAMVT--AAAATGADRVELYTEGY--AREYALGNKGAIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               AQ A+K+ L +NAGHDL++ N+      IP + E+S+GHA    AL  G++  +  
Sbjct: 172 YVRAAQEAEKVGLGLNAGHDLSLDNVQYFRRQIPNLLEVSIGHALICEALYLGLENVIQL 231

Query: 242 FR 243
           + 
Sbjct: 232 YL 233


>gi|313206068|ref|YP_004045245.1| pyridoxine 5'-phosphate synthase [Riemerella anatipestifer DSM
           15868]
 gi|312445384|gb|ADQ81739.1| pyridoxine 5'-phosphate synthase [Riemerella anatipestifer DSM
           15868]
 gi|315022381|gb|EFT35409.1| pyridoxine 5'-phosphate synthase [Riemerella anatipestifer RA-YM]
 gi|325336491|gb|ADZ12765.1| Pyridoxal phosphate biosynthesis protein [Riemerella anatipestifer
           RA-GD]
          Length = 239

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 87/247 (35%), Positives = 132/247 (53%), Gaps = 9/247 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P++  +   A + GA G+T+HPRPD+RHI   D+ +++
Sbjct: 1   MTKLSVNINKIATLRNARGGDVPSVTQVAIDAQKFGAQGITIHPRPDERHITRKDVYDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L+       E NIEG P+  F+++    KPEQ+TLVPD    +TS+ GWD   +   L 
Sbjct: 61  PLVT-----TEFNIEGNPHRPFIDMVLEVKPEQVTLVPDADDAITSNAGWDCKMHLDFLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             +A     G R S+F D   N   ++ A  TG D IELYT  Y       +     +  
Sbjct: 116 NVIAEFKAEGIRTSIFLDP--NPEMVKYAAETGTDRIELYTEAY--AKGYTKNREQAILP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
              TA+ A    L INAGHDL+++N+    + IP + E+S+GHA  + AL  G++  +  
Sbjct: 172 YIKTAEEAINNGLGINAGHDLSLENLKYFSDEIPNLLEVSIGHALISEALYLGLENTIQS 231

Query: 242 FRRACGQ 248
           + +   +
Sbjct: 232 YLKRLAK 238


>gi|332162688|ref|YP_004299265.1| pyridoxine 5'-phosphate synthase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318606793|emb|CBY28291.1| pyridoxine 5'-phosphate synthase [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325666918|gb|ADZ43562.1| pyridoxine 5'-phosphate synthase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330860316|emb|CBX70630.1| pyridoxine 5'-phosphate synthase [Yersinia enterocolitica W22703]
          Length = 243

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 76/247 (30%), Positives = 123/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    +  + +     P    LVP+   ++T++ G D       +T  V
Sbjct: 63  --ETIQTRMNLEMAVTDEMVGIACEINPHFCCLVPEKRQEVTTEGGLDVAGQIDKMTVAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G  +SLF D +  +    AA   GA  IE++TG Y    ++  ++   L ++A 
Sbjct: 121 SRLAEAGILVSLFIDADMRQI--DAAVAVGAPYIEIHTGAYADATSDLARQ-AELVRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P I E+++GHA    A+  G+  AV   + 
Sbjct: 178 AATYAASKGLKVNAGHGLTYHNVQP-IAALPEIHELNIGHAIIGQAVMSGLAAAVTDMKV 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|312888559|ref|ZP_07748128.1| pyridoxine 5'-phosphate synthase [Mucilaginibacter paludis DSM
           18603]
 gi|311298873|gb|EFQ75973.1| pyridoxine 5'-phosphate synthase [Mucilaginibacter paludis DSM
           18603]
          Length = 239

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 92/244 (37%), Positives = 136/244 (55%), Gaps = 10/244 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P+L+ +     + GA G+TVHPRPD+RHIRY D+ +++
Sbjct: 1   MTRLSVNINKIATLRNSRGGNNPDLIKVALDCERFGAEGITVHPRPDERHIRYQDVDDLK 60

Query: 62  RLIDEQFPKAELNIEGYP-NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
                +  K E NIEG P  ++F+ L    +P Q+TLVPD   Q+TS+HGWD + NQ+ L
Sbjct: 61  -----KTIKTEFNIEGNPVEDSFMKLVLNNRPAQVTLVPDALGQITSNHGWDTIANQSYL 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            + ++     G R+S+F D       ++A   TG + IELYT  Y             + 
Sbjct: 116 KEVISEFQLAGIRVSIFVDPV--AEMIEATATTGTNRIELYTEAY--ASGYHADREKAIA 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
                AQ+AQK+ L +NAGHDL + N+      IP + E+S+GHA    AL  G++  + 
Sbjct: 172 PYVEAAQIAQKLGLGLNAGHDLDLVNLQYFAQNIPGLLEVSIGHALVCDALYYGLENTIQ 231

Query: 241 CFRR 244
            + R
Sbjct: 232 MYLR 235


>gi|260432752|ref|ZP_05786723.1| pyridoxine 5'-phosphate synthase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416580|gb|EEX09839.1| pyridoxine 5'-phosphate synthase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 248

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 68/250 (27%), Positives = 120/250 (48%), Gaps = 10/250 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R   +P+ +   K+A ++GA G+T H R D+RHI   D+  + ++
Sbjct: 7   RLGVNIDHVATVRNARGGAYPDPLRAAKLAEEAGADGITAHLREDRRHISDADIEGLMQV 66

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +        LN E         +  R+KP  + LVP+   + T++ G +  + +  L   
Sbjct: 67  LS-----VPLNFEMAATPEMQAIALRHKPHAVCLVPEKREERTTEGGLEVAREENRLAHF 121

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFLNK 181
           +A L + G R+S+F     +   ++AA   GA  IEL+TG Y   +        +  L  
Sbjct: 122 IAPLRDAGCRVSIFIAA--DRKQIEAAHRIGAQVIELHTGAYCDAHAEGRMDDAQRELEA 179

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   +  A  + L+++AGH LT   +   + A P + E+++GH     A+  G+  A+  
Sbjct: 180 LREMSAFAHSLGLEVHAGHGLTYDTVQP-VAAFPELRELNIGHFLIGEAIFRGLGPAIHE 238

Query: 242 FRRACGQHLD 251
            RR   +   
Sbjct: 239 MRRLMDEARR 248


>gi|238753921|ref|ZP_04615281.1| Pyridoxal phosphate biosynthetic protein [Yersinia ruckeri ATCC
           29473]
 gi|238707909|gb|EEQ00267.1| Pyridoxal phosphate biosynthetic protein [Yersinia ruckeri ATCC
           29473]
          Length = 243

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 77/247 (31%), Positives = 124/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTQYPDPVQAAFIAEQNGAEGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    +  L +    KP    LVP+   ++T++ G D       +T  V
Sbjct: 63  --ETIQTRMNLEMAVTDEMLAIACELKPHFCCLVPEKREEVTTEGGLDVAGQLDKMTFAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L + G  +SLF D +  +    AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 EQLTDAGILVSLFIDADKRQI--DAAVAAGAPYIEIHTGAYADAQTHLSRQ-AELLRIAN 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A +  L++NAGH LT  N+   I A+P I E+++GHA    A+  G+  AV   + 
Sbjct: 178 AASYAAEKGLKVNAGHGLTYHNVQP-IAALPEIHELNIGHAIIGQAVMTGLAVAVSEMKM 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|304413542|ref|ZP_07395015.1| pyridoxine 5'-phosphate synthase [Candidatus Regiella insecticola
           LSR1]
 gi|304284385|gb|EFL92778.1| pyridoxine 5'-phosphate synthase [Candidatus Regiella insecticola
           LSR1]
          Length = 252

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 72/247 (29%), Positives = 126/247 (51%), Gaps = 10/247 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ +A LRN R   +P+ +    IA Q+GA G+TVH R D+RHI   D+  +R  
Sbjct: 7   RLGVNIDHIATLRNARGTNYPDPIFAAGIAEQAGADGITVHLREDRRHITDPDVELLR-- 64

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +     +N+E    +  ++   + KP    LVP++  ++T++ G + +     +T  
Sbjct: 65  ---KTISTRMNLEMAVTKEMIDNACQLKPHFCCLVPENRQEITTEGGLNVVDQLETITAA 121

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V RL  +G ++SLF D + ++    AA  TG   IE++TG Y             L ++ 
Sbjct: 122 VERLSAVGIQVSLFIDADNDQI--DAAVKTGTPYIEIHTGAYAEAA--ELDRDNELERIT 177

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A+ A    L++NAGH L   N+ + I A+P I E+++GHA  + A+  G+  A+   +
Sbjct: 178 KAARYATAQGLKVNAGHGLHYHNVKS-IAALPEIHELNIGHAIISRAVITGLDAAIRDMK 236

Query: 244 RACGQHL 250
           +   +  
Sbjct: 237 QLMREAR 243


>gi|332519952|ref|ZP_08396416.1| pyridoxal phosphate biosynthetic protein PdxJ [Lacinutrix algicola
           5H-3-7-4]
 gi|332044511|gb|EGI80705.1| pyridoxal phosphate biosynthetic protein PdxJ [Lacinutrix algicola
           5H-3-7-4]
          Length = 237

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 92/246 (37%), Positives = 133/246 (54%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PNL+   K   + GA G+T+HPRPD+RHIRY D  +++
Sbjct: 1   MTKLSVNINKIATLRNARGGDTPNLLQFAKDVQRFGAQGVTIHPRPDERHIRYQDARDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                     E NIEG PN  F++L    KP Q+TLVPD    +TSD GWD ++++  LT
Sbjct: 61  -----SIVNTEYNIEGNPNSKFIDLVLEVKPTQVTLVPDAVDAITSDAGWDTIKHKIFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + ++   + G R S+F D    +   + AK TG D +ELYT  +   +         +  
Sbjct: 116 EVISEFKSNGIRTSIFVDPVLAQI--EGAKATGTDRVELYTEAF--AHQFGLGNTNAVKP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A LA  +DL +NAGHDL++ NI      IP + E+S+GHA  + +L  GV+  V  
Sbjct: 172 YTDCAVLANTLDLGVNAGHDLSLDNIKFFKENIPNLLEVSIGHALVSESLYLGVENVVNM 231

Query: 242 FRRACG 247
           +     
Sbjct: 232 YLNKLK 237


>gi|323137547|ref|ZP_08072624.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylocystis sp.
           ATCC 49242]
 gi|322397173|gb|EFX99697.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylocystis sp.
           ATCC 49242]
          Length = 251

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 69/253 (27%), Positives = 119/253 (47%), Gaps = 10/253 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R  P P+ V    +A+++GA G+T H R D+RHI   D+  ++  
Sbjct: 7   RLGVNVDHVATIRNARGGPRPDPVRAALLAIEAGADGITAHLREDRRHINDADMARLKAA 66

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I        LN E       L++     P  + LVP+   + T++ G D +     L   
Sbjct: 67  ITR-----PLNFEMAATGQMLDIALATAPHAVCLVPEKRTERTTEGGLDVVGGHDYLAPY 121

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGAC--YNNPQQERIFLNK 181
           V +L   G R+SLF +   +E ++ AA    A  +EL+TG +       +         +
Sbjct: 122 VDQLARGGIRVSLFIEP--SEEAIDAAVSIRAPVVELHTGAWCHAVEVRDLALAEREFAR 179

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A  A +  ++++AGH L  +     ++A+P I E+++GH     A+  G+ EA+  
Sbjct: 180 VEKAAAYAAERGIEVHAGHGLDYETARR-VSALPQIVELNIGHFLIGEAVFVGLAEAIRQ 238

Query: 242 FRRACGQHLDNTM 254
            RRA      +  
Sbjct: 239 MRRAMDDGRASAA 251


>gi|213962046|ref|ZP_03390311.1| pyridoxine 5'-phosphate synthase [Capnocytophaga sputigena Capno]
 gi|213955399|gb|EEB66716.1| pyridoxine 5'-phosphate synthase [Capnocytophaga sputigena Capno]
          Length = 238

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 89/242 (36%), Positives = 130/242 (53%), Gaps = 9/242 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P+++ + K   + GA G+T+HPRPD+RHIRY D  ++ 
Sbjct: 1   MTKLSVNINKIATLRNARGGNMPDVLQVAKDVQRFGAEGVTIHPRPDERHIRYQDAFDL- 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    E NIEG P   F++L  + KP Q+TLVPD    +TS+ GWD ++++  LT
Sbjct: 60  ----LKVVTTEYNIEGNPIPKFIDLVLQVKPTQVTLVPDAEDAITSNAGWDTIKHKDFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V      G R SLF D      +  AA  TG D +ELYT  Y          +  +  
Sbjct: 116 EVVTEFKRNGIRTSLFVDPVEAMVT--AAAATGTDRVELYTEGY--ASQYALGNKTAVEP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A  AQK+ L +NAGHDL++ N+      IP + E+S+GHA    AL  G++  +  
Sbjct: 172 YVKAALEAQKVGLGLNAGHDLSLDNLKYFKEQIPNLLEVSIGHALICEALYLGLENVIQL 231

Query: 242 FR 243
           + 
Sbjct: 232 YL 233


>gi|227112904|ref|ZP_03826560.1| pyridoxine 5'-phosphate synthase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 243

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 77/247 (31%), Positives = 125/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    E  LN+    KP    LVP+   ++T++ G D    Q  +   V
Sbjct: 63  --ETLQTRMNLEMAVTEEMLNIACEVKPHFCCLVPEKRQEVTTEGGLDVAGQQEKIDNAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL      +SLF D +  +    AA  +GA  IE++TG Y    ++  ++     ++  
Sbjct: 121 ARLSQANILVSLFIDADKRQI--DAAVASGAPYIEIHTGAYADAPDDAARQ-HEFERIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+K+AV   + 
Sbjct: 178 AATYAAAKGLKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVMSGLKDAVAEMKS 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|114570123|ref|YP_756803.1| pyridoxine 5'-phosphate synthase [Maricaulis maris MCS10]
 gi|114340585|gb|ABI65865.1| pyridoxine 5'-phosphate synthase [Maricaulis maris MCS10]
          Length = 247

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 77/255 (30%), Positives = 129/255 (50%), Gaps = 10/255 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MS  + VN++ VA +RN R    P+ V   + A ++GA G+T H R D+RHI  TD+  +
Sbjct: 1   MSIRLGVNIDHVATIRNARGGEHPDPVRAARQASEAGADGITAHLREDRRHITDTDIDRL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
              ID       LN+E       L++  R+KP  + LVP+   + T++ G D       +
Sbjct: 61  MAEID-----LPLNLEMAATPEMLDIALRHKPHAVCLVPEKREERTTEGGLDVAAGHNTI 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQQERIF 178
              V +L   GSR+SLF + +  + ++  A+  GA  +EL+TG Y   +   +  +    
Sbjct: 116 APYVRQLREAGSRVSLFIEPDPVQIAV--AEAMGAAVVELHTGAYCEAFLAGDKAKLDHH 173

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           L +L   + +A +  L+++AGH LT   +   I AIP + E+++GH     A+  G++EA
Sbjct: 174 LKRLQAASTVAHERGLEVHAGHGLTYDTVKP-IAAIPEVIELNIGHFLIGEAIFRGLREA 232

Query: 239 VFCFRRACGQHLDNT 253
           V   R    +    +
Sbjct: 233 VGTMRGLIEEARAAS 247


>gi|87198933|ref|YP_496190.1| pyridoxal phosphate biosynthetic protein PdxJ [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87134614|gb|ABD25356.1| pyridoxine 5'-phosphate synthase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 247

 Score =  255 bits (652), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 77/247 (31%), Positives = 119/247 (48%), Gaps = 10/247 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R    P+ V   +I    G  G+T H R D+RHIR  DL  I   
Sbjct: 11  RLGVNIDHVATIRNARGGDHPDPVRAAEIVAAVGGDGITAHLREDRRHIRDEDLARI--- 67

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
             +      LN+E    +  L +  R+KP    +VP+   + T++ G D       L   
Sbjct: 68  --QAATSLPLNLEMAATDEMLEIALRHKPHAACIVPERREERTTEGGLDAAGQHNRLAPI 125

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           VARL + G R+SLF      +   +AA   GA  +EL+TG Y   +       + L ++A
Sbjct: 126 VARLSDAGIRVSLFIAPEPRQI--EAAMKLGAPVVELHTGEY--AHAEGDARAVELRRIA 181

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A LA +  ++ +AGH LT +N+   I AIP ++E+++GH     A+  G+  AV   R
Sbjct: 182 DMAALAARNGIEPHAGHGLTYENVQP-IAAIPQLAELNIGHYLIGEAIFVGLDTAVRRMR 240

Query: 244 RACGQHL 250
               +  
Sbjct: 241 DLMDEAR 247


>gi|254429657|ref|ZP_05043364.1| pyridoxal phosphate biosynthetic protein PdxJ [Alcanivorax sp.
           DG881]
 gi|196195826|gb|EDX90785.1| pyridoxal phosphate biosynthetic protein PdxJ [Alcanivorax sp.
           DG881]
          Length = 241

 Score =  255 bits (651), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 77/244 (31%), Positives = 120/244 (49%), Gaps = 9/244 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R   +P  V    +A Q+GA G+TVH R D+RHI   D+  +    
Sbjct: 6   LGVNIDHIATLRQARGTRYPEPVQAALVAEQAGADGITVHLREDRRHINDRDVELL---- 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    E  + +  R +P    LVP+   +LT++ G D   N+A + +  
Sbjct: 62  -AQTLQTRMNLEMAATEEMVGIACRIQPPHCCLVPEKREELTTEGGLDVAGNKAWIAQCC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  + +  AA+  GA  IE++TG Y        Q+   L ++  
Sbjct: 121 QRLGQAGIEVSLFIDADKAQIA--AARECGAPAIEIHTGGYADAETVDAQQ-QELARIRE 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
               A +  L +NAGH L   N    I  IP I+E+++GH+  A A   G+ EAV   R 
Sbjct: 178 GVAFALEQGLVVNAGHGLHYHNTLP-IAEIPGINELNIGHSIIARAAITGLDEAVRSMRA 236

Query: 245 ACGQ 248
              +
Sbjct: 237 LLDK 240


>gi|34540436|ref|NP_904915.1| pyridoxine 5'-phosphate synthase [Porphyromonas gingivalis W83]
 gi|6225840|sp|Q51843|PDXJ_PORGI RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|1296977|emb|CAA65867.1| pyridoxal phosphate synthetase [Porphyromonas gingivalis]
 gi|34396749|gb|AAQ65814.1| pyridoxal phosphate biosynthetic protein PdxJ [Porphyromonas
           gingivalis W83]
          Length = 238

 Score =  255 bits (651), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 96/243 (39%), Positives = 138/243 (56%), Gaps = 9/243 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P+++ +     + GA G+TVHPRPD+RHIR +D+ +++
Sbjct: 1   MTRLSVNVNKIATLRNARGGNVPDVLRVALDCERFGAQGITVHPRPDERHIRRSDVYDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           + +       E NIEG P+E F+ L E  +PEQ+T+VPD P  LTS+ GWD  +N   L 
Sbjct: 61  KALT-----TEFNIEGNPDERFIRLIEEIRPEQVTMVPDAPDVLTSNAGWDVARNYDHLC 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V R H  G R S+F D + +      A  TG D IELYT PY A Y+        +  
Sbjct: 116 RLVERFHAWGIRTSIFIDTDLDNI--SWAAKTGTDRIELYTEPYAAAYHKDM--AAAVQP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               +  A  + L INAGHDL + N+      +PY+ E+S+GHA  A AL  G++E +  
Sbjct: 172 YVKASVHAHSLGLGINAGHDLNLDNLRYFAERLPYLDEVSIGHALIADALYLGLEETIRQ 231

Query: 242 FRR 244
           +R 
Sbjct: 232 YRD 234


>gi|54310184|ref|YP_131204.1| pyridoxine 5'-phosphate synthase [Photobacterium profundum SS9]
 gi|91207554|sp|Q3V7I6|PDXJ_PHOPR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|46914625|emb|CAG21402.1| putative pyridoxal phosphate biosyntheticprotein PdxJ
           [Photobacterium profundum SS9]
          Length = 243

 Score =  255 bits (651), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 72/249 (28%), Positives = 126/249 (50%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ VH  ++A ++GA G+TVH R D+RHI   D+  ++ 
Sbjct: 4   ILLGVNIDHIATLRNARGTRYPDPVHAAEVAERAGADGITVHLREDRRHINDRDVRILK- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  +  +N+E    +  +++    KPE + LVP+   +LT++ G D       +  
Sbjct: 63  ----ETIQTRMNLEMAVTDEMVSIALDTKPEFVCLVPEKREELTTEGGLDVAGQLEKIKA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L + G ++SLF D +  +    A    GA  +EL+TG Y        Q+   L K+
Sbjct: 119 ATQKLTDAGIKVSLFIDADRAQI--DATLACGAPFVELHTGHYADAETEEAQQ-AELEKI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A  A  + +++NAGH LT  N+   I A+P + E+++GH+  + A   G+ +AV   
Sbjct: 176 ASAATYAHGLGIKVNAGHGLTYHNVKP-IAALPELYELNIGHSIISRAAFDGLNKAVADM 234

Query: 243 RRACGQHLD 251
           +        
Sbjct: 235 KVEMLDARR 243


>gi|319779584|ref|YP_004130497.1| Pyridoxine 5'-phosphate synthase [Taylorella equigenitalis MCE9]
 gi|317109608|gb|ADU92354.1| Pyridoxine 5'-phosphate synthase [Taylorella equigenitalis MCE9]
          Length = 254

 Score =  255 bits (651), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 72/248 (29%), Positives = 132/248 (53%), Gaps = 10/248 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR +R   +P+ +    +A  +GA  +T+H R D+RHI+  D+ E++
Sbjct: 7   MIKLGVNIDHVATLRQQRGTLYPDPIEAALLAESAGADFITLHLREDRRHIQDKDVFEMK 66

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +        +N+E    E  L++  + KP+ + LVP+   +LT++ G D + +  L+ 
Sbjct: 67  DRLL-----THMNLECAITEEMLSIAIKAKPKDVCLVPEKREELTTEGGLDVVTHFDLIK 121

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ--QERIFL 179
             V++L + G R+SLF D + N+   +AA   G   IEL+TG Y    +     +    L
Sbjct: 122 SAVSKLSDSGIRVSLFIDPDVNQI--KAAYDAGTKIIELHTGAYAELSDKSSGAEVNTEL 179

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            +L    + A+ + L++NAGH L  +N+  +I  +  ISE+++GH+  A ++  G+ +AV
Sbjct: 180 ERLKTCIREAKTLGLKVNAGHGLNFKNVVPII-KLEGISELNIGHSLIAQSVFDGLYKAV 238

Query: 240 FCFRRACG 247
              +    
Sbjct: 239 SDMKALIR 246


>gi|292489087|ref|YP_003531974.1| Pyridoxine 5'-phosphate synthase [Erwinia amylovora CFBP1430]
 gi|292900211|ref|YP_003539580.1| pyridoxal phosphate biosynthetic protein [Erwinia amylovora ATCC
           49946]
 gi|291200059|emb|CBJ47185.1| pyridoxal phosphate biosynthetic protein [Erwinia amylovora ATCC
           49946]
 gi|291554521|emb|CBA22088.1| Pyridoxine 5'-phosphate synthase [Erwinia amylovora CFBP1430]
 gi|312173245|emb|CBX81500.1| Pyridoxine 5'-phosphate synthase [Erwinia amylovora ATCC BAA-2158]
          Length = 243

 Score =  255 bits (651), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 72/247 (29%), Positives = 120/247 (48%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R   +P+ V    ++ Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHVATVRNARGTHYPDPVQAAYVSEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    +  +++    +P    LVP+   ++T++ G D    Q  +T  V
Sbjct: 63  --ETIQTRMNLEMAVTDEMVDIACEIQPHFCCLVPEKREEVTTEGGLDVAGQQDKVTAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL+  G  +SLF D +  +    AA   GA  IE++TG Y             L ++A 
Sbjct: 121 KRLNAAGILVSLFIDADPRQI--DAAVAAGAPYIEIHTGAYAEA-QEGPARDAELARIAE 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
               A    L++NAGH LT  N+   + A+P + E+++GHA    A+  G+  AV   + 
Sbjct: 178 ATTYAAGKGLKVNAGHGLTYHNVLP-VAALPEMHELNIGHAIIGRAMFSGLAAAVQEMKL 236

Query: 245 ACGQHLD 251
                  
Sbjct: 237 LLRAARR 243


>gi|295677173|ref|YP_003605697.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           CCGE1002]
 gi|295437016|gb|ADG16186.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           CCGE1002]
          Length = 254

 Score =  254 bits (650), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 71/252 (28%), Positives = 121/252 (48%), Gaps = 9/252 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ +    +A ++GA  +T+H R D+RHI   D+ ++R 
Sbjct: 11  IDLGVNIDHVATLRNARGTSYPDPIRAALMAEEAGADAITLHLREDRRHIVDADVHKLRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
                  K  +N+E       L++  + +P  + LVP+   +LT++ G D       +  
Sbjct: 71  -----LLKTRMNLECAVTAEMLDIACQVQPHDVCLVPEKRAELTTEGGLDVAGQFEAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L +  SR+SLF D +  +   +AA   GA  IEL+TG Y    ++P +++    ++
Sbjct: 126 ACKQLADANSRVSLFIDPDETQI--RAAHEAGAPVIELHTGRYAEA-HDPAEQQREYERI 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
                    + L++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV   
Sbjct: 183 VRAVDFGTTLGLKVNAGHGLHYTNVQQ-IAAIDGIVELNIGHAIVAHAIFAGWDNAVREM 241

Query: 243 RRACGQHLDNTM 254
           +           
Sbjct: 242 KAIMVAARLGAR 253


>gi|78184987|ref|YP_377422.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. CC9902]
 gi|123580867|sp|Q3AVH3|PDXJ_SYNS9 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|78169281|gb|ABB26378.1| Pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           CC9902]
          Length = 249

 Score =  254 bits (650), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 77/256 (30%), Positives = 132/256 (51%), Gaps = 10/256 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MASLGVNIDHIANIREARRTVEPDPVPMAMLAELGGADGITVHLREDRRHIQDRDVELLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  ++ LN+E       + +  R KP+ +TLVP+   ++T++ G D +   + LT
Sbjct: 61  -----QTVRSRLNLEMAATAEMVAIALRVKPDMVTLVPEHRQEVTTEGGLDVVAQLSELT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V++L   G  +SLF D   ++  L+    +GA  +EL+TG Y     +   +   L +
Sbjct: 116 GMVSQLQTSGIPVSLFVDPVASQ--LRGCTDSGARWVELHTGRY--AEGSWNDQPHELAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L      A+ M L++NAGH LT QN+   + AIP + E+++GH   A A+  G+++AV  
Sbjct: 172 LTEGTATARAMGLRVNAGHGLTYQNVEP-VAAIPGMEELNIGHTIVARAVVVGLQQAVRE 230

Query: 242 FRRACGQHLDNTMRLT 257
            +        + +   
Sbjct: 231 MKALIQNPRRDPLFGQ 246


>gi|295132500|ref|YP_003583176.1| pyridoxal phosphate biosynthetic protein PdxJ [Zunongwangia
           profunda SM-A87]
 gi|294980515|gb|ADF50980.1| pyridoxal phosphate biosynthetic protein PdxJ [Zunongwangia
           profunda SM-A87]
          Length = 249

 Score =  254 bits (650), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 93/246 (37%), Positives = 142/246 (57%), Gaps = 8/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PN+V       + GA G+TVHPRPD+RHIRY D  +++
Sbjct: 12  MTKLSVNINKIATLRNARGGNIPNVVQCALDIEKFGAEGITVHPRPDERHIRYQDTRDLK 71

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++     K E NIEG P   F+NL    KP Q+TLVPD    +TS+ GW+ ++N+  L 
Sbjct: 72  PVL-----KTEFNIEGNPVTKFINLVLEVKPAQVTLVPDAEDAITSNAGWNTVKNKEYLI 126

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + ++     G R S+F D   +E  ++ A  TG D IELYT  +   + +  + +  +  
Sbjct: 127 EVISEFKKHGIRTSIFVDA--DEKMIEGAAATGTDRIELYTESFAEKFADGDK-KEAVKP 183

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
            A  A+LA ++ L +NAGHDL++ NI    N +P++ E+S+GHA  A AL  G++E +  
Sbjct: 184 YAKCAELAHQLGLGVNAGHDLSLDNIEFFKNEVPFVDEVSIGHALIAEALYLGLEETISR 243

Query: 242 FRRACG 247
           + +   
Sbjct: 244 YLKKLQ 249


>gi|292492475|ref|YP_003527914.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosococcus
           halophilus Nc4]
 gi|291581070|gb|ADE15527.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosococcus
           halophilus Nc4]
          Length = 246

 Score =  254 bits (650), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 76/248 (30%), Positives = 129/248 (52%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ +     A Q+GA G+T+H R D+RHI+  D+  +  
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPIQAAIEAEQAGAEGITLHLREDRRHIQERDVALLSN 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +     +N+E    E  L + E+Y P+   LVP+   +LT++ G +       +T+
Sbjct: 67  ILLSK-----MNLEMAVTEEMLAIAEKYGPKDCCLVPERREELTTEGGLEVAGQLGRITE 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
             ARL   G R+SLF D   + + ++AA    A  IE++TG +    +   ++     ++
Sbjct: 122 ACARLKEAGIRVSLFIDA--DPYQVEAAAQAAAPVIEIHTGHFADAEDERSRQ-KEFQRI 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               +  ++  LQ+NAGH L  QN+   I AIP I E+++GHA  A AL  G++ AV   
Sbjct: 179 VEAVRQGREAGLQVNAGHGLNYQNVAA-IAAIPEIVELNIGHAIIARALFTGMQAAVREM 237

Query: 243 RRACGQHL 250
           +R   +  
Sbjct: 238 KRLMREAR 245


>gi|149369713|ref|ZP_01889565.1| pyridoxal phosphate biosynthetic protein PdxJ [unidentified
           eubacterium SCB49]
 gi|149357140|gb|EDM45695.1| pyridoxal phosphate biosynthetic protein PdxJ [unidentified
           eubacterium SCB49]
          Length = 237

 Score =  254 bits (650), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 136/246 (55%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P+L+   K     GA G+T+HPRPD+RHIRY D  +++
Sbjct: 1   MTKLSVNINKLATLRNARGGNVPDLLKATKDIELFGAQGITIHPRPDERHIRYQDARDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                     E NIEG P  +F++L    KP Q+TLVPD    LTS+ GWD +++++ L 
Sbjct: 61  -----NVVNTEYNIEGNPITSFIDLVLEVKPTQVTLVPDSVDVLTSNAGWDTVKHKSFLI 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +      G R S+F D   +    + A L G D IELYT  +       + +   + K
Sbjct: 116 EVIDEFKRNGIRTSVFVDPELSLI--EGAALVGTDRIELYTEDF--AVGYSKGDHAVVKK 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
            A  + LA ++ L +NAGHDL++ NI    N +PY++E+S+GHA  + AL  G++  V  
Sbjct: 172 YADCSLLAHQLGLGVNAGHDLSLDNIEFFKNNVPYLAEVSIGHALISEALYQGLERVVKQ 231

Query: 242 FRRACG 247
           + +   
Sbjct: 232 YLQKLK 237


>gi|254431339|ref|ZP_05045042.1| pyridoxal phosphate biosynthetic protein PdxJ [Cyanobium sp. PCC
           7001]
 gi|197625792|gb|EDY38351.1| pyridoxal phosphate biosynthetic protein PdxJ [Cyanobium sp. PCC
           7001]
          Length = 249

 Score =  254 bits (650), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 78/256 (30%), Positives = 131/256 (51%), Gaps = 10/256 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MASLGVNIDHIANVRQARRTVEPDPVTYALLAELGGADGITVHLREDRRHIQERDVELLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  ++ LN+E         +  R +P+ +TLVP+   ++T++ G D       LT
Sbjct: 61  -----QTVRSRLNLEMAATAEMEAIALRLRPDMVTLVPEKREEVTTEGGLDVAAQTGPLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V RL   G  +SLF D    +  L+A +  GA  +EL+TG Y     + Q++   L +
Sbjct: 116 AMVTRLQQAGIGVSLFVDPAAAQ--LEACRAIGARWVELHTGAYAEA--DWQRQSDELAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   + +A+ + L++NAGH LT QN+   + AI  + E+++GH   A AL  G+++AV  
Sbjct: 172 LTEGSFIARSLGLRVNAGHGLTYQNVEP-VAAIEGMEELNIGHTIVARALAVGLEQAVRE 230

Query: 242 FRRACGQHLDNTMRLT 257
            +        + +  +
Sbjct: 231 MKVLVQNPRRDPLFGS 246


>gi|302878423|ref|YP_003846987.1| pyridoxal phosphate biosynthetic protein PdxJ [Gallionella
           capsiferriformans ES-2]
 gi|302581212|gb|ADL55223.1| pyridoxal phosphate biosynthetic protein PdxJ [Gallionella
           capsiferriformans ES-2]
          Length = 239

 Score =  254 bits (650), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 75/246 (30%), Positives = 121/246 (49%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + +N++ VA LR  R   +PNLV    I  ++GA  +T+H R D+RHI+  D+  +R
Sbjct: 1   MIKLGLNIDHVATLRQARGARYPNLVRAALICEEAGADAITIHLREDRRHIQDADVEVLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++     +  +N+E    E  +    R KP  + LVP+   +LT++ G + L+    + 
Sbjct: 61  GML-----QTRMNLECAVTEEMIANALRIKPHDLCLVPERREELTTEGGLNVLRYFDAVK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               R  + G R+SLF D +  +    AA   GA  IEL+TG Y    ++       L +
Sbjct: 116 SACERCADAGIRVSLFIDADNAQI--DAAVRAGAPVIELHTGKYADA-DSVPARAYELER 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +    + A    LQ+NAGH L   N+   I AIP I E+++GHA  A ++  G+  AV  
Sbjct: 173 IRAAVEYAHGQGLQVNAGHGLHYHNVQA-IAAIPNIVELNIGHAIIAESVFIGLDAAVRK 231

Query: 242 FRRACG 247
            +    
Sbjct: 232 MKDLIR 237


>gi|238750383|ref|ZP_04611884.1| Pyridoxine 5'-phosphate synthase [Yersinia rohdei ATCC 43380]
 gi|238711314|gb|EEQ03531.1| Pyridoxine 5'-phosphate synthase [Yersinia rohdei ATCC 43380]
          Length = 243

 Score =  254 bits (650), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 124/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    +  + +    +P    LVP+   ++T++ G D       +T  V
Sbjct: 63  --ETIQTRMNLEMAVTDEMVGIACELQPHFCCLVPEKRQEVTTEGGLDVAGQIDKMTIAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G  +SLF D +  +    AA   GA  IE++TG Y    ++  ++   L ++A 
Sbjct: 121 SRLSEAGILVSLFIDADMRQI--DAAVAVGAPYIEIHTGAYADASSDLARQ-AELVRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV   + 
Sbjct: 178 AATYAAGKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMTGLAAAVTDMKV 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|291279425|ref|YP_003496260.1| pyridoxine 5-phosphate synthase [Deferribacter desulfuricans SSM1]
 gi|290754127|dbj|BAI80504.1| pyridoxine 5-phosphate synthase [Deferribacter desulfuricans SSM1]
          Length = 242

 Score =  254 bits (650), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 78/248 (31%), Positives = 135/248 (54%), Gaps = 10/248 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +R  R    P+ V    +A   GA G+T+H R D+RHI+  DL  +R
Sbjct: 1   MIKLGVNVDHVATVRQARLSIEPDPVRAAVLAELGGADGITIHLREDRRHIQDRDLYLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++     K  LN+E   NE  +++  + KP+  TLVP+   +LT++ G D + N  L+ 
Sbjct: 61  DIV-----KTRLNLEMACNEEIIDIALKVKPDMCTLVPEKREELTTEGGLDVISNFELVK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
            TV++L + G  +S+F D +  +  L+ A  TGA  +EL+TG Y    +        L +
Sbjct: 116 DTVSKLRDEGIEVSIFIDPDEAQ--LEKAIYTGARFVELHTGAYADAKSE--NRLKELKR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L + A++A+ +   +NAGH L   N+ +++  I  + E+++GH+  A ++  G+KEAV  
Sbjct: 172 LKLAAKVAKNLGFIVNAGHGLDYYNVIDIV-KIKELYELNIGHSIIARSIYVGIKEAVKE 230

Query: 242 FRRACGQH 249
            +    +H
Sbjct: 231 MKDLICKH 238


>gi|296284259|ref|ZP_06862257.1| pyridoxine 5'-phosphate synthase [Citromicrobium bathyomarinum
           JL354]
          Length = 246

 Score =  254 bits (650), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 78/249 (31%), Positives = 121/249 (48%), Gaps = 10/249 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R    P+ V   +I    G  G+T H R D+RHIR  DL  I 
Sbjct: 8   KLRLGVNIDHVATIRNARGGDHPDPVRAAQIVAAVGGDGITAHLREDRRHIRDDDLRRI- 66

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
               +      LN+E    E  L +  R++P    +VP+   + T++ G D       L 
Sbjct: 67  ----QDATDLPLNLEMAATEEMLAIALRHQPHAACIVPEKREERTTEGGLDAAGLHNQLA 122

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V++L + G R+SLF + +  +  L+AA   GA  +E +TG Y        Q  I L +
Sbjct: 123 PIVSQLTDAGIRVSLFIEAHPAQ--LEAAMRLGAPVVEFHTGEYAHATGE--QRSIELKR 178

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A LA K  ++ +AGH LT  N+   I AIP I+E+++GH     A+  G++ A+  
Sbjct: 179 IADMAALAVKNGIEPHAGHGLTFDNVQP-IAAIPQIAELNIGHYLIGEAIFTGLEPAIRR 237

Query: 242 FRRACGQHL 250
            R    +  
Sbjct: 238 MRELMDEAR 246


>gi|262340807|ref|YP_003283662.1| pyridoxal phosphate biosynthetic protein [Blattabacterium sp.
           (Blattella germanica) str. Bge]
 gi|262272144|gb|ACY40052.1| pyridoxal phosphate biosynthetic protein [Blattabacterium sp.
           (Blattella germanica) str. Bge]
          Length = 249

 Score =  254 bits (649), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 96/251 (38%), Positives = 140/251 (55%), Gaps = 9/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVNLN +A LRN R    P+L+ +     + G  G+T+HPRPD+RHI Y D+ +I 
Sbjct: 1   MTKLSVNLNKIATLRNARGGDIPSLLQVAIDVQKFGCQGITIHPRPDERHITYQDVYDI- 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   K ELNIEG P + F+ L    KP+Q+TLVPD    +TS+ GW+ + +   LT
Sbjct: 60  ----HSVIKTELNIEGRPTDKFMELVLNVKPDQVTLVPDQDDAITSNSGWNTISHCNFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + + +L N G R S+F D   N   +  A  TGAD IELYTG +   Y   +     +N 
Sbjct: 116 QKIKKLKNHGIRTSIFLDP--NPKFVAYAAKTGADRIELYTGNFSIGYARKEWNS--INP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
              TA+ A    + +NAGHDL + NI  LI  IP ++E+S+GHA  + AL  G++  +  
Sbjct: 172 YIKTAKEAITHHMLVNAGHDLNLDNISFLIKKIPNLAEVSIGHALISEALYMGLENTIQS 231

Query: 242 FRRACGQHLDN 252
           + +   ++  N
Sbjct: 232 YLKRIHEYQRN 242


>gi|52841181|ref|YP_094980.1| pyridoxine 5'-phosphate synthase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52628292|gb|AAU27033.1| pyridoxal phosphate biosynthetic protein PdxJ [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 268

 Score =  254 bits (649), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 83/246 (33%), Positives = 134/246 (54%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +R  R   +P+ V     A ++GA G+T+H R D RHI+  D+  I+   
Sbjct: 27  LGVNIDHIATIRQARGTRYPDPVQAAMDAEEAGADGITLHMREDLRHIQARDVRLIK--- 83

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    E  L+  E   PE   LVP+   +LT++ G D L ++ ++ K V
Sbjct: 84  --QVLQTRMNLELAVTEAMLDFAEEISPEHACLVPEKREELTTEGGLDILTHRNVVEKAV 141

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +GS +SLF D +  +   +AA   GA  IEL+TG Y    +  +++   L ++  
Sbjct: 142 RRLQLMGSEVSLFIDPDKEQI--RAAVDVGAPVIELHTGCYADATSE-EKQHYELQRIKE 198

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A  ++L +NAGH L   N+   I AI  ++E+++GHA  A AL CG+KEAV   R+
Sbjct: 199 AAEFAASLNLVVNAGHGLHYHNVKP-IAAIRELNELNIGHAIIARALFCGLKEAVRHMRQ 257

Query: 245 ACGQHL 250
              +  
Sbjct: 258 LMQEAR 263


>gi|224825227|ref|ZP_03698333.1| pyridoxal phosphate biosynthetic protein PdxJ [Lutiella nitroferrum
           2002]
 gi|224602898|gb|EEG09075.1| pyridoxal phosphate biosynthetic protein PdxJ [Lutiella nitroferrum
           2002]
          Length = 245

 Score =  254 bits (649), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 75/252 (29%), Positives = 125/252 (49%), Gaps = 9/252 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR  R   +P+ +    +A  +GA  +T+H R D+RHI+  D+  +R
Sbjct: 1   MILLGVNIDHVATLRQARGTRYPSPIEAALVAETAGADLITLHLREDRRHIQDADVVAMR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  K  +N+E    E  L      KPE + LVP+   ++T++ G D +++   + 
Sbjct: 61  -----QVIKTRMNLEMALTEEMLANALAVKPEDVCLVPEKREEITTEGGLDVIRHFDQVR 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
                L   G R+SLF D +  +   +AA+  GA  IEL+TG Y    +   +    L +
Sbjct: 116 DYTLALTEAGIRVSLFIDPDNQQI--EAARDAGARVIELHTGAYADAVH-QAERERELAR 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A  A  +D  +NAGH L+  N+ + + AI  I+E+++GHA  + AL  G  EAV  
Sbjct: 173 VREAAVFAAHLDFVVNAGHGLSYHNVKS-VAAIAEIAELNIGHAIVSQALFVGFPEAVRS 231

Query: 242 FRRACGQHLDNT 253
            +    +   + 
Sbjct: 232 MKALMIEGRRDA 243


>gi|116073012|ref|ZP_01470274.1| pyridoxal phosphate biosynthetic protein [Synechococcus sp. RS9916]
 gi|116068317|gb|EAU74069.1| pyridoxal phosphate biosynthetic protein [Synechococcus sp. RS9916]
          Length = 248

 Score =  254 bits (649), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 79/255 (30%), Positives = 127/255 (49%), Gaps = 10/255 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MASLGVNIDHIANVRQARQTVEPDPVTMCLLAELGGADGITVHLREDRRHIQDRDVELLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  ++ LN+E         +  R KP+ +TLVP+   ++T++ G D       LT
Sbjct: 61  -----QTVRSRLNLEMAATGEMQTIALRIKPDMVTLVPERREEVTTEGGLDVAGQIPSLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V  L   G  +SLF D    +  L+A + TGA  +EL+TG Y     +  ++   L +
Sbjct: 116 SMVQTLQGSGIPVSLFVDPELGQ--LKACQATGARWVELHTGTYAEASWD--EQPAELAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L      A+ + L++NAGH LT QN+   + AI  + E+++GH   A AL  G++ AV  
Sbjct: 172 LTEATAQARALGLRVNAGHGLTYQNVEP-VAAIEGMEELNIGHTIVARALAVGLQAAVQE 230

Query: 242 FRRACGQHLDNTMRL 256
            R        + +  
Sbjct: 231 MRTLVQNPRRDPLFG 245


>gi|84500565|ref|ZP_00998814.1| pyridoxal phosphate biosynthetic protein [Oceanicola batsensis
           HTCC2597]
 gi|84391518|gb|EAQ03850.1| pyridoxal phosphate biosynthetic protein [Oceanicola batsensis
           HTCC2597]
          Length = 249

 Score =  254 bits (649), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 67/249 (26%), Positives = 120/249 (48%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R   +P+ +   K+A ++GA G+T H R D+RHI   D+  +   
Sbjct: 7   RLGVNIDHVATVRNARGGAYPDPLRAAKLAQEAGADGITAHLREDRRHISDADIEGLMAT 66

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +        LN E    +    +  R++P  + +VP+   + T++ G +  + +  L   
Sbjct: 67  LS-----LPLNFEMAATDEMQAIALRHRPHAVCIVPERREERTTEGGLEVAREENRLAHF 121

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFLNK 181
           +A L   G R+S+F     +   ++AA   GA  IEL+TG Y   +     ++    L +
Sbjct: 122 IAPLREAGCRVSIFIAA--DSKQIEAAHRIGAQVIELHTGAYCDAHAEERFEERDAELAR 179

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   A  A  + L+++AGH LT   +   + A+P + E+++GH     A+  G+  A+  
Sbjct: 180 LTEMATFAHSLGLEVHAGHGLTYDTVQP-VAALPEVRELNIGHFLVGEAIFRGLDPAIRE 238

Query: 242 FRRACGQHL 250
            RR      
Sbjct: 239 MRRLMDDAR 247


>gi|238796738|ref|ZP_04640244.1| Pyridoxine 5'-phosphate synthase [Yersinia mollaretii ATCC 43969]
 gi|238719469|gb|EEQ11279.1| Pyridoxine 5'-phosphate synthase [Yersinia mollaretii ATCC 43969]
          Length = 243

 Score =  254 bits (649), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 122/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ +    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPIQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  + +    +P    LVP+   ++T++ G D       +T  V
Sbjct: 63  --QTIQTRMNLEMAVTDEMVGIACELQPHFCCLVPEKRQEVTTEGGLDVAGQIDKMTIAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G  +SLF D +  +    AA   GA  IE++TG Y     +  ++   L ++  
Sbjct: 121 SRLAEAGILVSLFIDADMRQI--DAAVTVGAPYIEIHTGAYADAITDLARQ-AELVRITK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P I E+++GHA    A+  G+  AV   + 
Sbjct: 178 AATYAASKGLKVNAGHGLTYHNVQP-IAALPEIQELNIGHAIIGQAVMTGLAAAVGDMKV 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|170076728|ref|YP_001733366.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. PCC 7002]
 gi|169884397|gb|ACA98110.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           PCC 7002]
          Length = 246

 Score =  254 bits (649), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 77/242 (31%), Positives = 127/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R   
Sbjct: 10  LGVNIDHVATIRQARRTVEPDPVAAATLAELGGADGITVHLREDRRHIQDRDVKILR--- 66

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  ++ LN+E  P    + +    KP+ +TLVP+   ++T++ G D + N A   + V
Sbjct: 67  --QTVQSHLNLEMAPTAEMVAIALDIKPDYVTLVPEKREEITTEGGIDIVGNFARFEEVV 124

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G  +S F D    +   +AA+ TGA  IEL+TG Y     +  Q++  L  L  
Sbjct: 125 DQLQGAGIPVSWFIDAELEQI--EAAQKTGAQFIELHTGKYAEA-QDSDQQQAELATLKT 181

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A  + L++NAGH LT +N+   +  I  + E+++GH   + A+  G++ AV   + 
Sbjct: 182 GAKQAIALGLRVNAGHGLTYRNV-YPVACIEGMEELNIGHTIISRAVLVGLERAVREMKL 240

Query: 245 AC 246
           A 
Sbjct: 241 AM 242


>gi|218893284|ref|YP_002442153.1| pyridoxine 5'-phosphate synthase [Pseudomonas aeruginosa LESB58]
 gi|226694870|sp|B7UYW9|PDXJ_PSEA8 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|218773512|emb|CAW29324.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa LESB58]
          Length = 248

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 76/244 (31%), Positives = 124/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVRVLK- 65

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  +  +N E    E  L   E  +P    LVP+   +LT++ G D    +  +  
Sbjct: 66  ----EVLQTRMNFEMGVTEEMLAFAEEIRPAHSCLVPERREELTTEGGLDVAGQEQRIRD 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +GS +SLF D +  +   +A+   GA  IEL+TG Y     +P+++   L ++
Sbjct: 122 AVRRLAAVGSEVSLFIDPDPRQI--EASARVGAPAIELHTGRYADA-EDPEEQTRELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
                L + + L +NAGH L   N+   + AI  I+E+++GHA  A AL  G ++AV   
Sbjct: 179 REGVALGRSLGLIVNAGHGLHYHNVEP-VAAIDGINELNIGHAIVAHALFVGFRQAVAEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALM 241


>gi|89070104|ref|ZP_01157434.1| pyridoxal phosphate biosynthetic protein PdxJ [Oceanicola
           granulosus HTCC2516]
 gi|89044325|gb|EAR50468.1| pyridoxal phosphate biosynthetic protein PdxJ [Oceanicola
           granulosus HTCC2516]
          Length = 246

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 70/252 (27%), Positives = 124/252 (49%), Gaps = 10/252 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R   +P+ V   ++A ++GA G+T H R D+RHI   D+  + 
Sbjct: 3   KLRLGVNIDHVATVRNARGSAYPDPVRAARLAEEAGADGITAHLREDRRHISDRDIDALM 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +     LN E         +  R++P  + +VP+   + T++ G +  ++Q  LT
Sbjct: 63  -----EALTLPLNFEMAATPEMQAIALRHRPHAVCIVPERREERTTEGGLEVARDQNRLT 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFL 179
           + +A L + G R+S+F   +  +   +AA   GA  +EL+TG Y   +      +    L
Sbjct: 118 QFIAPLADAGCRVSIFIAADRPQI--EAAHRIGAAVVELHTGRYCDLHAEGRFDERDEEL 175

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            +L   A+LA  + L+++AGH LT   +   + AIP + E+++GH     A+  G+  A+
Sbjct: 176 ARLVDMARLADSLGLEVHAGHGLTYDTVAP-VAAIPELRELNIGHFLVGEAIFLGLGPAI 234

Query: 240 FCFRRACGQHLD 251
              RR       
Sbjct: 235 HEMRRRMDAARQ 246


>gi|123441366|ref|YP_001005353.1| pyridoxine 5'-phosphate synthase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122088327|emb|CAL11118.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 243

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 123/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    +  + +     P    LVP+   ++T++ G D       +T  V
Sbjct: 63  --ETIQTRMNLEMAVTDEMVGIACEINPHFCCLVPEKRQEVTTEGGLDVAGQIDKMTVAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G  +SLF D +  +    AA   GA  IE++TG Y    ++  ++   L ++A 
Sbjct: 121 SRLAKAGILVSLFIDADMRQI--DAAVAVGAPYIEIHTGAYADATSDLARQ-AELVRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV   + 
Sbjct: 178 AATYAASKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMSGLAAAVTDMKV 236

Query: 245 ACGQHLD 251
              +   
Sbjct: 237 LMREARR 243


>gi|87124717|ref|ZP_01080565.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           RS9917]
 gi|86167596|gb|EAQ68855.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           RS9917]
          Length = 249

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 81/258 (31%), Positives = 133/258 (51%), Gaps = 10/258 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MASLGVNIDHIANVRQARRTVEPDPVSYALLAELGGADGITVHLREDRRHIQDRDVDLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  ++ LN+E         +  R +P+ +TLVP+   ++T++ G D       L 
Sbjct: 61  -----QTVRSRLNLEMAATTEMEAIALRIRPDMVTLVPEKREEVTTEGGLDVAGQVEPLQ 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V RL + G  +SLF D +  +  LQA + TGA  +EL+TG Y         + + L +
Sbjct: 116 RLVGRLQDAGIGVSLFVDADARQ--LQACRTTGARWVELHTGRYAEAA--WPDQPLELAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   + +A+ +DL++NAGH LT QN+   + AI  + E+++GH   A AL  G++ AV  
Sbjct: 172 LIEGSAIARNLDLRVNAGHGLTYQNV-EAVAAIEGMEELNIGHTIVARALAVGLQSAVSE 230

Query: 242 FRRACGQHLDNTMRLTHP 259
            +R         +  + P
Sbjct: 231 MKRLVQNPRREPLFGSTP 248


>gi|256819878|ref|YP_003141157.1| pyridoxine 5'-phosphate synthase [Capnocytophaga ochracea DSM 7271]
 gi|256581461|gb|ACU92596.1| pyridoxal phosphate biosynthetic protein PdxJ [Capnocytophaga
           ochracea DSM 7271]
          Length = 238

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 92/242 (38%), Positives = 136/242 (56%), Gaps = 9/242 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P+L+ + K   Q GA G+T+HPRPD+RHIRY D  ++ 
Sbjct: 1   MTKLSVNINKIATLRNARGGNIPDLLQVAKDVQQFGAEGITIHPRPDERHIRYQDAFDL- 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    E NIEG P   F++L  + KP Q+TLVPD    +TS+ GWD +++++ LT
Sbjct: 60  ----LKVVTTEYNIEGNPIPKFIDLVLQVKPTQVTLVPDAEDAITSNAGWDTVKHKSFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V      G R SLF D      +  A+  TGAD +ELYT  Y       + ++  +  
Sbjct: 116 EVVTEFKRNGIRTSLFVDPVEAMVT--ASATTGADRVELYTERY--AREYARGDKTQIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A  AQK+ L +NAGHDL++ N+    + IP +SE+S+GHA    AL  G++  +  
Sbjct: 172 YIKAALEAQKVGLGLNAGHDLSLDNVKYFKDNIPNLSEVSIGHALICEALYLGLENVIQL 231

Query: 242 FR 243
           + 
Sbjct: 232 YL 233


>gi|260063798|ref|YP_003196878.1| pyridoxine 5'-phosphate synthase [Robiginitalea biformata HTCC2501]
 gi|88783243|gb|EAR14416.1| pyridoxal phosphate biosynthetic protein [Robiginitalea biformata
           HTCC2501]
          Length = 237

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 85/242 (35%), Positives = 133/242 (54%), Gaps = 9/242 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              +SVN+N +A LRN R    P+L+   +     GA G+T+HPRPD+RHIRY D  +++
Sbjct: 1   MVRLSVNVNKIATLRNARGGNVPDLLQAVRDIEVFGAQGITIHPRPDERHIRYRDARDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++       ELNIEG P   F++L     P+Q+TLVPD P  +TS+ GWD ++++  L 
Sbjct: 61  SVV-----GTELNIEGNPIPAFVDLVLEVAPDQVTLVPDAPDAITSNAGWDTVRHRDFLQ 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + + +  + G R S+F D +      +AA  TG D IELYT  Y    +        +  
Sbjct: 116 EVIGKFRDAGIRTSIFVDPDPQ--MARAAAETGTDRIELYTESY--ATHYGTDPEAAVKP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
              TA+ A  + L +NAGHDL + NI      +P++ E+S+GHA    +L  G++  +  
Sbjct: 172 FRETAEAAASVGLGVNAGHDLNLDNIAFFARQVPHLLEVSIGHALICESLYLGLENVIGM 231

Query: 242 FR 243
           ++
Sbjct: 232 YK 233


>gi|90412089|ref|ZP_01220096.1| pyridoxal phosphate biosynthetic protein [Photobacterium profundum
           3TCK]
 gi|90327067|gb|EAS43446.1| pyridoxal phosphate biosynthetic protein [Photobacterium profundum
           3TCK]
          Length = 243

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 72/249 (28%), Positives = 125/249 (50%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ VH  ++A ++GA G+TVH R D+RHI   D+  ++ 
Sbjct: 4   ILLGVNIDHIATLRNARGTRYPDPVHAAEVAERAGADGITVHLREDRRHINDRDVRILK- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  +  +N+E    +  +++    KPE + LVP+   +LT++ G D       +  
Sbjct: 63  ----ETIQTRMNLEMAVTDEMVSIALDTKPEFVCLVPEKREELTTEGGLDVAGQLEKIKA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L   G ++SLF D +  +    A    GA  +EL+TG Y        Q+   L+K+
Sbjct: 119 ATQKLTAAGIKVSLFIDADRAQI--DATLACGAPFVELHTGHYADAETEEAQQ-AELDKI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A  A  + +++NAGH LT  N+   I A+P + E+++GH+    A   G+ +AV   
Sbjct: 176 ASAATYAHGLGIKVNAGHGLTYHNVKP-IAALPELYELNIGHSIIGRAAFDGLNKAVADM 234

Query: 243 RRACGQHLD 251
           +        
Sbjct: 235 KVEVLDARR 243


>gi|146341380|ref|YP_001206428.1| pyridoxine 5'-phosphate synthase [Bradyrhizobium sp. ORS278]
 gi|166219084|sp|A4YWD1|PDXJ_BRASO RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|146194186|emb|CAL78207.1| pyridoxal phosphate biosynthetic protein PdxJ (PNP synthase)
           [Bradyrhizobium sp. ORS278]
          Length = 256

 Score =  253 bits (647), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 72/254 (28%), Positives = 117/254 (46%), Gaps = 10/254 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ +A LRN R    P+ V    +A+++GA G+T H R D+RHIR  D+  ++
Sbjct: 6   KLRLGVNVDHIATLRNARGGRAPDPVRAALLAIEAGADGITAHLREDRRHIRDDDMARLK 65

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I        LN E    E  + +    KP    LVP+   +LT++ G D +     L 
Sbjct: 66  AQISR-----PLNFEMAATEEMVRIALATKPHACCLVPERREELTTEGGLDVVGQHNALA 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFL 179
             +ARL   G R+SLF   +  +   + A    A  IE++TG +     +    +     
Sbjct: 121 PAIARLSEAGIRVSLFIAADPAQI--EMAARLRAPVIEIHTGGWCDAITDGHHDKADAEW 178

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++   A+ A    L+++AGH L        I A+P I E+++G+     AL  G+ E+V
Sbjct: 179 QRIVAGARQAYAAGLEVHAGHGLDYAT-AEQIAALPEIRELNIGYFIMGEALFVGLAESV 237

Query: 240 FCFRRACGQHLDNT 253
              R A  +  D  
Sbjct: 238 RTMRAAMDRGRDRA 251


>gi|94311351|ref|YP_584561.1| pyridoxine 5'-phosphate synthase [Cupriavidus metallidurans CH34]
 gi|229485648|sp|Q1LKN4|PDXJ_RALME RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|93355203|gb|ABF09292.1| pyridoxine 5'-phosphate synthase [Cupriavidus metallidurans CH34]
          Length = 260

 Score =  253 bits (647), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 72/252 (28%), Positives = 125/252 (49%), Gaps = 9/252 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ +     A ++GA  +T+H R D+RHIR  D+  +R 
Sbjct: 10  IDLGVNIDHVATLRNARGTVYPDPIQAALQAEEAGADLITLHLREDRRHIRDADVRALRP 69

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +        +N+E       L++    KP+ + LVP+   ++T++ G D   +   ++ 
Sbjct: 70  KLA-----TRMNLECAITSEMLDIACEIKPQDVCLVPEKREEVTTEGGLDVAGHFEQVSA 124

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L + G R+SLF D + ++ +  AA    A  IE++TG Y    +  +++     ++
Sbjct: 125 ACRQLADAGIRVSLFIDADPDQIAAAAACK--APVIEIHTGRYADA-HTAEEQAAEFRRV 181

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A   +  QK  L +NAGH L   N+   I A+P I E+++GHA  A A+  G + AV   
Sbjct: 182 AAGVEAGQKHGLIVNAGHGLHYTNVQP-IAALPGIKELNIGHAIVAHAVFAGWQNAVREM 240

Query: 243 RRACGQHLDNTM 254
           +         T 
Sbjct: 241 KAIMVAARLGTR 252


>gi|15595970|ref|NP_249464.1| pyridoxine 5'-phosphate synthase [Pseudomonas aeruginosa PAO1]
 gi|116048689|ref|YP_792511.1| pyridoxine 5'-phosphate synthase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|254239135|ref|ZP_04932458.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa C3719]
 gi|254245028|ref|ZP_04938350.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa 2192]
 gi|296390877|ref|ZP_06880352.1| pyridoxine 5'-phosphate synthase [Pseudomonas aeruginosa PAb1]
 gi|20139189|sp|Q9I5G5|PDXJ_PSEAE RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|122257795|sp|Q02HS5|PDXJ_PSEAB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|9946662|gb|AAG04162.1|AE004512_5 pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa PAO1]
 gi|115583910|gb|ABJ09925.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|126171066|gb|EAZ56577.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa C3719]
 gi|126198406|gb|EAZ62469.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa 2192]
          Length = 248

 Score =  253 bits (647), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 76/244 (31%), Positives = 124/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVRVLK- 65

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  +  +N E    E  L   E  +P    LVP+   +LT++ G D    +  +  
Sbjct: 66  ----EVLQTRMNFEMGVTEEMLAFAEEIRPAHSCLVPERREELTTEGGLDVAGQEQRIRD 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +GS +SLF D +  +   +A+   GA  IEL+TG Y     +P+++   L ++
Sbjct: 122 AVRRLAAVGSEVSLFIDPDPRQI--EASARVGAPAIELHTGRYADA-EDPEEQARELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
                L + + L +NAGH L   N+   + AI  I+E+++GHA  A AL  G ++AV   
Sbjct: 179 REGVALGRSLGLIVNAGHGLHYHNVEP-VAAIDGINELNIGHAIVAHALFVGFRQAVAEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALM 241


>gi|313105595|ref|ZP_07791861.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa 39016]
 gi|310878363|gb|EFQ36957.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa 39016]
          Length = 248

 Score =  253 bits (647), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 76/244 (31%), Positives = 124/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVRVLK- 65

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  +  +N E    E  L   E  +P    LVP+   +LT++ G D    +  +  
Sbjct: 66  ----EVLQTRMNFEMGGTEEMLAFAEEIRPAHSCLVPERREELTTEGGLDVAGQEQRIRD 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +GS +SLF D +  +   +A+   GA  IEL+TG Y     +P+++   L ++
Sbjct: 122 AVRRLAAVGSEVSLFIDPDPRQI--EASARVGAPAIELHTGRYADA-EDPEEQARELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
                L + + L +NAGH L   N+   + AI  I+E+++GHA  A AL  G ++AV   
Sbjct: 179 REGVALGRSLGLIVNAGHGLHYHNVEP-VAAIDGINELNIGHAIVAHALFVGFRQAVAEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALM 241


>gi|91216693|ref|ZP_01253658.1| pyridoxal phosphate biosynthetic protein [Psychroflexus torquis
           ATCC 700755]
 gi|91185162|gb|EAS71540.1| pyridoxal phosphate biosynthetic protein [Psychroflexus torquis
           ATCC 700755]
          Length = 237

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 92/243 (37%), Positives = 134/243 (55%), Gaps = 9/243 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              +SVN+N +A LRN R    PN+V   K     GA G+TVHPRPD+RHIRY D+ E+ 
Sbjct: 1   MIRLSVNINKIATLRNARGGDTPNVVESAKNLESFGAQGITVHPRPDERHIRYADVNEL- 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  K E NIEG PN+ F+ L    KP Q+TLVPD    LTS+ GWD ++++  L 
Sbjct: 60  ----TKVIKTEFNIEGNPNQKFIALVLDAKPAQVTLVPDGEDVLTSNAGWDTIKHKDFLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + ++     G R S+F D +      Q A   GAD +EL+T  Y       + +   +  
Sbjct: 116 EVISEFKAHGIRTSVFVDPSLQMI--QGAAEVGADRVELFTEAY--AQGYIKDKEKAIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+ A+ + L INAGHDL+++NI      IP++ E+S+GHA  + AL  G++  V  
Sbjct: 172 YLKCAEEAKSLGLGINAGHDLSLENIEYFAQTIPFLDEVSIGHALISEALYDGLEVVVKS 231

Query: 242 FRR 244
           + +
Sbjct: 232 YLK 234


>gi|153869555|ref|ZP_01999130.1| Pyridoxal phosphate biosynthetic protein pdxJ [Beggiatoa sp. PS]
 gi|152073964|gb|EDN70875.1| Pyridoxal phosphate biosynthetic protein pdxJ [Beggiatoa sp. PS]
          Length = 255

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 77/249 (30%), Positives = 123/249 (49%), Gaps = 9/249 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA +R  R+  +P+ +    IA Q+GA  +T+H R D+RHI+  D+  ++
Sbjct: 12  SIRLGVNIDHVATIRQARDTRYPDPIQAAIIAEQAGADLITLHLREDRRHIQERDVLMLK 71

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++        +N+E    E  L   E+ +P  + LVP+   +LT++ G D    +  + 
Sbjct: 72  DVLV-----TRMNLEMAVTEDMLAFAEQIRPHDVCLVPERREELTTEGGLDVAGQEERIR 126

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           +   RL  +G R+SLF D       + AA   GA  IE++TG +     +     I   +
Sbjct: 127 EACQRLTAVGIRVSLFIDA--QLKQIDAAVRVGAPVIEIHTGHFADA-VDDNNCHIEYQR 183

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +        K  LQ+NAGH L   NI + I  IP I E+++GHA  A AL  G  EAV  
Sbjct: 184 ILTAVAHGYKAGLQVNAGHGLNYHNIAD-IALIPEIRELNIGHAIVARALFSGFAEAVRE 242

Query: 242 FRRACGQHL 250
            +R   +  
Sbjct: 243 MKRLMVKAR 251


>gi|78713000|gb|ABB50177.1| pyridoxine 5'-phosphate synthase [Prochlorococcus marinus str. MIT
           9312]
          Length = 339

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 70/245 (28%), Positives = 124/245 (50%), Gaps = 10/245 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ +A +R  R    P+ V    +A   GA  +TVH R D+RHI+  D+  ++
Sbjct: 102 MATLGVNIDHIANVRQARKTVEPDPVQFAFLAELGGADSITVHLREDRRHIQDRDVFLLK 161

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  K +LN+E    E  L + ++  P+ +TLVP+   ++T++ G D   N   L 
Sbjct: 162 -----ETIKTKLNLEMAATEEMLEIAKKTLPDYVTLVPEKREEVTTEGGLDLKSNAQYLK 216

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V  L +    +S F D  G + +   +K  G D IEL+TG Y     +  ++   L +
Sbjct: 217 NFVENLKHSNIEVSAFIDPLGEQINY--SKEIGFDFIELHTGKY--AELSGSEQYKELQR 272

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +  +  LA  + L +NAGH L   N+   I +I  ++E+++GH+  A AL  G++++V  
Sbjct: 273 IIESTHLANDLGLVVNAGHGLNYNNVKK-IASINNMNELNIGHSIVARALAIGLEKSVRE 331

Query: 242 FRRAC 246
            +   
Sbjct: 332 MKSLI 336


>gi|313675884|ref|YP_004053880.1| pyridoxine 5'-phosphate synthase [Marivirga tractuosa DSM 4126]
 gi|312942582|gb|ADR21772.1| pyridoxine 5'-phosphate synthase [Marivirga tractuosa DSM 4126]
          Length = 239

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 100/247 (40%), Positives = 149/247 (60%), Gaps = 9/247 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            TS+SVN+N +A LRN R    PN+V++ K   + GA G+T+HPRPD+RHI   D+ ++ 
Sbjct: 1   MTSLSVNINKIATLRNARGGENPNVVNVAKDCERFGAQGITIHPRPDERHITTKDVYDLA 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++       E NIEGYP+E FL L +   P Q TLVPD P  LTS+ GWD +++Q  L 
Sbjct: 61  PIVT-----TEFNIEGYPDERFLELVKNNNPAQATLVPDPPGVLTSNAGWDTVKHQDFLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             +++L N+G R S+F     +   ++AA   G D IELYT PY A Y   +++ +    
Sbjct: 116 DVISQLKNMGVRTSIFTG--TDLKHIEAAAKLGTDRIELYTEPYAANYAKDREKAVEPFV 173

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           LA  A+ AQ++ L INAGHDL+++N+  L   IP++ E+S+GHA    AL  G++  +  
Sbjct: 174 LA--AKKAQEVGLGINAGHDLSLENLKFLKEKIPFLDEVSIGHALICDALYFGLENTIQL 231

Query: 242 FRRACGQ 248
           + R   +
Sbjct: 232 YLRELRE 238


>gi|163740173|ref|ZP_02147567.1| pyridoxal phosphate biosynthetic protein [Phaeobacter gallaeciensis
           2.10]
 gi|161386031|gb|EDQ10406.1| pyridoxal phosphate biosynthetic protein [Phaeobacter gallaeciensis
           2.10]
          Length = 253

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 69/249 (27%), Positives = 120/249 (48%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R    P+ V   K+A ++GA G+T H R D+RHI   D+  +   
Sbjct: 12  RLGVNIDHVATVRNARGGLAPDPVRAAKLAEEAGADGITAHLREDRRHITDADIDRLMDA 71

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +        LN E    E    +  R+KP  + +VP+   + T++ G +  + +  L   
Sbjct: 72  L-----NVPLNFEMAATEEMQKIALRHKPHAVCIVPEKREERTTEGGLEVAREENKLAHY 126

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQQERIFLNK 181
           +A L + G R+S+F   +  +   +AA   GA+ IEL+TG Y   +   +  +    L  
Sbjct: 127 IAPLRDAGCRVSIFIAADQRQI--EAAHRIGAEVIELHTGAYCDAHAEGDFAKRDAELAA 184

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   +  A  + L+++AGH LT   +   + A P + E+++GH     A+  G+  A+  
Sbjct: 185 LREMSSFAHSLGLEVHAGHGLTYDCVQP-VAAFPEVRELNIGHFLIGEAIFRGLTPAIAE 243

Query: 242 FRRACGQHL 250
            RR   +  
Sbjct: 244 MRRLMDEVR 252


>gi|149374706|ref|ZP_01892480.1| pyridoxal phosphate biosynthetic protein PdxJ [Marinobacter
           algicola DG893]
 gi|149361409|gb|EDM49859.1| pyridoxal phosphate biosynthetic protein PdxJ [Marinobacter
           algicola DG893]
          Length = 244

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 81/252 (32%), Positives = 128/252 (50%), Gaps = 11/252 (4%)

Query: 1   MSTS--VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLP 58
           M     + VN++ VA LR  R   +P+ V    +A ++GA G+T+HPR D+RHI+  D+ 
Sbjct: 1   MKPRVLLGVNIDHVATLRQARGTRYPDPVQAAILAEEAGADGITIHPREDRRHIQDRDVL 60

Query: 59  EIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQA 118
            ++     +    ++N+E    +  L   E+ +PE + LVP+   +LT++ G D    +A
Sbjct: 61  LLK-----EILTTKMNLEMAVTDAMLAFAEQVRPECVCLVPEKREELTTEGGLDVEGQEA 115

Query: 119 LLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF 178
            + K   RL  +G+ +SLF D +  +    AA   GA  +EL+TG Y     +PQ     
Sbjct: 116 RVAKACDRLAKIGAEVSLFIDPDVAQI--DAAVRCGAPVVELHTGEYAEA-TDPQIVEGA 172

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
            N L      A+K  L +NAGH L   N    + AI  I+E+++GHA  A A+  G+KEA
Sbjct: 173 FNTLQEAVTYARKKGLVVNAGHGLHYHN-TERVAAIAGINELNIGHAIIARAVFTGLKEA 231

Query: 239 VFCFRRACGQHL 250
           V   +       
Sbjct: 232 VKDMKAILESAR 243


>gi|86749727|ref|YP_486223.1| pyridoxine 5'-phosphate synthase [Rhodopseudomonas palustris HaA2]
 gi|123004149|sp|Q2IWU8|PDXJ_RHOP2 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|86572755|gb|ABD07312.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodopseudomonas
           palustris HaA2]
          Length = 254

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 71/255 (27%), Positives = 120/255 (47%), Gaps = 10/255 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ +A +RN R    P+ V     A+++GA G+T H R D+RHIR  D+  ++
Sbjct: 6   PLRLGVNIDHIATVRNARGGRHPDPVRAALTAIEAGADGITAHLREDRRHIRDNDMERLK 65

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I +      LN E       + +    KP  + LVP+   +LT++ G D +  +  L 
Sbjct: 66  AEISK-----PLNFEMAATPDMVRIALGVKPHAVCLVPERREELTTEGGLDVVGQRDSLA 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ--QERIFL 179
            ++AR ++ G R+SLF   +  +   + A    A  IEL+TG +     + +  +     
Sbjct: 121 PSIARFNDAGIRVSLFIAADPAQI--EMAAKLKAPAIELHTGAWCDAITDDEPAKVAEEW 178

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++   A LAQ   L+++AGH L        I A+P I E+++G      AL  G+ E V
Sbjct: 179 RRIVAGAALAQSAGLEVHAGHGLDYAT-AETIAALPQIVELNIGFYMIGEALFVGLGETV 237

Query: 240 FCFRRACGQHLDNTM 254
              R A  +     +
Sbjct: 238 KAMRSAMDRGRARVI 252


>gi|198283252|ref|YP_002219573.1| pyridoxine 5'-phosphate synthase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667027|ref|YP_002425835.1| pyridoxal phosphate biosynthetic protein PdxJ [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|226694865|sp|B7J9K4|PDXJ_ACIF2 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|226700968|sp|B5EQL6|PDXJ_ACIF5 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|198247773|gb|ACH83366.1| pyridoxal phosphate biosynthetic protein PdxJ [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218519240|gb|ACK79826.1| pyridoxal phosphate biosynthetic protein PdxJ [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 241

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 80/249 (32%), Positives = 122/249 (48%), Gaps = 9/249 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ VA LR  R   +P+ V    +A ++GA  +T H R D+RHI   D+  + 
Sbjct: 1   MIALGVNIDHVATLRQARGTRYPDPVEAAFVAERAGADAITAHLREDRRHIVERDVEILS 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  +  LN+E    E  L + ER  P    LVP+   +LT++ G D     + + 
Sbjct: 61  -----QTLRTRLNLEMAVEEGVLRVAERLSPSDCCLVPERRAELTTEGGLDVAGQLSRIK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           +   RL     R+SLF D   +   L+AA  TGA  +EL+TG Y     +       L +
Sbjct: 116 EACQRLAAAKVRVSLFVDP--DPFQLEAAMETGAPVVELHTGRYAN-TADTATRAEELGQ 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A  A  + LQ+NAGH L   N+   + AIPYI E+++GHA  A A+  G+  AV  
Sbjct: 173 ITSAASFADSLGLQVNAGHGLDYHNVQA-VAAIPYIRELNIGHAIVAHAVFVGMATAVAD 231

Query: 242 FRRACGQHL 250
            +R   +  
Sbjct: 232 MKRLMLEAR 240


>gi|238920902|ref|YP_002934417.1| pyridoxine 5'-phosphate synthase [Edwardsiella ictaluri 93-146]
 gi|238870471|gb|ACR70182.1| pyridoxine 5'-phosphate synthase, putative [Edwardsiella ictaluri
           93-146]
          Length = 243

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 76/249 (30%), Positives = 123/249 (49%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R 
Sbjct: 4   ILLGVNIDHIATLRNARGTQYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVQLLR- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               Q  +  +N+E    E  + +    +P    LVP+   ++T++ G D    +  +  
Sbjct: 63  ----QTIQTRMNLEMAVTEEMVAIACELRPHFCCLVPEKRQEVTTEGGLDVAGQRDKIAA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VARL   G ++SLF D +  +   +AA   GA  IE++TG Y    +   Q    L ++
Sbjct: 119 AVARLSAAGIQVSLFIDPDERQI--EAAVAVGAPYIEIHTGAYADAPSALAQA-AELERI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A  A    L++NAGH LT  N+   + A+P + E+++GH+    A   G+  AV   
Sbjct: 176 AAAACFAHARGLKVNAGHGLTYHNVQA-VAALPQMHELNIGHSIIGRAALDGLNLAVRDM 234

Query: 243 RRACGQHLD 251
           +R       
Sbjct: 235 KRLLLDARR 243


>gi|99082403|ref|YP_614557.1| pyridoxine 5'-phosphate synthase [Ruegeria sp. TM1040]
 gi|99038683|gb|ABF65295.1| pyridoxal phosphate biosynthetic protein PdxJ [Ruegeria sp. TM1040]
          Length = 252

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 75/258 (29%), Positives = 126/258 (48%), Gaps = 13/258 (5%)

Query: 1   MST---SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDL 57
           MST    + VN++ VA +RN R   +P+ +   K+A ++GA G+T H R D+RHI   D+
Sbjct: 1   MSTNTLRLGVNIDHVATVRNARGGAYPDPIRAAKLAEEAGADGITAHLREDRRHIVDADI 60

Query: 58  PEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQ 117
             +   +        LN E    E    +  R+KP  + +VP+   + T++ G D ++++
Sbjct: 61  DGLMAALT-----VPLNFEMAATEEMQKIALRHKPHAVCIVPEKREERTTEGGLDVVRDE 115

Query: 118 ALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGA--CYNNPQQE 175
           + L   +A L   GSR+S+F     ++  ++AA   GA+ IEL+TG Y       +    
Sbjct: 116 SRLAACIAPLREAGSRVSIFIAA--DQKQIEAAHRIGAEVIELHTGAYCDHHAEGDFAAR 173

Query: 176 RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
              L  L   A  A  + L+++AGH LT + +   I A P + E+++GH     A+  G+
Sbjct: 174 DAELAALGEMATYAHSLGLEVHAGHGLTYETVAP-IAAFPEVRELNIGHFLIGEAIFRGL 232

Query: 236 KEAVFCFRRACGQHLDNT 253
             A+   RR         
Sbjct: 233 SPAIGEMRRLMDAARSGA 250


>gi|146299455|ref|YP_001194046.1| pyridoxal phosphate biosynthetic protein PdxJ [Flavobacterium
           johnsoniae UW101]
 gi|189036748|sp|A5FJ95|PDXJ_FLAJO RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|146153873|gb|ABQ04727.1| pyridoxal phosphate biosynthetic protein PdxJ [Flavobacterium
           johnsoniae UW101]
          Length = 237

 Score =  253 bits (645), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 133/246 (54%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P+L+ +     + G  G+T+HPRPD+RHIRY D  +++
Sbjct: 1   MTKLSVNINKIATLRNARGGNVPDLLKVAADIQRFGGQGITIHPRPDERHIRYQDARDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++       E NIEG P   F++L    KP+Q+TLVPD    +TS  GWD ++NQ  L 
Sbjct: 61  AIVT-----TEYNIEGNPQHNFIDLVLECKPDQVTLVPDAIGAITSSAGWDTIKNQEYLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +      G R S+F D       ++ AK TG D IELYT  +   +      +  ++ 
Sbjct: 116 EVIQEFQRNGIRTSIFVDPV--LEMIEGAKKTGTDRIELYTEAF--AHQYDLGNKNGIDP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+LA ++ L INAGHDL++ NI      IP + E+S+GHA  + AL  G+   V  
Sbjct: 172 YVKAAELANELGLGINAGHDLSLDNIQFFKQNIPGLLEVSIGHALISEALYLGLDNVVNM 231

Query: 242 FRRACG 247
           + +   
Sbjct: 232 YLKKLK 237


>gi|259417276|ref|ZP_05741195.1| pyridoxine 5'-phosphate synthase [Silicibacter sp. TrichCH4B]
 gi|259346182|gb|EEW57996.1| pyridoxine 5'-phosphate synthase [Silicibacter sp. TrichCH4B]
          Length = 252

 Score =  253 bits (645), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 70/249 (28%), Positives = 121/249 (48%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R   +P+ +   K+A ++GA G+T H R D+RHI   D+  +   
Sbjct: 7   RLGVNIDHVATVRNARGGAYPDPIRAAKLAEEAGADGITAHLREDRRHITDADIDGLM-- 64

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +     LN E    +    +  R+KP  + +VP+   + T++ G +  + +  L   
Sbjct: 65  ---EALSVPLNFEMAATDEMQKIALRHKPHAVCIVPEKREERTTEGGLEVAREENRLAHF 121

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGA--CYNNPQQERIFLNK 181
           +A L + G R+S+F     ++  ++AA   GA+ IEL+TG Y       N       L+ 
Sbjct: 122 IAPLRDAGCRVSIFIAA--DQKQIEAAHRIGAEVIELHTGAYCDHHAEGNFAARDRELDA 179

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   A  A  + L+++AGH LT + +   + A P + E+++GH     A+  G+  AV  
Sbjct: 180 LQDMATFAHSLGLEVHAGHGLTYETVAP-VAAFPEVMELNIGHFLIGEAIFRGLTPAVQE 238

Query: 242 FRRACGQHL 250
            RR      
Sbjct: 239 MRRLMDAAR 247


>gi|294084103|ref|YP_003550861.1| pyridoxal phosphate biosynthetic protein PdxJ [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663676|gb|ADE38777.1| pyridoxal phosphate biosynthetic protein PdxJ [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 253

 Score =  253 bits (645), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 118/247 (47%), Gaps = 11/247 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R    PN V    +A Q+GA G+T H R D+RHI   D+  I+  
Sbjct: 13  RLGVNIDHVATIRNARGGVHPNPVDAALLAEQAGADGITAHLREDRRHIHDDDIHAIKAA 72

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I        LN E   N   +++    +P    +VP+   ++T++ G   + N+  L   
Sbjct: 73  IT-----VPLNFEMAANSEMIDMALAVRPNAACIVPERREEVTTEGGLAVVGNEDRLGTL 127

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           +  L + G RISLF + +     + AA+  GAD IEL+TG Y    ++         ++ 
Sbjct: 128 LQPLKDAGIRISLFIEASEA--EIDAARSVGADIIELHTGRYC---HDDTNRNFEYTRIR 182

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A  A K  ++ +AGH LT   +   I AIP + E+++GH     ++  G+ EA+   R
Sbjct: 183 SAATYAVKQGIECHAGHGLTFDTVGA-IAAIPEMEELNIGHFLIGESIFLGLPEAIRRMR 241

Query: 244 RACGQHL 250
                  
Sbjct: 242 NLMDDAR 248


>gi|157413578|ref|YP_001484444.1| pyridoxine 5'-phosphate synthase [Prochlorococcus marinus str. MIT
           9215]
 gi|166980407|sp|A8G5H7|PDXJ_PROM2 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|157388153|gb|ABV50858.1| Pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. MIT 9215]
          Length = 238

 Score =  253 bits (645), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 72/245 (29%), Positives = 124/245 (50%), Gaps = 10/245 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ +A +R  R    P+ V    +A   GA  +TVH R D+RHI+  DL  ++
Sbjct: 1   MATLGVNIDHIANVRQARKTVEPDPVQFAFLAELGGADSITVHLREDRRHIQDRDLFLLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  K +LN+E    E  L + ++  P+ +TLVP+   ++T++ G D   N   L 
Sbjct: 61  -----ETIKTKLNLEMAATEEMLEIAKKILPDYVTLVPEKREEVTTEGGLDLKSNVQYLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           K V  L +    +S F D  G + +   +K  G D IEL+TG Y     +   +   L +
Sbjct: 116 KAVGNLQDSNIEVSAFIDPLGEQINY--SKEIGFDFIELHTGKY--AKLSGSDQYKELQR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +  +  LA  + L +NAGH L   N+   I +I  ++E+++GH+  A AL  G++++V  
Sbjct: 172 IIESTYLANDLGLVVNAGHGLNYNNVKK-IASINNMNELNIGHSIVARALAIGLEKSVRE 230

Query: 242 FRRAC 246
            +   
Sbjct: 231 MKSLI 235


>gi|85707972|ref|ZP_01039038.1| pyridoxal phosphate biosynthesis protein [Erythrobacter sp. NAP1]
 gi|85689506|gb|EAQ29509.1| pyridoxal phosphate biosynthesis protein [Erythrobacter sp. NAP1]
          Length = 247

 Score =  253 bits (645), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 77/251 (30%), Positives = 119/251 (47%), Gaps = 10/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R    P+ V   +I    G  G+T H R D+RHIR  DL  I 
Sbjct: 4   PLRLGVNIDHVATIRNARGGDHPDPVRAAEIVAAVGGDGITAHLREDRRHIRDEDLARI- 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
               +      LN+E    E  L +  R+KP    +VP+   + T++ G D       LT
Sbjct: 63  ----QDATDLPLNLEMAATEEMLEIALRHKPHAACIVPEKREERTTEGGLDAAGLHNTLT 118

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGAC--YNNPQQERIFL 179
             V RL + G R+SLF + +  +  L AA   G   +E +TG Y       + ++    L
Sbjct: 119 PIVYRLKDHGIRVSLFIEADERQ--LDAALKLGVPVVEFHTGEYAHAILDGDSERTAKEL 176

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++   A LA K  ++ +AGH LT  N+   I AIP I+E+++GH     A+  G++ A+
Sbjct: 177 RRITDIAALAAKNGIEPHAGHGLTFDNVQP-IAAIPQIAELNIGHYLIGEAIFAGLEPAI 235

Query: 240 FCFRRACGQHL 250
              R    +  
Sbjct: 236 RRMRDLMDEAR 246


>gi|300114889|ref|YP_003761464.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosococcus
           watsonii C-113]
 gi|299540826|gb|ADJ29143.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosococcus
           watsonii C-113]
          Length = 246

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 77/248 (31%), Positives = 131/248 (52%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ +     A Q+GA G+T+H R D+RHI+  D+  +R 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPIQAAIEAEQAGADGITLHLREDRRHIQERDVALLRD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +     +N+E       L + E+Y+PE   LVP+   +LT++ G D       +T+
Sbjct: 67  ILLSK-----MNLEMAVTGEMLAIAEQYRPEDCCLVPERREELTTEGGLDVAGQLGRITE 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              RL   G+R+SLF D +  +  ++AA    A  +E++TG +     + Q+ R    ++
Sbjct: 122 ACVRLKEAGTRVSLFIDADPRQ--VEAAAQARAPVVEIHTGHFADA-RDEQRRRKEFQRI 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               +  ++  LQ+NAGH L  QN+   I A+P I E+++GHA  A AL  G++ AV   
Sbjct: 179 VEAVKKGREAGLQVNAGHGLNYQNVAA-IAALPDIVELNIGHAIMARALFTGMQSAVGEM 237

Query: 243 RRACGQHL 250
           +R   +  
Sbjct: 238 KRLMREAR 245


>gi|113868514|ref|YP_727003.1| pyridoxine 5'-phosphate synthase [Ralstonia eutropha H16]
 gi|123329058|sp|Q0K8N6|PDXJ_RALEH RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|113527290|emb|CAJ93635.1| pyridoxal phosphate biosynthesis protein [Ralstonia eutropha H16]
          Length = 260

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 75/252 (29%), Positives = 125/252 (49%), Gaps = 9/252 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ +    +A Q+GA  +T+H R D+RHIR  D+  +R 
Sbjct: 10  IDLGVNIDHVATLRNARGTVYPDPIRAALLAEQAGADLITLHLREDRRHIRDADVRALRP 69

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +        +N+E    +  L++    +P+ + LVP+   ++T++ G D       +  
Sbjct: 70  QLA-----TRMNLECALTQEMLDIACEIRPQDVCLVPERREEVTTEGGLDVAGRFEQVKA 124

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
             A+L   G R+SLF D + ++ +  A    GA  IEL+TG Y    + P ++ +   ++
Sbjct: 125 ACAQLAGAGIRVSLFIDADADQIAAAA--ACGAPVIELHTGRYADA-HTPDEQALEFRRI 181

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A      QK  L +NAGH L   N+   I A+P I E+++GHA  A A+  G + AV   
Sbjct: 182 ADGVDAGQKHGLVVNAGHGLHYTNVQP-IAALPGIKELNIGHAIVAHAVFAGWENAVREM 240

Query: 243 RRACGQHLDNTM 254
           +         T 
Sbjct: 241 KAIMVAARLGTR 252


>gi|110678682|ref|YP_681689.1| pyridoxine 5'-phosphate synthase [Roseobacter denitrificans OCh
           114]
 gi|123172748|sp|Q16AJ0|PDXJ_ROSDO RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|109454798|gb|ABG31003.1| pyridoxal phosphate biosynthetic protein PdxJ [Roseobacter
           denitrificans OCh 114]
          Length = 249

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 69/251 (27%), Positives = 122/251 (48%), Gaps = 10/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R   +P+ +   +IA ++GA G+T H R D+RHI   D+  + 
Sbjct: 6   KLRLGVNIDHVATVRNARGGAYPDPLRAARIAEEAGADGITAHLREDRRHISDADIEGLM 65

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++        LN E    +    +  R+KP  + +VP+   + T++ G +  + + +L 
Sbjct: 66  DVLS-----VPLNFEMAATDEMQQIALRHKPHAVCIVPEKREERTTEGGLEVAREENVLA 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQQERIFL 179
             +A L   G R+S+F      +   +AA   GA+ IEL+TG Y   +   +  Q    L
Sbjct: 121 HFIAPLREAGCRVSIFIAAEQRQI--EAAHRIGAEVIELHTGAYCDAHAEGDFAQRDAEL 178

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            +L   A  A  + L+++AGH LT   +   I A P + E+++GH     ++  G++ A+
Sbjct: 179 ARLRDMATFAHGLGLEVHAGHGLTYDTVQP-IAAFPEVIELNIGHFLIGESIFRGLEPAI 237

Query: 240 FCFRRACGQHL 250
              RR      
Sbjct: 238 AEMRRLMDAAR 248


>gi|149200810|ref|ZP_01877785.1| pyridoxal phosphate biosynthetic protein [Roseovarius sp. TM1035]
 gi|149145143|gb|EDM33169.1| pyridoxal phosphate biosynthetic protein [Roseovarius sp. TM1035]
          Length = 249

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 65/251 (25%), Positives = 117/251 (46%), Gaps = 10/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R   +P+ +   +IA ++GA G+T H R D+RHI   D+  + 
Sbjct: 6   KLRLGVNIDHVATVRNARGGAYPDPLRAARIAQEAGADGITAHLREDRRHISDADIDGLM 65

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +     LN E    +    +  R+KP  + +VP+   + T++ G +  + +  L 
Sbjct: 66  -----EVLTVPLNFEMAATDEMQRIALRHKPHAVCIVPEKREERTTEGGLEVAREENRLA 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ--QERIFL 179
             +A L   G R+S+F   +  +   +AA   GA+ IEL+TG Y   +           L
Sbjct: 121 HFIAPLREAGCRVSIFIAADKRQI--EAAHRIGAEVIELHTGAYCDAHAEGHVDARDREL 178

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             L      A  + L+++AGH L  + +   + A P + E+++GH     ++  G+  A+
Sbjct: 179 ESLREMTAYAHSLGLEVHAGHGLNYETVKP-VAAFPEVMELNIGHFLIGESIFRGLGPAI 237

Query: 240 FCFRRACGQHL 250
              RR   +  
Sbjct: 238 AEMRRLMDEAR 248


>gi|119383176|ref|YP_914232.1| pyridoxal phosphate biosynthetic protein PdxJ [Paracoccus
           denitrificans PD1222]
 gi|119372943|gb|ABL68536.1| pyridoxine 5'-phosphate synthase [Paracoccus denitrificans PD1222]
          Length = 244

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 74/251 (29%), Positives = 121/251 (48%), Gaps = 10/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R  PWP+ V   K+A ++GA G+T H R D+RHI   D+  + 
Sbjct: 1   MLRLGVNIDHVATIRNARGTPWPDPVRAAKLAEEAGADGITAHLREDRRHISDGDIDRLM 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +     LN+E         +  R++P  + +VP+   + T++ G D   N+A L 
Sbjct: 61  -----ESLHLPLNLEMAATAEMQAIALRHRPHAVCIVPEKREERTTEGGLDVAGNEAFLA 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ--QERIFL 179
             +A L   G R+SLF      +  ++AA   GA  +EL+TG Y       +  +  + L
Sbjct: 116 DFIAPLREAGCRVSLFIG--HEQDQIEAAARIGAAVVELHTGAYCDFDTEGRLAERDLEL 173

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             L   A  A  + L+++AGH LT   +   I AI  + E+++GH   A ++  G+  A+
Sbjct: 174 EALRRGAAQAHLLGLEVHAGHGLTFDTVGP-IAAISELRELNIGHFLIAESVFLGLGPAI 232

Query: 240 FCFRRACGQHL 250
              RR      
Sbjct: 233 REMRRNMDAAR 243


>gi|126696552|ref|YP_001091438.1| pyridoxine 5'-phosphate synthase [Prochlorococcus marinus str. MIT
           9301]
 gi|126543595|gb|ABO17837.1| pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. MIT 9301]
          Length = 323

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 70/245 (28%), Positives = 124/245 (50%), Gaps = 10/245 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ +A +R  R    P+ V    +A   GA  +TVH R D+RHI+  D+  ++
Sbjct: 86  MATLGVNIDHIANVRQARKTVEPDPVQFAFLAELGGADSITVHLREDRRHIQDRDVFLLK 145

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  K +LN+E       L + ++  P+ +TLVP+   ++T++ G D   N   L 
Sbjct: 146 -----ETIKTKLNLEMAATGEMLEIAKKILPDYVTLVPEKREEVTTEGGLDLKSNMQYLK 200

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           K V  L +    +S F D  G + +   +K  G D IEL+TG Y     +  ++   L +
Sbjct: 201 KAVGNLKDSNIEVSAFIDPLGEQINY--SKEIGFDFIELHTGKY--AELSGSEQYKELQR 256

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +  +  LA  + L +NAGH L   N+   I +I  ++E+++GH+  A AL  G++++V  
Sbjct: 257 IIESTHLANDLGLVVNAGHGLNYNNVKK-IASINNMNELNIGHSIVARALAIGLEKSVRE 315

Query: 242 FRRAC 246
            +   
Sbjct: 316 MKSLI 320


>gi|114765712|ref|ZP_01444810.1| pyridoxal phosphate biosynthetic protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114541929|gb|EAU44964.1| pyridoxal phosphate biosynthetic protein [Roseovarius sp. HTCC2601]
          Length = 250

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 70/249 (28%), Positives = 119/249 (47%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R   +P  +   KIA ++GA G+T H R D+RHI   D+  +   
Sbjct: 9   RLGVNIDHVATVRNARGSAYPCPLRAAKIAEEAGADGITAHLREDRRHISDADIDGLM-- 66

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +     LN+E    E    +  R+KP  + +VP+   + T++ G +  +++  L   
Sbjct: 67  ---ETLSLPLNLEMAATEEMQAIALRHKPHAVCIVPEKREERTTEGGLEVAKDENRLAHF 123

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFLNK 181
           +  L   G R+SLF   +  +  + A+   GA  +EL+TG Y   +      +    L +
Sbjct: 124 IEPLRAAGCRLSLFIGADETQ--VAASARIGAAVVELHTGAYCDFHYEGKFAERDAELER 181

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   A  A  + L+++AGH LT + +   I  IP I E+++GH     AL  G+  ++  
Sbjct: 182 LREMAAYAHSLGLEVHAGHGLTYETVAP-IAQIPAIVELNIGHFLIGEALFRGLGPSIEE 240

Query: 242 FRRACGQHL 250
            RR      
Sbjct: 241 MRRLMDDAR 249


>gi|209695940|ref|YP_002263870.1| pyridoxine 5'-phosphate synthase [Aliivibrio salmonicida LFI1238]
 gi|208009893|emb|CAQ80206.1| pyridoxal phosphate biosynthetic protein PdxJ [Aliivibrio
           salmonicida LFI1238]
          Length = 243

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 78/250 (31%), Positives = 128/250 (51%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA+G+T+H R D+RHI+  D+  +R
Sbjct: 3   SILLGVNIDHVATLRNARGTKYPDPVHAAEIAERAGAAGITIHLREDRRHIKDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  +N+E    +  + +    +PE + LVP+   +LT++ G + +     + 
Sbjct: 63  -----ETLQTRMNLEMAVTDEMVGIALETQPEFVCLVPEKREELTTEGGLNVVGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
                L   G ++SLF D +  +    AA   GA  IEL+TG Y        ++ I L K
Sbjct: 118 AATQTLSKAGIKVSLFIDADNAQI--DAAVACGAPFIELHTGAYADAETEEAEQ-IELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A    L +NAGH LT  N+   I A+P I E+++GH+    A+  G+++AV  
Sbjct: 175 IAAGATYAASKGLIVNAGHGLTYHNV-EAIAALPEIYELNIGHSIMGRAVFDGLEKAVAD 233

Query: 242 FRRACGQHLD 251
             R       
Sbjct: 234 MHRIMLGARK 243


>gi|94271344|ref|ZP_01291941.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93450472|gb|EAT01646.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
          Length = 440

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 73/248 (29%), Positives = 127/248 (51%), Gaps = 9/248 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              +++N++ VA LR  R +  P+ V    I   +GA+G+ VH R D+RHI+  DL  ++
Sbjct: 198 MIQLAINVDHVATLRQARGINEPDPVLAAGICELAGAAGIVVHLREDRRHIQDRDLQLLK 257

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  K++LN+E   N   + +    +P+ +TLVP+   +LT++ G +    +  LT
Sbjct: 258 -----QTVKSKLNLEMGANPEIIAIALELQPDMVTLVPEKRRELTTEGGLNVKGGRKKLT 312

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             + +    G  +SLF D +  +   +AA   GA  +E++TG Y    +   ++ +    
Sbjct: 313 GVIEQFRQKGIPVSLFIDPDARQI--EAAAAIGATFVEIHTGRYCDATSE-AEQELEFAL 369

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A +A +  L++NAGH L  +N    I A+  I E+S+GHA  A A+  G++ AV  
Sbjct: 370 VAEAADIAWQAGLRVNAGHGLNYRNTGR-IAALENIEELSIGHAIMARAILVGLERAVRE 428

Query: 242 FRRACGQH 249
                 + 
Sbjct: 429 MLAIIREA 436


>gi|254512392|ref|ZP_05124459.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodobacteraceae
           bacterium KLH11]
 gi|221536103|gb|EEE39091.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodobacteraceae
           bacterium KLH11]
          Length = 248

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 68/249 (27%), Positives = 119/249 (47%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R   +P+ +   K+A ++GA G+T H R D+RHI   D+  +   
Sbjct: 7   RLGVNIDHVATIRNARGGAYPDPIRAAKLAEEAGADGITAHLREDRRHILDADIDGLM-- 64

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +     LN E    +    +  R+KP  + +VP+   + T++ G +  + +  L   
Sbjct: 65  ---EALTVPLNFEMAATDEMQKIALRHKPHAVCIVPEKREERTTEGGLEVAREENKLAHF 121

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNP--QQERIFLNK 181
           +A L ++G R+S+F   +  +    AA   GA+ IEL+TG Y   +           L  
Sbjct: 122 IAPLRDVGCRVSIFIAADQRQI--DAAHRIGAEVIELHTGAYCDFHAEGKLDAAARELEA 179

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   +  A  + L+++AGH LT   +   + A P + E+++GH     A+  G+  AV  
Sbjct: 180 LRKMSAYAHSLGLEVHAGHGLTYDTVQP-VAAFPEVRELNIGHFLIGEAIFRGLTPAVHE 238

Query: 242 FRRACGQHL 250
            RR   +  
Sbjct: 239 MRRLMDEAR 247


>gi|56698033|ref|YP_168404.1| pyridoxine 5'-phosphate synthase [Ruegeria pomeroyi DSS-3]
 gi|91207570|sp|Q3V7J3|PDXJ_SILPO RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|56679770|gb|AAV96436.1| pyridoxal phosphate biosynthetic protein PdxJ [Ruegeria pomeroyi
           DSS-3]
          Length = 248

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 69/249 (27%), Positives = 120/249 (48%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R   +P+ +   KIA Q+GA G+T H R D+RHI   D+  +   
Sbjct: 7   RLGVNIDHVATVRNARGGEYPDPIRAAKIAEQAGADGITAHLREDRRHITDADIDGLMAA 66

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +        LN E    +    +  R+KP  + +VP+   + T++ G +  + +  L   
Sbjct: 67  LS-----VPLNFEMAATDEMQKIALRHKPHAVCIVPEKREERTTEGGLEVAREENRLAHF 121

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQQERIFLNK 181
           +A L  +G R+S+F   +  +  ++AA   GA  IEL+TG Y   +   +       L  
Sbjct: 122 IAPLREVGCRVSIFIAADRRQ--VEAAHRIGAQVIELHTGAYCDAHAEGDFATRDRELEA 179

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   +  A  + L+++AGH LT   +   + A P + E+++GH     A+  G+  A+  
Sbjct: 180 LREMSAFAHSLGLEVHAGHGLTYDTVQP-VAAFPEVMELNIGHFLIGEAIFRGLHPAIAE 238

Query: 242 FRRACGQHL 250
            RR   +  
Sbjct: 239 MRRLMDEAR 247


>gi|237755459|ref|ZP_04584083.1| pyridoxine 5'-phosphate synthase [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237692391|gb|EEP61375.1| pyridoxine 5'-phosphate synthase [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 247

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 70/249 (28%), Positives = 123/249 (49%), Gaps = 7/249 (2%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ +A LR  R    P+ V    IA+++GA  +T+H R D+RHI+  DL  ++  
Sbjct: 2   RLGVNIDHIATLREARKTTEPDPVKGALIAIEAGADQITLHLREDRRHIQDEDLFRLK-- 59

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
            + +     +N+E  P     N+     P  +TLVP+   ++T++ G D +     L   
Sbjct: 60  CELKDTNIPINLEMAPTYEMQNIALEALPNNVTLVPEKRQEITTEGGLDVVSMLDYLKDF 119

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           +  +   G  +SLF D   +   + A+   GAD IE++TG Y   Y    ++ +   ++ 
Sbjct: 120 IKPIKQQGITVSLFIDP--DFKQIDASVEIGADAIEIHTGEYANAYGKNVEKELE--RIK 175

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A+ A++  L++ AGH LT QN+   I  I  I E+++GH+  + A+  G+ EAV   +
Sbjct: 176 KAAKYAKEKGLKVYAGHGLTYQNVSE-IAKIKEIEELNIGHSIISNAIFLGLYEAVRRMK 234

Query: 244 RACGQHLDN 252
                    
Sbjct: 235 EIILNARKE 243


>gi|126739727|ref|ZP_01755419.1| pyridoxal phosphate biosynthetic protein [Roseobacter sp.
           SK209-2-6]
 gi|126719373|gb|EBA16083.1| pyridoxal phosphate biosynthetic protein [Roseobacter sp.
           SK209-2-6]
          Length = 248

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 72/249 (28%), Positives = 124/249 (49%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R    P+ V    +A  +GA G+T H R D+RHI  +D+  +   
Sbjct: 7   RLGVNIDHVATVRNARGGDNPDPVRAAILAQNAGADGITAHLREDRRHIIDSDIDGLM-- 64

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              Q  +  LN E    E   ++  R+KP  + LVP+   + T++ G D   N   L   
Sbjct: 65  ---QALRIPLNFEMAATEEMQSIALRHKPHAVCLVPEKREERTTEGGLDVAANDNALADY 121

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFLNK 181
           ++ L + GSR+S+F   +  +  ++A+   GA  IEL+ G Y   +     ++  + L K
Sbjct: 122 ISPLRDSGSRVSMFIAADKAQ--VEASHRIGAPVIELHAGAYADAWAEGRWEERDLELAK 179

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A  A  + L+++ GH LT +++   I A+P + E+++GH     A+  G+  A+  
Sbjct: 180 ITEMAAFAHDLGLEVHVGHGLTYESVGP-IAALPQVRELNIGHFLMGEAMFVGLPAALAE 238

Query: 242 FRRACGQHL 250
            RR   Q  
Sbjct: 239 MRRCMEQAR 247


>gi|225010442|ref|ZP_03700913.1| pyridoxal phosphate biosynthetic protein PdxJ [Flavobacteria
           bacterium MS024-3C]
 gi|225005271|gb|EEG43222.1| pyridoxal phosphate biosynthetic protein PdxJ [Flavobacteria
           bacterium MS024-3C]
          Length = 238

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 91/245 (37%), Positives = 132/245 (53%), Gaps = 8/245 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P+L+       + GA G+T+HPRPD+RHIRY D  E++
Sbjct: 1   MTKLSVNINKLATLRNARGGNVPDLLVSASDIERFGAEGITIHPRPDERHIRYKDARELK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++       E NIEG PNE F+ L    KP Q+TLVPD    +TS+ GWD + +   L 
Sbjct: 61  NVVT-----TEYNIEGNPNEKFIALVLDVKPTQVTLVPDAVDAITSNAGWDAITHADFLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
            T+AR    G R S+F D    +   +AA  TG D +ELYT  Y A   +   +   +  
Sbjct: 116 NTIARFKAAGIRTSIFIDPVITQI--EAAAATGTDRVELYTEAY-AKGFDQGNKEAAIAP 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A  A+ + L +NAGHDL++ NI      I  + E+S+GHA    +L  G++  +  
Sbjct: 173 YKAAATKARSLGLGVNAGHDLSLDNIGFFKAEIKELDEVSIGHALICESLYLGLENVIPM 232

Query: 242 FRRAC 246
           + +A 
Sbjct: 233 YLKAL 237


>gi|163738235|ref|ZP_02145651.1| pyridoxal phosphate biosynthetic protein PdxJ [Phaeobacter
           gallaeciensis BS107]
 gi|161388851|gb|EDQ13204.1| pyridoxine 5'-phosphate synthase [Phaeobacter gallaeciensis BS107]
          Length = 253

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 70/249 (28%), Positives = 120/249 (48%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R    P+ V   K+A ++GA G+T H R D+RHI   D+  +   
Sbjct: 12  RLGVNIDHVATVRNARGGLAPDPVRAAKLAEEAGADGITAHLREDRRHITDADIDGLMAA 71

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +        LN E    E    +  R+KP  + +VP+   + T++ G +  + +  L   
Sbjct: 72  LS-----VPLNFEMAATEEMQKIALRHKPHAVCIVPEKREERTTEGGLEVAREENKLAHY 126

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQQERIFLNK 181
           +A L + G R+S+F   +  +   +AA   GA+ IEL+TG Y   +   +  +    L  
Sbjct: 127 IAPLRDAGCRVSIFIAADQRQI--EAAHRIGAEVIELHTGAYCDAHAEGDFAKRDAELAA 184

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   +  A  + L+++AGH LT   +   I A P + E+++GH     A+  G+  A+  
Sbjct: 185 LREMSSFAHSLGLEVHAGHGLTYDCVQP-IAAFPEVRELNIGHFLIGEAIFRGLTPAIAE 243

Query: 242 FRRACGQHL 250
            RR   +  
Sbjct: 244 MRRLMDEVR 252


>gi|228473543|ref|ZP_04058296.1| pyridoxine 5'-phosphate synthase [Capnocytophaga gingivalis ATCC
           33624]
 gi|228275150|gb|EEK13953.1| pyridoxine 5'-phosphate synthase [Capnocytophaga gingivalis ATCC
           33624]
          Length = 237

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 94/246 (38%), Positives = 134/246 (54%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PNL+ +       GA G+T+HPRPD+RHIRY D  +++
Sbjct: 1   MTKLSVNINKIATLRNSRGGNVPNLLQVATDLQDFGAEGITIHPRPDERHIRYQDALDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    E NIEG P   F++L  + KP Q+TLVPD    +TS+ GWD L + A LT
Sbjct: 61  -----EIVHTEYNIEGNPIPKFVDLVLKVKPTQVTLVPDAEDAITSNAGWDTLTHGAYLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + VA     G R SLF D       ++AA  TG D +ELYT  Y       +  +  +  
Sbjct: 116 EIVAEFKRHGIRTSLFVDPVER--MVEAAAKTGTDRVELYTEAY--AREYARGNKEGIRP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A++AQK+ L +NAGHDL++ N+      IP + E+S+GHA  + AL  G++  V  
Sbjct: 172 YVQAAEVAQKVGLGLNAGHDLSLDNLQYFKEQIPGLLEVSIGHALISEALYLGLQNVVSM 231

Query: 242 FRRACG 247
           +     
Sbjct: 232 YLYRLK 237


>gi|288941439|ref|YP_003443679.1| pyridoxal phosphate biosynthetic protein PdxJ [Allochromatium
           vinosum DSM 180]
 gi|288896811|gb|ADC62647.1| pyridoxal phosphate biosynthetic protein PdxJ [Allochromatium
           vinosum DSM 180]
          Length = 255

 Score =  252 bits (643), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 122/247 (49%), Gaps = 9/247 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA +R  R   +P  +    +A Q+GA  +T+H R D+RHI+  D+  +R 
Sbjct: 11  ILLGVNIDHVATVRQARGTRYPEPIQAALVAEQAGADAITLHLREDRRHIQDRDVEMLRD 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N+E         +  R +P    LVP+   +LT++ G D    Q  + +
Sbjct: 71  IL-----QTRMNLEMAVTPEMAAIACRIRPADCCLVPERREELTTEGGLDVASRQDAMRE 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
             ARL   G R+SLF D +  +   +AA   GA  IE++TG Y     +P +    L ++
Sbjct: 126 FCARLAEAGIRVSLFIDADPVQI--EAAHAIGAPVIEIHTGHYADA-RDPVERAAQLERI 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
                L   + LQ+NAGH L   N+   I AIP + E+++GH+  A AL  G+  AV   
Sbjct: 183 RSAVALGLSLGLQVNAGHGLDYHNVQA-IAAIPGVRELNIGHSIIARALFSGLDRAVRDM 241

Query: 243 RRACGQH 249
           +    + 
Sbjct: 242 KDVMERA 248


>gi|305665183|ref|YP_003861470.1| pyridoxal phosphate biosynthetic protein [Maribacter sp. HTCC2170]
 gi|88709935|gb|EAR02167.1| pyridoxal phosphate biosynthetic protein [Maribacter sp. HTCC2170]
          Length = 237

 Score =  252 bits (643), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 87/246 (35%), Positives = 131/246 (53%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PNL  + +     GA G+TVHPRPD+RHI+Y D  +++
Sbjct: 1   MTKLSVNINKIATLRNSRGGNIPNLTKVAQDIESFGAQGITVHPRPDERHIKYQDARDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    E NIEG P + F++L    +P Q+TLVPD    +TS+ GW+ ++++  L 
Sbjct: 61  -----KIVATEYNIEGNPIQKFIDLVLEVRPTQVTLVPDAEDAITSNAGWNTVKHKDFLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +      G R S+F D   +   ++ A  TG D IELYT  +    N  Q++   +  
Sbjct: 116 EVINTFKQNGIRTSIFVDP--DVKMIEGAAKTGTDRIELYTESF--AENFGQEKSESIKP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A++A K+ L INAGHDL + NI      IP + E+S+GHA    +L  G+   V  
Sbjct: 172 FKEAAKIAAKLGLGINAGHDLNLDNIKYFKEHIPNLLEVSIGHALICESLYFGLDNVVKM 231

Query: 242 FRRACG 247
           +     
Sbjct: 232 YLDKLK 237


>gi|332994405|gb|AEF04460.1| pyridoxine 5'-phosphate synthase [Alteromonas sp. SN2]
          Length = 245

 Score =  252 bits (643), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 123/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ VH   +A ++GA G+TVH R D+RHI+  D+  +    
Sbjct: 6   LGVNIDHIATLRNARGTNYPDPVHAADVAERAGADGITVHLREDRRHIKDRDVRIL---- 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     LN+E    +  L + E  KP    LVP+   +LT++ G D   N A++ +  
Sbjct: 62  -AQTINTRLNLEMAVTDEMLAIAEEVKPVFCCLVPEKREELTTEGGLDVAGNLAVMKQAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL      +SLF D +  +    AA   GA  IE++TG Y    +  +     L +L  
Sbjct: 121 ERLAAANILVSLFIDADKQQI--DAAVECGAPYIEIHTGQYAEATSEAE-LEEELARLVE 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             + A K  L++NAGH L   N+   I AIP + E+++GHA  A A   G+  AV   R+
Sbjct: 178 GIEYADKRGLKVNAGHGLHYHNVKP-IAAIPQLIELNIGHAIIARAAFDGLATAVADMRK 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMLEAR 242


>gi|302039389|ref|YP_003799711.1| pyridoxine 5'-phosphate synthase [Candidatus Nitrospira defluvii]
 gi|300607453|emb|CBK43786.1| Pyridoxine 5'-phosphate synthase [Candidatus Nitrospira defluvii]
          Length = 237

 Score =  252 bits (643), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 72/246 (29%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR  R    P+ +    +   +GA GL VH R D+RHI+  DL  +R
Sbjct: 1   MARLGVNIDHVATLRQARGGTDPDPLTAAILVELAGADGLVVHLREDRRHIQDRDLTMLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  + +L++E   ++    +    KP+ +TLVP+   +LT++ G D   ++  + 
Sbjct: 61  -----EIVRTKLDLEMAADDAMAKIALSIKPDLVTLVPERRQELTTEGGLDVANHRDRIQ 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           K V  L + G   SLF + + ++   +AA   GA  +EL+TG Y     + ++E      
Sbjct: 116 KIVDLLRDGGIPTSLFVEPSLDQI--KAAHKIGAAYVELHTGRYSNAKRS-KEEDEEFEA 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A+LA K+ L +NAGH LT +N+   +  +P I E ++GH+  A ++  G+ +AV  
Sbjct: 173 ITQAAKLAYKLGLGVNAGHGLTYKNVKR-LAKLPEIVEFNIGHSIIARSVMVGLVQAVRE 231

Query: 242 FRRACG 247
            +    
Sbjct: 232 MKELVA 237


>gi|119471908|ref|ZP_01614216.1| pyridoxal phosphate biosynthetic protein [Alteromonadales bacterium
           TW-7]
 gi|119445281|gb|EAW26571.1| pyridoxal phosphate biosynthetic protein [Alteromonadales bacterium
           TW-7]
          Length = 243

 Score =  252 bits (643), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 74/248 (29%), Positives = 122/248 (49%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LR  R   +P+  H   +A  +GA G+T+H R D+RHI+  D+     
Sbjct: 4   ILLGVNVDHIATLRQARGTTYPDPAHAASVAEHAGADGITIHLREDRRHIQDRDVY---- 59

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +  +  +  +N+E    +  + +    KPE + LVP+   +LT++ G D   N   +  
Sbjct: 60  -VMAKTIQTRMNLETAVTDEMIAIALEVKPEYVCLVPEKREELTTEGGLDVAGNIEKIKA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
               L + G ++SLF D +  +  L AAK  GA  +E++TG Y    N+       L  +
Sbjct: 119 ATKTLTDAGIKVSLFIDADTAQ--LDAAKACGAPYVEIHTGAYADATND-SDLSKELEHI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               Q A  + L +NAGH L   N+   I A+P I E+++GHA  A A   G+ +AV   
Sbjct: 176 RQGVQYAASLGLIVNAGHGLNYHNVKP-IAAMPEIYELNIGHAIIARAAIDGLDKAVRDM 234

Query: 243 RRACGQHL 250
           +R   +  
Sbjct: 235 KRLMIEAR 242


>gi|313201511|ref|YP_004040169.1| pyridoxal phosphate biosynthetic protein pdxj [Methylovorus sp.
           MP688]
 gi|312440827|gb|ADQ84933.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylovorus sp.
           MP688]
          Length = 243

 Score =  252 bits (643), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 75/248 (30%), Positives = 128/248 (51%), Gaps = 9/248 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR  R   +P++V     A ++GA  +T+H R D+RHI+  D+  +R
Sbjct: 1   MIKLGVNIDHVATLRQARGTQYPSVVQAALRAEEAGADSITIHLREDRRHIQDADVFALR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + ++N+E    E  L +  + KP+ + LVP+   + T++ G +   N A ++
Sbjct: 61  P-----LLQTKMNLEMAVTEEMLGIALQVKPQDVCLVPERREERTTEGGLEVAGNLAAVS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
                L + G R+SLF   +  +    AAK  GA  IE++TG +      P+++   L +
Sbjct: 116 HACQVLRDAGIRVSLFIAPDIAQI--DAAKAAGAPVIEIHTGTFADA-ETPEEQAHELAR 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +       +K+ L +NAGH L I N+ +LI AIP I E+++GHA  A A+  G + +V  
Sbjct: 173 VQAAVAHGRKLGLVVNAGHGLNIHNV-HLIAAIPGIEELNIGHAIVAHAIFVGWEYSVRE 231

Query: 242 FRRACGQH 249
            +    Q 
Sbjct: 232 MKVLMLQA 239


>gi|110834489|ref|YP_693348.1| pyridoxine 5'-phosphate synthase [Alcanivorax borkumensis SK2]
 gi|122959429|sp|Q0VP22|PDXJ_ALCBS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|110647600|emb|CAL17076.1| pyridoxal phosphate biosynthetic protein PdxJ [Alcanivorax
           borkumensis SK2]
          Length = 244

 Score =  252 bits (643), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 77/243 (31%), Positives = 119/243 (48%), Gaps = 9/243 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R   +P  V    +A Q+GA G+TVH R D+RHI   D+  +    
Sbjct: 9   LGVNIDHIATLRQARGTRYPEPVQAALVAEQAGADGITVHLREDRRHINDRDVELL---- 64

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    E  + +  R +P    LVP+   +LT++ G D + N+A + +  
Sbjct: 65  -AQTLQTRMNLEMAATEEMVVIACRIQPPHCCLVPEKREELTTEGGLDVVGNKAWIAQCC 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D   ++    AA+  GA  IE++TG Y        Q++  L ++  
Sbjct: 124 QRLGQAGIEVSLFIDAEESQIL--AARECGAPAIEIHTGGYADA-QTIDQQQQELARIRS 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
               A    L +NAGH L   N    I  IP I+E+++GH+  A A   G+ EAV   R 
Sbjct: 181 AVAFALAQGLIVNAGHGLHYHNTLA-IAEIPGINELNIGHSIIARAAITGLDEAVRSMRS 239

Query: 245 ACG 247
              
Sbjct: 240 LLD 242


>gi|254525405|ref|ZP_05137457.1| pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. MIT 9202]
 gi|221536829|gb|EEE39282.1| pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. MIT 9202]
          Length = 238

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 71/245 (28%), Positives = 124/245 (50%), Gaps = 10/245 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ +A +R  R    P+ V    +A   GA  +TVH R D+RHI+  D+  ++
Sbjct: 1   MATLGVNIDHIANVRQARKTVEPDPVQFAFLAELGGADSITVHLREDRRHIQDRDVFLLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  K +LN+E    E  L + ++  P+ +TLVP+   ++T++ G D   N   L 
Sbjct: 61  -----ETIKTKLNLEMAATEEMLEIAQKILPDYVTLVPEKREEVTTEGGLDLKSNLQYLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           K V  L +    +S F D  G + +   +K  G D IEL+TG Y     +   +   L +
Sbjct: 116 KAVGNLQDSNIEVSAFIDPLGEQINY--SKEIGFDFIELHTGKY--AELSGSDQYKELQR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +  +  LA  + L +NAGH L   N+   I +I  ++E+++GH+  A AL  G++++V  
Sbjct: 172 IIESTHLANDLGLVVNAGHGLNYNNVKK-IASINNMNELNIGHSIVARALAIGLEKSVRE 230

Query: 242 FRRAC 246
            +   
Sbjct: 231 MKSLI 235


>gi|148242652|ref|YP_001227809.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. RCC307]
 gi|166219116|sp|A5GU97|PDXJ_SYNR3 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|147850962|emb|CAK28456.1| Pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           RCC307]
          Length = 252

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 79/256 (30%), Positives = 133/256 (51%), Gaps = 10/256 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ +NL+ +A +R  R    P+ VH+  +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MASLGINLDHIATVRQARRTVEPDPVHLALLAELGGADGITVHLREDRRHIQDRDVELLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  +  LN+E       + +    KP+ +TLVP+   ++T++ G D +   A L 
Sbjct: 61  -----QTVRTRLNLEMAATAEMVAIALTIKPDMVTLVPEKRQEVTTEGGLDVVSQAAALQ 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             +++L   G  +SLF D    +  LQA++ +GA  +EL+TG Y     +  Q+ + L +
Sbjct: 116 GQISQLQGAGIPVSLFVDPERAQ--LQASQRSGARWVELHTGSYAEA--SWSQQPLELAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L      A+++ L++NAGH LT QN+   I AI  + E+++GH   A A+  G++EAV  
Sbjct: 172 LIEGTTEARQLGLRVNAGHGLTYQNVEP-IAAISGMEELNIGHTVMARAMAVGLQEAVKQ 230

Query: 242 FRRACGQHLDNTMRLT 257
            +          +   
Sbjct: 231 MKELVSAPRQEPLFGA 246


>gi|260429005|ref|ZP_05782982.1| pyridoxine 5'-phosphate synthase [Citreicella sp. SE45]
 gi|260419628|gb|EEX12881.1| pyridoxine 5'-phosphate synthase [Citreicella sp. SE45]
          Length = 250

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 65/249 (26%), Positives = 118/249 (47%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R   +P+ +   +IA ++GA G+T H R D+RHI   D+  +   
Sbjct: 9   RLGVNIDHVATVRNARGSAYPDPLRAAQIAQEAGADGITAHLREDRRHISDADIDGLM-- 66

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +     LN+E    +    +  R+KP  + +VP+   ++T++ G +   N+  L   
Sbjct: 67  ---ESLNLPLNLEMAATDEMQAIALRHKPHAVCIVPEKREEVTTEGGLEVAMNENRLAHF 123

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFLNK 181
           +  L   G R+SLF   +  +  + A+   GA  +EL+TG Y   +      +    L +
Sbjct: 124 IDPLREAGCRVSLFIGADKAQ--VAASARIGAQVVELHTGHYCDLHAEGRFDERDAELAR 181

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L      A  + L+++AGH LT   +   + A   + E+++GH     A+  G+  A+  
Sbjct: 182 LRDMTAYAHSLGLEVHAGHGLTYDTVKP-VAAFAEVIELNIGHFLIGEAIFRGLGPAIAE 240

Query: 242 FRRACGQHL 250
            RR   +  
Sbjct: 241 MRRLMDEAR 249


>gi|86157925|ref|YP_464710.1| pyridoxine 5'-phosphate synthase [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774436|gb|ABC81273.1| pyridoxine 5'-phosphate synthase [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 242

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 74/251 (29%), Positives = 126/251 (50%), Gaps = 9/251 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   + VN++ VA LR  R   +P+ V    +A   GA  +T+H R D+RHI+  DL  +
Sbjct: 1   MPARLGVNVDHVATLRQSRRTQYPDPVAAAVLAEMGGADQITIHLREDRRHIQERDLQVL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R+ +        LN+E    +  + +    KP+  TLVP+   +LT++ G D +  +  +
Sbjct: 61  RKTVSS-----RLNLEMAATQDMVKIAYGVKPDIATLVPERREELTTEGGLDVVGGREHV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            K V  L +    +SLF D + ++  ++AA    A+ +EL+TG Y        +    L+
Sbjct: 116 RKVVKTLRDAEIEVSLFIDPDLDQ--VKAAHRAEAEVVELHTGRYCDARLASDRR-RELS 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A K+ L++ AGH L  QN+   + AIP I E+++GH+  A A+  G + AV 
Sbjct: 173 RVIDACKAAAKLGLRVAAGHGLNYQNVLP-VAAIPEIEELNIGHSIVARAVLVGFERAVR 231

Query: 241 CFRRACGQHLD 251
             R    +   
Sbjct: 232 EMRELLREARP 242


>gi|91775220|ref|YP_544976.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylobacillus
           flagellatus KT]
 gi|91775364|ref|YP_545120.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylobacillus
           flagellatus KT]
 gi|91709207|gb|ABE49135.1| pyridoxine 5'-phosphate synthase [Methylobacillus flagellatus KT]
 gi|91709351|gb|ABE49279.1| pyridoxine 5'-phosphate synthase [Methylobacillus flagellatus KT]
          Length = 240

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 68/246 (27%), Positives = 122/246 (49%), Gaps = 9/246 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA LR  R   +P++V     A ++GA  +T+H R D+RHI+  D+  +R  
Sbjct: 2   KLGVNIDHVATLRQARGTQYPSVVQAALRAEEAGADSITIHLREDRRHIQDADVFALRP- 60

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
                 + ++N+E    +  + +  + +P+ + LVP+   + T++ G + + N   +   
Sbjct: 61  ----LLQTKMNLEMAVTDEMVGIALQVRPQDVCLVPERREERTTEGGLNVIGNLGAIKGA 116

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
              L + G R+SLF         ++AAK  GA  IE++TG +        +    L ++ 
Sbjct: 117 CKTLGDAGIRVSLFIGP--ELEQVEAAKAAGAPVIEIHTGAFADAGTEAAK-HAELQRIR 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
           +       + L +NAGH L I N+  +++ IP I E+++GHA  A AL  G + AV   +
Sbjct: 174 MAVDHGLALGLTVNAGHGLNIHNVHEIVS-IPGIEELNIGHAIVAHALFVGWEYAVREMK 232

Query: 244 RACGQH 249
               Q 
Sbjct: 233 ALIVQK 238


>gi|254460528|ref|ZP_05073944.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodobacterales
           bacterium HTCC2083]
 gi|206677117|gb|EDZ41604.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 249

 Score =  251 bits (642), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 70/252 (27%), Positives = 120/252 (47%), Gaps = 10/252 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LRN R    P+ V    +A ++GA G+T H R D+RHIR  D+  + 
Sbjct: 6   PLRLGVNIDHVATLRNARGGALPDPVRAALVAQKAGADGITAHLREDRRHIRDADIDALM 65

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +        LN E    +    +  R+KP  + LVP+   + T++ G +  Q++  L 
Sbjct: 66  DALS-----IPLNFEMAATDEMQTIALRHKPHAVCLVPEKREERTTEGGLNVAQDENKLA 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQQERIFL 179
             +A L   GSR+S+F   +  +     A   GA+ IEL+TG Y   +   + +     L
Sbjct: 121 HFIAPLREAGSRVSIFIAADKKQIDS--AHRIGAEVIELHTGAYCDAFAEGDMKTRDAEL 178

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             +   A  A  + L+++AGH LT +++   +  +P + E+++GH     A+  G+  A+
Sbjct: 179 AAMTEMAAYAHDLGLEVHAGHGLTYEDVTP-VAQLPQVQEVNIGHFIIGEAVFRGLGPAI 237

Query: 240 FCFRRACGQHLD 251
              RR       
Sbjct: 238 EEMRRILDLARP 249


>gi|54293919|ref|YP_126334.1| pyridoxal phosphate biosynthetic protein PdxJ [Legionella
           pneumophila str. Lens]
 gi|91207239|sp|Q3V7F6|PDXJ_LEGPL RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|53753751|emb|CAH15209.1| Pyridoxal phosphate biosynthetic protein pdxJ [Legionella
           pneumophila str. Lens]
          Length = 248

 Score =  251 bits (642), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 83/246 (33%), Positives = 134/246 (54%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +R  R   +P+ V     A ++GA G+T+H R D RHI+  D+  I+   
Sbjct: 7   LGVNIDHIATIRQARGTRYPDPVQAAMDAEEAGADGITLHMREDLRHIQARDVRLIK--- 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    E  L+  E   PE   LVP+   +LT++ G D L ++ ++ K V
Sbjct: 64  --QVLQTRMNLELAVTEAMLDFAEEISPEHSCLVPEKREELTTEGGLDILTHRNVVEKAV 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +GS +SLF D +  +   +AA   GA  IEL+TG Y    +  +++   L ++  
Sbjct: 122 RRLQLMGSEVSLFIDPDKEQI--RAAVDVGAPVIELHTGCYADATSE-EKQHYELQRIKE 178

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A  ++L +NAGH L   N+   I AI  ++E+++GHA  A AL CG+KEAV   R+
Sbjct: 179 AAEFAASLNLVVNAGHGLHYHNVKP-IAAIRELNELNIGHAIIARALFCGLKEAVRHMRQ 237

Query: 245 ACGQHL 250
              +  
Sbjct: 238 LMQEAR 243


>gi|238899296|ref|YP_002924979.1| pyridoxine 5'-phosphate synthesizing enzyme [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229467057|gb|ACQ68831.1| pyridoxine 5'-phosphate synthesizing enzyme [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 242

 Score =  251 bits (642), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 79/247 (31%), Positives = 119/247 (48%), Gaps = 10/247 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   DL  +    
Sbjct: 6   LGVNIDHVATLRNARRSVYPDPVQAAFIAEQAGADGITVHLREDRRHITERDLHLLS--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  LN+E         +    KP    LVP+   ++T++ G D       + +T+
Sbjct: 63  --QTIQTRLNLEMAVTNEMREMAYAIKPYSCCLVPEKREEITTEGGLDMTVQTDNIVETI 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L   G  IS+F D + ++  L A     A  IEL+TG Y     N  Q+   L ++  
Sbjct: 121 EVLSKAGIVISVFIDPDKHQIDLAAQAK--AQYIELHTGTYANASGN--QKSSELKRIVD 176

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A +  L++NAGH L+  N+   I AI  I E+++GHA    AL  G+  AV   ++
Sbjct: 177 AAAYASQKKLKVNAGHGLSYHNV-KAIAAILDIEELNIGHAIIGRALISGLAPAVSEMKK 235

Query: 245 ACGQHLD 251
              +   
Sbjct: 236 LMKEARQ 242


>gi|92113758|ref|YP_573686.1| pyridoxal phosphate biosynthetic protein PdxJ [Chromohalobacter
           salexigens DSM 3043]
 gi|91796848|gb|ABE58987.1| pyridoxine 5'-phosphate synthase [Chromohalobacter salexigens DSM
           3043]
          Length = 270

 Score =  251 bits (642), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 78/243 (32%), Positives = 124/243 (51%), Gaps = 10/243 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LR  R   +P+ V    +A ++GA G+T+H R D+RHI+  D+  +  
Sbjct: 6   ILLGVNIDHIATLRQARGTRYPDPVQAAMLAEEAGADGITLHLREDRRHIQERDVRVL-- 63

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +     +N+E    E  +   E  +P  + LVP+   +LT++ G D +     +  
Sbjct: 64  ---AETLATRMNLEMAVTEEMIAFAETLRPANVCLVPEKREELTTEGGLDVVGACERVGD 120

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              RL   G  +SLF D    +   QAA   GA  +EL+TG Y     + Q+  +   +L
Sbjct: 121 ACRRLAAAGCEVSLFIDPEPAQI--QAAYELGAPTVELHTGAYAEASGDAQR--VEYQRL 176

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A++A ++ L +NAGH L   N+   I AIP I E+++GHA  A AL  G+KEAV   
Sbjct: 177 VAAAEMAFELGLTVNAGHGLHYHNV-EAIAAIPGIHELNIGHAIIARALFVGLKEAVAEM 235

Query: 243 RRA 245
           +R 
Sbjct: 236 KRL 238


>gi|94502130|ref|ZP_01308631.1| pyridoxal phosphate biosynthetic protein [Oceanobacter sp. RED65]
 gi|94425732|gb|EAT10739.1| pyridoxal phosphate biosynthetic protein [Oceanobacter sp. RED65]
          Length = 246

 Score =  251 bits (642), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 76/242 (31%), Positives = 127/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R   +P+ V+   +A ++GA G+T+H R D+RHI+  D+  +R   
Sbjct: 9   LGVNIDHIATLRQARGTRYPDPVYAALVAEEAGADGITLHLREDRRHIQDADVYALR--- 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +     +N+E    +  + + +  KP  + LVP+   +LT++ G D L N+A + +  
Sbjct: 66  --ERLNTRMNLEMAVTDEMVAIAKEVKPHAVCLVPEKREELTTEGGLDVLGNEAKIKQAC 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L ++GS +SLF D   +   + AA   GA  IE++TG Y     +  + +  L K+  
Sbjct: 124 DDLASVGSEVSLFIDA--DTKQIDAAVRCGAPVIEIHTGHYAEA-QSAAEMQRELKKIED 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A +  L +NAGH L   N    I AI  ++E+++GHA  A A   G+K+AV   R 
Sbjct: 181 GASYALEQGLIVNAGHGLHYHN-TEAIAAISGMNELNIGHAIIAHAAFVGLKQAVKEMRD 239

Query: 245 AC 246
             
Sbjct: 240 LI 241


>gi|332532632|ref|ZP_08408508.1| pyridoxine 5'-phosphate synthase [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332037848|gb|EGI74297.1| pyridoxine 5'-phosphate synthase [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 243

 Score =  251 bits (642), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 73/249 (29%), Positives = 121/249 (48%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LR  R   +P+  H   +A  +GA G+T+H R D+RHI+  D+     
Sbjct: 4   ILLGVNVDHIATLRQARGTSYPDPAHAASVAEHAGADGITIHLREDRRHIQDRDVY---- 59

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +  +  +  +N+E    +  + +    KPE + LVP+   +LT++ G D   N   +  
Sbjct: 60  -VMAKTIQTRMNLETAVTDEMIKIALEVKPEYVCLVPEKREELTTEGGLDVAGNIDKIKA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
               L   G ++SLF D +  +  L AAK  GA  +E++TG Y    N+       L  +
Sbjct: 119 ATKTLTEAGIKVSLFIDADKAQ--LDAAKECGAPYVEIHTGAYADATND-TDLHKELEHI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               + A  + L +NAGH L   N+   I A+P I E+++GHA  A A   G+ +AV   
Sbjct: 176 REGVKYAASLGLIVNAGHGLHYHNVKP-IAAMPEIYELNIGHAIIARAAIDGLDKAVRDM 234

Query: 243 RRACGQHLD 251
           +R   +   
Sbjct: 235 KRLMIEARM 243


>gi|94264469|ref|ZP_01288257.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93455100|gb|EAT05324.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
          Length = 440

 Score =  251 bits (642), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 73/248 (29%), Positives = 127/248 (51%), Gaps = 9/248 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              +++N++ VA LR  R +  P+ V    I   +GA+G+ VH R D+RHI+  DL  ++
Sbjct: 198 MIQLAINVDHVATLRQARGINEPDPVLAAGICELAGAAGIVVHLREDRRHIQDRDLQLLK 257

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  K++LN+E   N   + +    +P+ +TLVP+   +LT++ G +    +  LT
Sbjct: 258 -----QTVKSKLNLEMGANPEIIAIALELQPDMVTLVPEKRRELTTEGGLNVKGGRKKLT 312

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             + +    G  +SLF D +  +   +AA   GA  +E++TG Y    +   ++ +    
Sbjct: 313 GVIEQFRQKGIPVSLFIDPDARQI--EAAAAIGATFVEIHTGRYCDATSE-AEQELEFAL 369

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A +A +  L++NAGH L  +N    I A+  I E+S+GHA  A A+  G++ AV  
Sbjct: 370 VAEAADIAWQAGLRVNAGHGLNYRNTGR-IAALENIEELSIGHAIMARAIMVGLERAVRE 428

Query: 242 FRRACGQH 249
                 + 
Sbjct: 429 MLAIIREA 436


>gi|197122772|ref|YP_002134723.1| pyridoxine 5'-phosphate synthase [Anaeromyxobacter sp. K]
 gi|220917555|ref|YP_002492859.1| pyridoxal phosphate biosynthetic protein PdxJ [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|196172621|gb|ACG73594.1| pyridoxal phosphate biosynthetic protein PdxJ [Anaeromyxobacter sp.
           K]
 gi|219955409|gb|ACL65793.1| pyridoxal phosphate biosynthetic protein PdxJ [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 242

 Score =  251 bits (642), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 74/251 (29%), Positives = 126/251 (50%), Gaps = 9/251 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   + VN++ VA LR  R   +P+ V    +A   GA  +T+H R D+RHI+  DL  +
Sbjct: 1   MPARLGVNVDHVATLRQSRRTQYPDPVAAAVLAEMGGADQITIHLREDRRHIQERDLQVL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R+ +        LN+E    +  + +    KP+  TLVP+   +LT++ G D +  +  +
Sbjct: 61  RKTVSS-----RLNLEMAATQDMVKIAYGVKPDIATLVPERREELTTEGGLDVVGGREHV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            K V  L +    +SLF D + ++  ++AA    A+ +EL+TG Y        +    L+
Sbjct: 116 RKVVKTLRDAEIEVSLFIDPDLDQ--VKAAHRAEAEVVELHTGRYCDARLASDRR-RELS 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A K+ L++ AGH L  QN+   + AIP I E+++GH+  A A+  G + AV 
Sbjct: 173 RVIDACKAAAKLGLRVAAGHGLNYQNVVP-VAAIPEIEELNIGHSIVARAVLVGFERAVR 231

Query: 241 CFRRACGQHLD 251
             R    +   
Sbjct: 232 EMRELLREARP 242


>gi|126726098|ref|ZP_01741940.1| pyridoxal phosphate biosynthetic protein [Rhodobacterales bacterium
           HTCC2150]
 gi|126705302|gb|EBA04393.1| pyridoxal phosphate biosynthetic protein [Rhodobacterales bacterium
           HTCC2150]
          Length = 252

 Score =  251 bits (642), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 68/249 (27%), Positives = 124/249 (49%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R   +P+ +   KIA ++GA G+T H R D+RHI   D+  +   
Sbjct: 11  RLGVNIDHVATIRNARGSAYPDPMVAAKIAEEAGADGITAHLREDRRHIADADIDALMAG 70

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     +  LN E         +  R+ P  + +VP+   + T++ G +   +   L   
Sbjct: 71  L-----RTPLNFEMAATVEMQKIALRHCPHAVCIVPEKREERTTEGGLEVAGDDNRLASF 125

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFLNK 181
           +A L + G R+S+F   +  +  ++A+   GA  +EL+TG Y   +           L +
Sbjct: 126 IAPLRDAGCRVSMFIGADEQQ--VRASARIGAAVVELHTGAYCDFHYEGRIAARDEELAR 183

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           LA  + LA  + L+++AGH LT + +   I A+P ++E+++GH   A ++  G+  A+  
Sbjct: 184 LAEMSALAHSLGLEVHAGHGLTYETVAP-IAALPEVAELNIGHFLIAESIFRGLSPAIKE 242

Query: 242 FRRACGQHL 250
            RR   +  
Sbjct: 243 MRRLMDEAR 251


>gi|253999486|ref|YP_003051549.1| pyridoxine 5'-phosphate synthase [Methylovorus sp. SIP3-4]
 gi|253986165|gb|ACT51022.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylovorus sp.
           SIP3-4]
          Length = 243

 Score =  251 bits (642), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 74/248 (29%), Positives = 127/248 (51%), Gaps = 9/248 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR  R   +P++V     A ++GA  +T+H R D+RHI+  D+  +R
Sbjct: 1   MIKLGVNIDHVATLRQARGTQYPSVVQAALRAEEAGADSITIHLREDRRHIQDADVFALR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + ++N+E    E  L +  + KP+ + LVP+   + T++ G +   N A ++
Sbjct: 61  P-----LLQTKMNLEMAVTEEMLGIALQVKPQDVCLVPERREERTTEGGLEVAGNLAAVS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
                L +   R+SLF   +  +    AAK  GA  IE++TG +      P+++   L +
Sbjct: 116 HACQVLRDADIRVSLFIAPDIAQI--DAAKAAGAPVIEIHTGTFADA-ETPEEQAHELAR 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +       +K+ L +NAGH L I N+ +LI AIP I E+++GHA  A A+  G + +V  
Sbjct: 173 VQAAVAHGRKLGLVVNAGHGLNIHNV-HLIAAIPGIEELNIGHAIVAHAIFVGWEYSVRE 231

Query: 242 FRRACGQH 249
            +    Q 
Sbjct: 232 MKALMLQA 239


>gi|22298381|ref|NP_681628.1| pyridoxal phosphate biosynthetic protein PdxJ [Thermosynechococcus
           elongatus BP-1]
 gi|30316019|sp|Q8DKM1|PDXJ_THEEB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|22294560|dbj|BAC08390.1| pyridoxal phosphate biosynthetic protein [Thermosynechococcus
           elongatus BP-1]
          Length = 238

 Score =  251 bits (642), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 77/245 (31%), Positives = 123/245 (50%), Gaps = 9/245 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ VA +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MATLGVNIDHVATIRQARRTVEPDPVAAALLAELGGADGITVHLREDRRHIQERDVRLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  +  LN+E       + +    +P+ +TLVP+   ++T++ G D +  Q  LT
Sbjct: 61  -----QTVRTHLNLEMAATPEMVAIALDIRPDYVTLVPERREEVTTEGGLDVVSQQEPLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V  L   G  +SLF D +  + +  AA  T A  IEL+TG Y        Q+   L  
Sbjct: 116 QVVQTLQGAGIPVSLFIDADPTQLA--AAAKTTAQFIELHTGRYAEAKGEVAQQ-RELAI 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           LA   Q A+ + L++NAGH LT  N+   I  +  I E+++GH   + A+  G+ +AV  
Sbjct: 173 LADGVQQAKALGLRVNAGHGLTYSNVGA-IARLEGIEELNIGHTIISRAVLVGMVQAVRD 231

Query: 242 FRRAC 246
            +   
Sbjct: 232 MKALI 236


>gi|189485214|ref|YP_001956155.1| pyridoxine 5'-phosphate synthase [uncultured Termite group 1
           bacterium phylotype Rs-D17]
 gi|170287173|dbj|BAG13694.1| pyridoxine 5'-phosphate synthase [uncultured Termite group 1
           bacterium phylotype Rs-D17]
          Length = 244

 Score =  251 bits (642), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 72/251 (28%), Positives = 129/251 (51%), Gaps = 12/251 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ +A +R  R   +P+++    I  +SGA G+TVH R D+RHI+  D+ ++R
Sbjct: 1   MVKLGVNIDHIATIRQARKEDFPSVIKAAAICEKSGADGITVHLREDRRHIQDEDVYDLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  K +LN+E   +E  + +    KP+ + +VP+   +LT++ G D   +++ L 
Sbjct: 61  -----KSLKIKLNLEMAASEEIVKIALDVKPDFVCMVPEKRQELTTEGGLDVKAHKSKLA 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNP----QQERI 177
             VARL   G  +S+F D N  +    A     AD IEL+TG Y   +        + + 
Sbjct: 116 SIVARLQKAGIIVSVFIDANTEQVL--ACSEIKADSIELHTGKYAKFFKENGTDSSEFKE 173

Query: 178 FLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKE 237
            + +L+  ++ A K  L +NAGH L   N+   I  IP ++E ++G +  A ++  G++ 
Sbjct: 174 EMERLSEASRKAVKKGLILNAGHGLDYDNVER-ICNIPGMNEFNIGFSIIAESVFAGLET 232

Query: 238 AVFCFRRACGQ 248
           AV   +    +
Sbjct: 233 AVRNMKELISK 243


>gi|326386645|ref|ZP_08208267.1| pyridoxal phosphate biosynthetic protein PdxJ [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208960|gb|EGD59755.1| pyridoxal phosphate biosynthetic protein PdxJ [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 247

 Score =  251 bits (641), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 77/249 (30%), Positives = 118/249 (47%), Gaps = 10/249 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R    P+ V   +I    GA G+T H R D+RHIR  D+  I 
Sbjct: 9   PLRLGVNIDHVATIRNARGGEHPDPVRAAEIVASVGADGITAHLREDRRHIRDEDIARI- 67

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
               +      LN E    E  + +  R+KP    +VP+   + T++ G D       L 
Sbjct: 68  ----QAATSLPLNFEMAATEEMVAIALRHKPHAACIVPERREERTTEGGLDAAGQHNRLA 123

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             VARL + G R+SLF      +   +AA   GA  +EL+TG Y         + + L +
Sbjct: 124 PIVARLSDAGIRVSLFIAPEPRQI--EAAIKLGAPVVELHTGEYAHAIGE--AQAVELKR 179

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A LA    ++ +AGH LT +N+   I AIP ++E+++GH     A+  G+  AV  
Sbjct: 180 IADMAALAAVNGIEPHAGHGLTFENVQP-IAAIPQLAELNIGHYLIGEAIFTGLGAAVRH 238

Query: 242 FRRACGQHL 250
            R    +  
Sbjct: 239 MRALMDEAR 247


>gi|149279012|ref|ZP_01885146.1| pyridoxal phosphate biosynthetic protein PdxJ [Pedobacter sp.
           BAL39]
 gi|149230291|gb|EDM35676.1| pyridoxal phosphate biosynthetic protein PdxJ [Pedobacter sp.
           BAL39]
          Length = 252

 Score =  251 bits (641), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 93/247 (37%), Positives = 139/247 (56%), Gaps = 10/247 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              +SVN+N +A LRN R    P+LV +   A + GA G+TVHPRPD+RHI Y D+ +++
Sbjct: 13  MVRLSVNINKIATLRNSRGGNNPDLVKVALDAERFGAEGITVHPRPDERHILYQDVFDLK 72

Query: 62  RLIDEQFPKAELNIEGYPNET-FLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
            +I       E NIEG   E  F++L    KP Q+TLVPD   Q+TS+HGWD +++Q  L
Sbjct: 73  AVIA-----TEFNIEGNCREQKFVDLVLANKPAQVTLVPDVEGQITSNHGWDTIKHQEYL 127

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            +      + G R+S+F D   +   ++AA L+G D IELYT  Y   +   Q +   + 
Sbjct: 128 KEMTGIFQSAGIRVSIFVDP--DVKIVEAAALSGTDRIELYTEAY--AHQYQQNKEAAIA 183

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
                A+ A ++ L INAGHDL + N+    + IP + E+S+GHA  + AL  G++  + 
Sbjct: 184 PYIAAAEKANELGLGINAGHDLDLNNLAYFASNIPGLLEVSIGHALVSDALYLGLENTIQ 243

Query: 241 CFRRACG 247
            + R   
Sbjct: 244 LYLRQLK 250


>gi|148360404|ref|YP_001251611.1| pyridoxal phosphate biosynthetic protein PdxJ [Legionella
           pneumophila str. Corby]
 gi|296106529|ref|YP_003618229.1| pyridoxine 5-phosphate synthase [Legionella pneumophila 2300/99
           Alcoy]
 gi|91207238|sp|Q3V870|PDXJ_LEGPH RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|166219093|sp|A5IFW5|PDXJ_LEGPC RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|148282177|gb|ABQ56265.1| pyridoxal phosphate biosynthetic protein PdxJ [Legionella
           pneumophila str. Corby]
 gi|295648430|gb|ADG24277.1| pyridoxine 5-phosphate synthase [Legionella pneumophila 2300/99
           Alcoy]
 gi|307609740|emb|CBW99251.1| pyridoxal phosphate biosynthetic protein pdxJ [Legionella
           pneumophila 130b]
          Length = 248

 Score =  251 bits (641), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 83/246 (33%), Positives = 134/246 (54%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +R  R   +P+ V     A ++GA G+T+H R D RHI+  D+  I+   
Sbjct: 7   LGVNIDHIATIRQARGTRYPDPVQAAMDAEEAGADGITLHMREDLRHIQARDVRLIK--- 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    E  L+  E   PE   LVP+   +LT++ G D L ++ ++ K V
Sbjct: 64  --QVLQTRMNLELAVTEAMLDFAEEISPEHACLVPEKREELTTEGGLDILTHRNVVEKAV 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +GS +SLF D +  +   +AA   GA  IEL+TG Y    +  +++   L ++  
Sbjct: 122 RRLQLMGSEVSLFIDPDKEQI--RAAVDVGAPVIELHTGCYADATSE-EKQHYELQRIKE 178

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A  ++L +NAGH L   N+   I AI  ++E+++GHA  A AL CG+KEAV   R+
Sbjct: 179 AAEFAASLNLVVNAGHGLHYHNVKP-IAAIRELNELNIGHAIIARALFCGLKEAVRHMRQ 237

Query: 245 ACGQHL 250
              +  
Sbjct: 238 LMQEAR 243


>gi|255535997|ref|YP_003096368.1| pyridoxine 5'-phosphate synthase [Flavobacteriaceae bacterium
           3519-10]
 gi|255342193|gb|ACU08306.1| Pyridoxine 5'-phosphate synthase [Flavobacteriaceae bacterium
           3519-10]
          Length = 258

 Score =  251 bits (641), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 88/247 (35%), Positives = 136/247 (55%), Gaps = 9/247 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              +SVN+N +A LRN R    P++        + GA G+T+HPRPD+RHI   D+ +++
Sbjct: 20  MVKLSVNINKIATLRNARGGELPSVTEAAVKLQEFGAYGITIHPRPDERHITRKDVYDLK 79

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +       E NIEG P++ F++L    KPEQ+TLVPD    +TS+ GWD   +   L 
Sbjct: 80  PHV-----HTEFNIEGNPHQPFIDLVLDVKPEQVTLVPDAEDAITSNAGWDCEVHMDFLK 134

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             +A+  N G R S+F D N     ++ AK TG D IELYT  Y   Y+  ++    +  
Sbjct: 135 NVIAQFKNAGIRTSIFLDPNPG--MVKFAKETGTDRIELYTEAYARNYSEDKEA--AIRS 190

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
              TA  A++  L +NAGHDL+++N+    + IP + E+S+GHA  + AL  G++  V  
Sbjct: 191 YVETALEAERHGLGVNAGHDLSLENLKYFADNIPNLLEVSIGHALISEALYMGLENTVQS 250

Query: 242 FRRACGQ 248
           + +   +
Sbjct: 251 YLKRLAK 257


>gi|148256035|ref|YP_001240620.1| pyridoxine 5'-phosphate synthase [Bradyrhizobium sp. BTAi1]
 gi|146408208|gb|ABQ36714.1| pyridoxine 5'-phosphate synthase [Bradyrhizobium sp. BTAi1]
          Length = 257

 Score =  251 bits (641), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 70/255 (27%), Positives = 120/255 (47%), Gaps = 10/255 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LRN R    P+ V    +A+++GA G+T H R D+RHIR  D+  ++
Sbjct: 11  KLRLGVNVDHVATLRNARGGRSPDPVRAALLAIEAGADGITAHLREDRRHIRDDDMARLK 70

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I +      LN E    +  + +    +P    LVP+   +LT++ G D +     L 
Sbjct: 71  AEIAK-----PLNFEMAATDEMVRIALATRPHACCLVPERREELTTEGGLDVVGQHNALA 125

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFL 179
             +ARL++ G R+SLF   +  +   + A    A  IE++TG +     +    +     
Sbjct: 126 PAIARLNDAGIRVSLFIAADPAQI--EMAARLRAPVIEIHTGGWCDAIADGHHDKAATEW 183

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++   A+LA    L+++AGH L        I A+P I E+++G+     AL  G+ ++V
Sbjct: 184 ERIVAGARLAYSAGLEVHAGHGLDY-TTAEQIAALPEIVELNIGYFMMGEALFVGLPQSV 242

Query: 240 FCFRRACGQHLDNTM 254
              R A  +      
Sbjct: 243 RSMRVAMDRGRSRAA 257


>gi|33519986|ref|NP_878818.1| pyridoxine 5'-phosphate synthase [Candidatus Blochmannia
           floridanus]
 gi|81666892|sp|Q7VRR1|PDXJ_BLOFL RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|33504332|emb|CAD83225.1| pyridoxal phosphate biosynthetic protein [Candidatus Blochmannia
           floridanus]
          Length = 247

 Score =  251 bits (641), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 72/248 (29%), Positives = 124/248 (50%), Gaps = 9/248 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           +++N++ +A +RN R   +P+ V+   IA QSG  G+TVH R D+RHI   D+  +R   
Sbjct: 6   LALNIDHIATVRNARGTQYPDPVYAAYIAEQSGIDGITVHLREDRRHITDRDVKLLR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    +  + +  + KP    LVP+   +LT++ G D +     +   V
Sbjct: 63  --EIVQTTMNLEMAATDEMVMIACQLKPHYCCLVPERRRELTTEGGLDLIYQIDKMQNIV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L + G R+SLF D +  +    A+   G  CIEL TG Y A   N +   +   ++  
Sbjct: 121 LKLSDAGIRVSLFIDPDIEQI--DASYKIGVRCIELNTGKY-AESKNKEDRILEYRRIEK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
           + + A    L INAGH L   N+   I  +  I E+++GHA  + A+ CG+ +A+   + 
Sbjct: 178 SIKHALSYGLMINAGHGLNYDNV-KFIAMLSQIRELNIGHAIVSRAVFCGLPKAIKDMKE 236

Query: 245 ACGQHLDN 252
              +    
Sbjct: 237 LLKEFRKK 244


>gi|269140064|ref|YP_003296765.1| pyridoxal phosphate biosynthetic protein [Edwardsiella tarda
           EIB202]
 gi|267985725|gb|ACY85554.1| pyridoxal phosphate biosynthetic protein [Edwardsiella tarda
           EIB202]
 gi|304559892|gb|ADM42556.1| Pyridoxine 5'-phosphate synthase [Edwardsiella tarda FL6-60]
          Length = 243

 Score =  251 bits (641), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 74/249 (29%), Positives = 124/249 (49%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R 
Sbjct: 4   ILLGVNIDHIATLRNARGTQYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVRLLR- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               Q  +  +N+E    +  + +    +P    LVP+   ++T++ G D    +  +  
Sbjct: 63  ----QTIQTRMNLEMAVTDEMVAIACELRPHFCCLVPEKRQEVTTEGGLDVAGQRDKIAA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VARL   G ++SLF D +  +   +AA   GA  IE++TG Y    +   Q    L ++
Sbjct: 119 AVARLSAAGIQVSLFIDPDERQI--EAAVAVGAPYIEIHTGAYADAPSALAQA-AELERI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A+ A    L++NAGH LT  N+   + A+P + E+++GH+    A   G+  AV   
Sbjct: 176 AAAARFAHARGLKVNAGHGLTYHNVQA-VAALPQMHELNIGHSIIGRAALDGLNLAVRDM 234

Query: 243 RRACGQHLD 251
           ++       
Sbjct: 235 KQLLLDARR 243


>gi|325954919|ref|YP_004238579.1| pyridoxine 5'-phosphate synthase [Weeksella virosa DSM 16922]
 gi|323437537|gb|ADX68001.1| Pyridoxine 5'-phosphate synthase [Weeksella virosa DSM 16922]
          Length = 246

 Score =  251 bits (641), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 97/245 (39%), Positives = 136/245 (55%), Gaps = 9/245 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A +RN R    PN+V       Q G  G+TVHPRPD+RHIRY D+ +++
Sbjct: 1   MTKLSVNINKIATIRNARGGNMPNVVEAAIKIQQFGGQGITVHPRPDERHIRYQDVLDLQ 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            +I       E NIEG P + F++L  + KPEQ+TLVPD    +TS+ GWD +++   L+
Sbjct: 61  PIIT-----TEFNIEGKPIDRFMDLVLQVKPEQVTLVPDAEDAITSNAGWDTIKHFDYLS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +  L   G R S+F D N        A  TG D IELYT  +       +     ++ 
Sbjct: 116 EVIDVLKKAGIRTSIFLDPNPKLIDS--AAKTGTDRIELYTEEF--ATEYAKGNLDCIHP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
              TA LA K  L +NAGHDL++ NI   I  IP I E+S+GHA  + AL  G++  V C
Sbjct: 172 YRETALLAIKNGLAVNAGHDLSLDNIQYFIEQIPQIEEVSIGHALISEALYMGLENTVQC 231

Query: 242 FRRAC 246
           + R  
Sbjct: 232 YLRKI 236


>gi|119489401|ref|ZP_01622181.1| pyridoxal phosphate biosynthetic protein [Lyngbya sp. PCC 8106]
 gi|119454674|gb|EAW35820.1| pyridoxal phosphate biosynthetic protein [Lyngbya sp. PCC 8106]
          Length = 238

 Score =  251 bits (641), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 79/246 (32%), Positives = 128/246 (52%), Gaps = 11/246 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M T + VN++ +A LR  R    P+ V    IA  +GA G+TVH R D+RHI+  D+  +
Sbjct: 1   MPT-LGVNIDHIATLRQARRTVEPDPVAGAVIAELAGADGITVHLREDRRHIQERDVRLL 59

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R     +  +  LN+E  P +  + +    KP+ ITLVP+   ++T++ G D +     +
Sbjct: 60  R-----ETVRTHLNLEMAPTDEMVTIALEIKPDYITLVPERREEVTTEGGLDIVGQIERM 114

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           TK V +L + G  +SLF D N  +    A+  T A  +EL+TG Y        Q+   L 
Sbjct: 115 TKVVGQLQDAGIPVSLFIDANPAQIG--ASARTKAVFVELHTGCYADAKGE--QQDKELA 170

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L   ++LA    L++NAGH LT  N+   +  I  + E+++GH   + A+  G++ AV 
Sbjct: 171 VLIAGSKLALDAGLRVNAGHGLTYWNV-YPVACIEGMEELNIGHTIISRAVLVGLERAVR 229

Query: 241 CFRRAC 246
             ++A 
Sbjct: 230 EMKQAM 235


>gi|163759025|ref|ZP_02166111.1| Pyridoxal phosphate biosynthetic protein PdxJ [Hoeflea
           phototrophica DFL-43]
 gi|162283429|gb|EDQ33714.1| Pyridoxal phosphate biosynthetic protein PdxJ [Hoeflea
           phototrophica DFL-43]
          Length = 247

 Score =  251 bits (640), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 140/247 (56%), Positives = 180/247 (72%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVA+LRNRR+LPWP++  +G+IALQ+GA GLTVHPRPDQRHIR++DLPE+
Sbjct: 1   MPAQLSVNLNAVAMLRNRRDLPWPSVTALGRIALQNGAHGLTVHPRPDQRHIRFSDLPEL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP+AE NIEGYP + FL+L E  +PEQ+TLVPDDP Q TSDHGWDF     +L
Sbjct: 61  RALIDDEFPQAEFNIEGYPTDDFLDLVEANQPEQVTLVPDDPSQATSDHGWDFEGKGNVL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V RL   G+R+SLF D +    +L+AAK TGAD +E YTGPYG  Y++P +    L+
Sbjct: 121 RSVVQRLKKNGARVSLFCDPDATRSALEAAKATGADRVEFYTGPYGGTYDDPARAAEELD 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL     +A ++ L +NAGHDLT+ N+P L  A+P + E+S+GH   A ALE G+ E V 
Sbjct: 181 KLKTAGSIAAELGLGVNAGHDLTVDNMPGLARALPNLLEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACG 247
            F RACG
Sbjct: 241 RFVRACG 247


>gi|161350032|ref|YP_397613.2| pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. MIT 9312]
 gi|91207555|sp|Q31AB8|PDXJ_PROM9 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
          Length = 238

 Score =  251 bits (640), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 70/245 (28%), Positives = 124/245 (50%), Gaps = 10/245 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ +A +R  R    P+ V    +A   GA  +TVH R D+RHI+  D+  ++
Sbjct: 1   MATLGVNIDHIANVRQARKTVEPDPVQFAFLAELGGADSITVHLREDRRHIQDRDVFLLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  K +LN+E    E  L + ++  P+ +TLVP+   ++T++ G D   N   L 
Sbjct: 61  -----ETIKTKLNLEMAATEEMLEIAKKTLPDYVTLVPEKREEVTTEGGLDLKSNAQYLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V  L +    +S F D  G + +   +K  G D IEL+TG Y     +  ++   L +
Sbjct: 116 NFVENLKHSNIEVSAFIDPLGEQINY--SKEIGFDFIELHTGKY--AELSGSEQYKELQR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +  +  LA  + L +NAGH L   N+   I +I  ++E+++GH+  A AL  G++++V  
Sbjct: 172 IIESTHLANDLGLVVNAGHGLNYNNVKK-IASINNMNELNIGHSIVARALAIGLEKSVRE 230

Query: 242 FRRAC 246
            +   
Sbjct: 231 MKSLI 235


>gi|254436586|ref|ZP_05050080.1| pyridoxal phosphate biosynthetic protein PdxJ [Octadecabacter
           antarcticus 307]
 gi|198252032|gb|EDY76346.1| pyridoxal phosphate biosynthetic protein PdxJ [Octadecabacter
           antarcticus 307]
          Length = 245

 Score =  251 bits (640), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 68/251 (27%), Positives = 118/251 (47%), Gaps = 10/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R    P+      +A  +GA G+T H R D+RHI   D+  + 
Sbjct: 3   KLRLGVNIDHVATVRNARGGDTPDPARAAVLAQDAGADGITAHLREDRRHIGDADIDALM 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +        LN E    +    +  R+KP  + +VP+   + T++ G +  + +  L 
Sbjct: 63  DALT-----IPLNFEMAATDEMQKIALRHKPHAVCIVPEKREERTTEGGLEVAREENHLA 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQQERIFL 179
             +A L + G R+S+F   +  +   +AA   GA  IEL+TG Y   +   +       L
Sbjct: 118 HFIAPLRDAGCRVSIFIAADQRQI--EAAHRIGAQIIELHTGAYCDAHAEGDFVTSNAEL 175

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            K+   A LA  + L+++AGH LT   +   + A P I E+++GH     ++  G++ A+
Sbjct: 176 CKMRDMAALALSLGLEVHAGHGLTYDTVKP-VAAFPEIMELNIGHFLIGESIFRGLQPAI 234

Query: 240 FCFRRACGQHL 250
              RR   +  
Sbjct: 235 AEMRRLMDEAR 245


>gi|134095250|ref|YP_001100325.1| pyridoxine 5'-phosphate synthase [Herminiimonas arsenicoxydans]
 gi|133739153|emb|CAL62202.1| Pyridoxine 5'-phosphate synthase (PNP synthase) [Herminiimonas
           arsenicoxydans]
          Length = 255

 Score =  251 bits (640), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 74/253 (29%), Positives = 128/253 (50%), Gaps = 9/253 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + +N++ VA LRN R   +P  +     A ++GA  +T+H R D+RHIR  D+  IR 
Sbjct: 11  IDLGINIDHVATLRNARGTVYPYPLQAALQAEEAGADAITLHLREDRRHIRDADVELIRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +     +  +N+E       ++   R KP+ + LVP+   ++T++ G D ++  + ++ 
Sbjct: 71  QL-----RTRMNLESAVTSEMIDFACRIKPQDVCLVPERREEVTTEGGLDIVKYFSEVSA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            + +L   G R+SLF D +  +   QAA   GA  IEL+TG Y   ++   Q+ + L ++
Sbjct: 126 AIRQLQGEGIRVSLFIDADVAQI--QAAAEAGAPVIELHTGRYADAHDEAGQQ-MELQRV 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
                   K  L++NAGH L   N+   I AI  I+E+++GHA  A A+  G + AV   
Sbjct: 183 KQGVHEGVKRGLKVNAGHGLHYTNVQA-IAAIQDIAELNIGHAIVAHAVFVGWQNAVREM 241

Query: 243 RRACGQHLDNTMR 255
           +        +  +
Sbjct: 242 KAIMTAARLSGRQ 254


>gi|123966431|ref|YP_001011512.1| pyridoxine 5'-phosphate synthase [Prochlorococcus marinus str. MIT
           9515]
 gi|166219106|sp|A2BX94|PDXJ_PROM5 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|123200797|gb|ABM72405.1| Pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. MIT 9515]
          Length = 238

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 73/245 (29%), Positives = 121/245 (49%), Gaps = 10/245 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ +A +R  R    P+ V    +A   GA  +TVH R D+RHI+  D+  ++
Sbjct: 1   MATLGVNIDHIANVRQARRTVEPDPVQFAFLAELGGADSITVHLREDRRHIQDRDIFLLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  K +LN+E    E  L + ++  P+ +TLVP+   ++T++ G +   NQ  L 
Sbjct: 61  -----ETIKTKLNLEMAATEEMLKISKKLLPDFVTLVPEKREEVTTEGGLNVKNNQRYLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V  L +    +S F D    + +  A    G D IEL+TG Y       Q+  + L K
Sbjct: 116 DYVTSLKSSNIEVSAFIDPLSEQINSSA--EIGFDFIELHTGKYSEL--KGQERYVELQK 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +  +   A  + L +NAGH L  QN    I +I  I+E+++GH+  A AL  G++ AV  
Sbjct: 172 IIESTHYAFDLGLVVNAGHGLNYQNAEK-IASINNINELNIGHSIVARALAVGLERAVSE 230

Query: 242 FRRAC 246
            +   
Sbjct: 231 MKALI 235


>gi|77164313|ref|YP_342838.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosococcus oceani
           ATCC 19707]
 gi|254434738|ref|ZP_05048246.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosococcus oceani
           AFC27]
 gi|91207549|sp|Q3JCY8|PDXJ_NITOC RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|76882627|gb|ABA57308.1| pyridoxine 5'-phosphate synthase [Nitrosococcus oceani ATCC 19707]
 gi|207091071|gb|EDZ68342.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosococcus oceani
           AFC27]
          Length = 246

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 76/249 (30%), Positives = 131/249 (52%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ +     A Q+GA G+T+H R D+RHI+  D+  +R 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPIQAAIEAEQAGADGITLHLREDRRHIQERDVALLRD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +     +N+E       L + E+Y PE   LVP+   +LT++ G +     A +T+
Sbjct: 67  VLVSK-----MNLEMAVTGEMLAIAEKYCPEDCCLVPERREELTTEGGLNVTGQLARITE 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              RL   G+R+SLF D +  +  ++AA    A  IE++TG +     + +  R    ++
Sbjct: 122 ACVRLKEAGTRVSLFIDADPRQ--VEAAAQANAPVIEIHTGHFADA-RDERNRRKEFQRI 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               +  +++ LQ+NAGH L  QN+   I A+  I E+++GHA  A AL  G++ AV   
Sbjct: 179 VEAVKRGREVGLQVNAGHGLNYQNVAA-IAALSDIVELNIGHAIIARALFTGMQSAVGEM 237

Query: 243 RRACGQHLD 251
           +R   +  +
Sbjct: 238 KRLMREARE 246


>gi|188997576|ref|YP_001931827.1| pyridoxal phosphate biosynthetic protein PdxJ [Sulfurihydrogenibium
           sp. YO3AOP1]
 gi|226694871|sp|B2V6U1|PDXJ_SULSY RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|188932643|gb|ACD67273.1| pyridoxal phosphate biosynthetic protein PdxJ [Sulfurihydrogenibium
           sp. YO3AOP1]
          Length = 243

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 70/249 (28%), Positives = 123/249 (49%), Gaps = 7/249 (2%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ +A LR  R    P+ +    IA+++GA  +T+H R D+RHI+  DL  ++  
Sbjct: 2   RLGVNIDHIATLREARKTTEPDPIKGALIAIEAGADQITLHLREDRRHIQDEDLFRLK-- 59

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
            + +     +N+E  P     N+     P  +TLVP+   ++T++ G D +     L   
Sbjct: 60  CELKDTNIPINLEMAPTYEMQNIALEALPNNVTLVPEKRQEITTEGGLDVVSMIDYLKDF 119

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           +  +   G  +SLF D +  +    A+   GAD IE++TG Y   Y    ++ +   ++ 
Sbjct: 120 IKPIKQQGITVSLFIDPDYEQI--DASVEVGADAIEIHTGEYANAYGKNVEKELE--RIK 175

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A+ A++  L++ AGH LT QN+   I  I  I E+++GH+  A A+  G+ EAV   +
Sbjct: 176 KAAKYAKEKGLKVYAGHGLTYQNVSE-IAKIKEIEELNIGHSIIANAVFLGLYEAVKKMK 234

Query: 244 RACGQHLDN 252
                    
Sbjct: 235 EIILNARKE 243


>gi|315127394|ref|YP_004069397.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudoalteromonas
           sp. SM9913]
 gi|315015908|gb|ADT69246.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudoalteromonas
           sp. SM9913]
          Length = 243

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 74/248 (29%), Positives = 123/248 (49%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LR  R   +P+ VH   +A  +GA G+T+H R D+RHI+  D+     
Sbjct: 4   ILLGVNVDHIATLRQARGTSYPDPVHAASVAEHAGADGITIHLREDRRHIQDRDVY---- 59

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +  +  +  +N+E    +  + +    KPE + LVP+   +LT++ G D   N   +  
Sbjct: 60  -VMAKTIQTRMNLETAVTDEMIAIALEVKPEYVCLVPEKREELTTEGGLDVAGNIDKIAA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
               L   G ++SLF D +  +  L AAK  GA  +E++TG Y    N+ +     L  +
Sbjct: 119 ATKTLTQAGIKVSLFIDADKAQ--LDAAKACGAPYVEIHTGAYADATND-EDTAKELEHI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               + A  + L +NAGH L   N+   I A+P I E+++GHA  A A   G+ +AV   
Sbjct: 176 RQGVKYAASIGLIVNAGHGLHYHNVKP-IAAMPEIYELNIGHAIIARAAIDGLDKAVRDM 234

Query: 243 RRACGQHL 250
           +R   +  
Sbjct: 235 KRLMLEAR 242


>gi|148556774|ref|YP_001264356.1| pyridoxine 5'-phosphate synthase [Sphingomonas wittichii RW1]
 gi|148501964|gb|ABQ70218.1| pyridoxal phosphate biosynthetic protein PdxJ [Sphingomonas
           wittichii RW1]
          Length = 241

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 72/247 (29%), Positives = 122/247 (49%), Gaps = 10/247 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R    P+ +   +IA ++GA G+T H R D+RHI   D+  +   
Sbjct: 5   RLGVNIDHVATIRNARGGLHPDPIRAAEIASEAGADGITAHLREDRRHIMDDDIGRLIGG 64

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I        +N+E    E  L +  R++P    +VP+   ++T++ G D       L   
Sbjct: 65  IA-----LPINLEMAATEEMLAIALRHRPHAACIVPERREEVTTEGGLDAAGQHNHLKPL 119

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           +A+L + G R+SLF +    +   +AA    A  +E +TG Y   +   ++    L ++A
Sbjct: 120 IAKLSDAGIRVSLFIEPTPRQI--EAAVSLRAPVVEFHTGRY--AHAEGEERATELRRIA 175

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A LA K  ++ +AGH LT  N+   I AIP I+E+++GH     A+  G+   V   R
Sbjct: 176 DAAALAAKNGIEPHAGHGLTFDNVVP-IAAIPQIAELNIGHFLIGEAIFDGLAPVVRRMR 234

Query: 244 RACGQHL 250
           +   +  
Sbjct: 235 QLMDEAR 241


>gi|86134475|ref|ZP_01053057.1| pyridoxal phosphate biosynthesis protein PdxJ [Polaribacter sp.
           MED152]
 gi|85821338|gb|EAQ42485.1| pyridoxal phosphate biosynthesis protein PdxJ [Polaribacter sp.
           MED152]
          Length = 237

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 91/242 (37%), Positives = 138/242 (57%), Gaps = 9/242 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PNL+ +       GA G+T+HPRPD+RHIRY D  +++
Sbjct: 1   MTKLSVNINKIATLRNSRGGNVPNLLKVATDIEGFGAQGITIHPRPDERHIRYQDARDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++       E NIEG P ++F++L    KP Q+TLVPD    +TS+ GWD + +Q+ L 
Sbjct: 61  GVVT-----TEFNIEGNPIQSFMDLVLETKPTQVTLVPDAVDAITSNAGWDTITHQSFLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +A     G R S+F D   +   ++AA  TG D IELYT  + + ++   ++   +  
Sbjct: 116 EVIAEFQQNGIRTSIFID--TDAKLIEAAAKTGTDRIELYTEEFASQFDKGNKD--AVKP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A LA  + L INAGHDL++ NI      IP ++E+S+GHA  A +L  G++  V  
Sbjct: 172 YTEAAILAHDLGLGINAGHDLSLDNIQFFKQNIPNLAEVSIGHALIAESLYLGLENVVNM 231

Query: 242 FR 243
           + 
Sbjct: 232 YL 233


>gi|326405102|ref|YP_004285184.1| pyridoxal phosphate biosynthetic protein PdxJ [Acidiphilium
           multivorum AIU301]
 gi|325051964|dbj|BAJ82302.1| pyridoxal phosphate biosynthetic protein PdxJ [Acidiphilium
           multivorum AIU301]
          Length = 241

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 79/252 (31%), Positives = 123/252 (48%), Gaps = 15/252 (5%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VNL+ VA LRN R +  P+ +   +IA+++GA G+T+H R D+RHIR  D+   R L
Sbjct: 5   RLGVNLDHVATLRNARGIATPDPIRAARIAIEAGADGITLHLREDRRHIRDADIRAARAL 64

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
                    LN+E    +  + +    KP    LVP+   ++T++ G D       L   
Sbjct: 65  S------VPLNMEMAATDEMVGIACGLKPHASCLVPERRQEVTTEGGLDAAGTAESLAPR 118

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           +A L   G R+SLF D +  +  L+AA   GA  +EL+TG Y             L++L 
Sbjct: 119 IAALRAAGIRVSLFVDPDPVQ--LEAAARLGAPVVELHTGAYAEG------RAGELDRLR 170

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A  A  + L+++AGH L   N+   I A+P + E+++GH     A+  G+ EA+   R
Sbjct: 171 AAAARAAALGLEVHAGHGLNYDNVGP-IAALPEVRELNIGHFIVGEAVFVGLAEAIRRMR 229

Query: 244 RACGQHLDNTMR 255
                    T R
Sbjct: 230 AIMDAARRRTQR 241


>gi|313159545|gb|EFR58908.1| pyridoxine 5'-phosphate synthase [Alistipes sp. HGB5]
          Length = 237

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 95/243 (39%), Positives = 137/243 (56%), Gaps = 9/243 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +AV+RN R    P++V       + GA G+TVHPRPD RHIRY D+  ++
Sbjct: 1   MTKLSVNINKIAVVRNSRGGNLPDVVRAALDIERFGAEGITVHPRPDARHIRYDDVRNLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           R++       E NIEG P  +F++L     P Q+TLVPD    +TS+ GWD L N+  LT
Sbjct: 61  RVLA-----TEFNIEGNPIPSFVDLVLEVVPTQVTLVPDAHDAITSNAGWDTLANRGFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           +  AR H  G R+S+F D +     +  AK  GAD +ELYT  Y      P      L  
Sbjct: 116 EVTARFHEKGIRVSVFVDPDPA--MVAGAKACGADRVELYTEAY--AREYPAGAEAALAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+ A++  L +NAGHDL ++N+   ++ IP+  E+S+GHA    AL  G++  V  
Sbjct: 172 YLAAAEEARRQGLGLNAGHDLNLENLRFFVSRIPWTDEVSIGHALICDALYYGLENTVQL 231

Query: 242 FRR 244
           ++R
Sbjct: 232 YKR 234


>gi|226940392|ref|YP_002795466.1| pyridoxine 5'-phosphate synthase [Laribacter hongkongensis HLHK9]
 gi|259530375|sp|C1D7L7|PDXJ_LARHH RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|226715319|gb|ACO74457.1| PdxJ [Laribacter hongkongensis HLHK9]
          Length = 244

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 75/253 (29%), Positives = 126/253 (49%), Gaps = 9/253 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LRN R   +P+ V    +A  +GA  +T+H R D+RHI+  DL  +R
Sbjct: 1   MILLGVNIDHVATLRNARGTRYPSPVEAALVAETAGADLITLHLREDRRHIKDDDLAVMR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     K  +N+E    +  L+   R  P+ + +VP+   +LT++ G D ++    + 
Sbjct: 61  AAI-----KTRMNLEMALTDEMLDNALRVLPQDVCIVPEKREELTTEGGLDVIRYFDRIA 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G R+SLF D +  +   +A+  TGA  +EL+TG Y    ++  ++   L +
Sbjct: 116 DFTRQLQAKGIRVSLFIDPDDEQI--KASHETGATVVELHTGRYADAESHDIRQ-RELTR 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A +   + L +NAGH L+  N+   + AI  I E+++GHA  A AL  G   AV  
Sbjct: 173 IRHAAIVGVDLGLVVNAGHGLSYHNVQP-VAAIREIRELNIGHAIVAHALMVGFAPAVRE 231

Query: 242 FRRACGQHLDNTM 254
            +    +   N  
Sbjct: 232 MKALMVEARHNAA 244


>gi|54296967|ref|YP_123336.1| pyridoxine 5'-phosphate synthase [Legionella pneumophila str.
           Paris]
 gi|91207237|sp|Q3V7G1|PDXJ_LEGPA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|53750752|emb|CAH12159.1| Pyridoxal phosphate biosynthetic protein pdxJ [Legionella
           pneumophila str. Paris]
          Length = 248

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 82/246 (33%), Positives = 134/246 (54%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +R  R   +P+ V     A ++GA G+T+H R D RHI+  D+  I+   
Sbjct: 7   LGVNIDHIATIRQARGTRYPDPVQAAMDAEEAGADGITLHMREDLRHIQARDVRLIK--- 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    E  L+  E   PE   LVP+   +LT++ G D L ++ ++ + V
Sbjct: 64  --QVLQTRMNLELAVTEAMLDFAEEILPEHACLVPEKREELTTEGGLDILTHRNVVERAV 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +GS +SLF D +  +   +AA   GA  IEL+TG Y    +  +++   L ++  
Sbjct: 122 RRLQLMGSEVSLFIDPDKEQI--RAAVDVGAPVIELHTGCYADATSE-EKQHYELQRIKE 178

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A  ++L +NAGH L   N+   I AI  ++E+++GHA  A AL CG+KEAV   R+
Sbjct: 179 AAEFAASLNLVVNAGHGLHYHNVKP-IAAIRELNELNIGHAIIARALFCGLKEAVRHMRQ 237

Query: 245 ACGQHL 250
              +  
Sbjct: 238 LMQEAR 243


>gi|300776777|ref|ZP_07086635.1| pyridoxine 5'-phosphate synthase [Chryseobacterium gleum ATCC
           35910]
 gi|300502287|gb|EFK33427.1| pyridoxine 5'-phosphate synthase [Chryseobacterium gleum ATCC
           35910]
          Length = 239

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 88/247 (35%), Positives = 134/247 (54%), Gaps = 9/247 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P++        + G  G+T+HPRPD+RHI   D+ +++
Sbjct: 1   MTKLSVNINKIATLRNARGGETPSVTEAAVKIQEFGGQGITIHPRPDERHITRKDVYDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L+       E NIEG P+++F+++    KPEQ+TLVPD    +TS+ GWD  ++   LT
Sbjct: 61  PLVA-----TEFNIEGNPHKSFIDMVLDVKPEQVTLVPDADDAITSNAGWDTKKHLDYLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +A     G R S+F D       ++ A  TGAD IELYT  Y    N    +   +  
Sbjct: 116 EIIAEFKKAGIRTSIFLDPL--PELVEYAAKTGADRIELYTEAY--AKNYLTNKEQAIKP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
              TA  A    L INAGHDL+++N+    + IP + E+S+GHA  + AL  G++  V  
Sbjct: 172 YYDTAVEATNFGLGINAGHDLSLENLKYFADNIPNLLEVSIGHALVSEALYMGLENTVQA 231

Query: 242 FRRACGQ 248
           + +   +
Sbjct: 232 YLKRLAK 238


>gi|58040667|ref|YP_192631.1| pyridoxine 5'-phosphate synthase [Gluconobacter oxydans 621H]
 gi|81556919|sp|Q5FNS2|PDXJ_GLUOX RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|58003081|gb|AAW61975.1| Pyridoxal phosphate biosynthetic protein PdxJ [Gluconobacter
           oxydans 621H]
          Length = 232

 Score =  250 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 74/246 (30%), Positives = 117/246 (47%), Gaps = 15/246 (6%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LRN R   +P+ V   ++A+ SGA G+T H R D+RHIR  D+P +R
Sbjct: 1   MIRLGVNIDHVATLRNARGGTFPDPVAAAELAIASGADGITAHLREDRRHIRDADMPRLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L       A LN E    +  + +    +P    LVP+   ++T++ G D +     L 
Sbjct: 61  ALS------APLNFEMAATDEMVRIACDLRPHACCLVPEKRQEVTTEGGLDIVGQSEALK 114

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             +ARL + G R+SLF D    +    AA   GA  +EL+TG Y    +        L +
Sbjct: 115 PKIARLRDAGIRVSLFIDPEARQIETAAA--LGAPVVELHTGAYALGGSE------ELER 166

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   A       L+++AGH LT  N+   I  +  ++E+++GH     A+  G+   V  
Sbjct: 167 LRSAAGTVAACGLELHAGHGLTYDNVGA-IADLTGLAELNIGHFLIGQAIFDGLGPVVRK 225

Query: 242 FRRACG 247
            +    
Sbjct: 226 MKSLIN 231


>gi|291515263|emb|CBK64473.1| pyridoxine 5'-phosphate synthase [Alistipes shahii WAL 8301]
          Length = 238

 Score =  250 bits (638), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 98/246 (39%), Positives = 137/246 (55%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +AV+RN R    P++V       + GA G+TVHPRPD RHIRY D+ +++
Sbjct: 1   MTKLSVNINKIAVVRNSRGGNLPDVVRAALDIERFGAEGITVHPRPDARHIRYDDVRDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           R +       ELNIEG P   F++L     P Q+TLVPD    +TS+ GWD L N+A LT
Sbjct: 61  RALT-----TELNIEGNPIPGFIDLVLEVVPAQVTLVPDAHDAITSNAGWDTLANRAFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
              AR H  G R+S+F D       +  AK  GAD +ELYT  Y   Y +  Q  +    
Sbjct: 116 DVTARFHAKGIRVSVFVDPV--AEMVAGAKACGADRVELYTEAYAREYPDDPQRAVA--P 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+ A++  L +NAGHDL+++N+      IP+  E+S+GHA    AL  G++  V  
Sbjct: 172 YLAAAEEARRQGLGLNAGHDLSLENLRWFAERIPWTDEVSIGHALICDALYYGLENTVQL 231

Query: 242 FRRACG 247
           +RR   
Sbjct: 232 YRRELK 237


>gi|27380175|ref|NP_771704.1| pyridoxine 5'-phosphate synthase [Bradyrhizobium japonicum USDA
           110]
 gi|30179735|sp|O69158|PDXJ_BRAJA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|27353329|dbj|BAC50329.1| pyridoxal phosphate biosynthetic protein [Bradyrhizobium japonicum
           USDA 110]
          Length = 250

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 70/254 (27%), Positives = 121/254 (47%), Gaps = 10/254 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LRN R    P+ V    +A+++GA G+T H R D+RHIR  D+  ++
Sbjct: 5   PLRLGVNVDHVATLRNARGGRNPDPVRAALLAIEAGADGITAHLREDRRHIRDEDMARLK 64

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I +      LN E    +  + +    +P  + LVP+   ++T++ G D +     L 
Sbjct: 65  AEISK-----PLNFEMAATDDMMRISLATRPHAVCLVPERRQEVTTEGGLDVVGQHNALA 119

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ--QERIFL 179
             +ARL++ G R+SLF   +  +   + A    A  IE++TG +     +    +     
Sbjct: 120 PYIARLNDAGIRVSLFIAADPAQI--EMAARLRAPVIEIHTGAWCDAVVDGHTEKADAEW 177

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++   A+LA+   L+++AGH L        I A+P I E+++G+     AL  G+ E V
Sbjct: 178 KRIVAGAKLAKDAGLEVHAGHGLDYAT-AETIAALPDIMELNIGYYMIGEALFVGLAETV 236

Query: 240 FCFRRACGQHLDNT 253
              R A  +     
Sbjct: 237 RSMRAAMDRGRSRA 250


>gi|302383076|ref|YP_003818899.1| pyridoxal phosphate biosynthetic protein PdxJ [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193704|gb|ADL01276.1| pyridoxal phosphate biosynthetic protein PdxJ [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 255

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 75/250 (30%), Positives = 125/250 (50%), Gaps = 7/250 (2%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA +RN R   +P+ V   + AL++GA G+T H R D+RHI   D+  +  
Sbjct: 5   VRLGVNIDHVATVRNARGGLYPDPVRAAREALEAGADGITAHLREDRRHISDADIDHLSA 64

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++ +Q     LN+E    +  L +   ++P  + LVP+   + T++ G D +     +T 
Sbjct: 65  VLRDQ--DRPLNLEMAVTQEMLAIALHHRPRAVCLVPEKREERTTEGGLDVVGGHNWITP 122

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFLN 180
            V RL+  GSR+SLF   +  + +  AA  TGA  +EL+TG Y     +  P      L 
Sbjct: 123 VVGRLNEAGSRVSLFIGADPAQIA--AAHRTGAAVVELHTGAYCDAVRDGRPDDAERELV 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L   A  A  + L+++AGH +  + +   + AIP I E+++GH     A+  G+  A+ 
Sbjct: 181 ALKAGATQAHALGLEVHAGHGIDYETVAA-VAAIPEIMELNIGHFLIGEAIFVGLGPAIG 239

Query: 241 CFRRACGQHL 250
             R    Q  
Sbjct: 240 RMRALMDQAR 249


>gi|33593096|ref|NP_880740.1| pyridoxal phosphate biosynthetic protein PdxJ [Bordetella pertussis
           Tohama I]
 gi|33596390|ref|NP_884033.1| pyridoxal phosphate biosynthetic protein PdxJ [Bordetella
           parapertussis 12822]
 gi|33602321|ref|NP_889881.1| pyridoxal phosphate biosynthetic protein PdxJ [Bordetella
           bronchiseptica RB50]
 gi|81578527|sp|Q7VWW0|PDXJ_BORPE RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|81579330|sp|Q7W9J7|PDXJ_BORPA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|81579900|sp|Q7WH63|PDXJ_BORBR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|33563471|emb|CAE42356.1| pyridoxal phosphate biosynthetic protein [Bordetella pertussis
           Tohama I]
 gi|33566159|emb|CAE37063.1| pyridoxal phosphate biosynthetic protein [Bordetella parapertussis]
 gi|33576760|emb|CAE33838.1| pyridoxal phosphate biosynthetic protein [Bordetella bronchiseptica
           RB50]
 gi|332382508|gb|AEE67355.1| pyridoxine 5-phosphate synthase [Bordetella pertussis CS]
          Length = 248

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 75/255 (29%), Positives = 122/255 (47%), Gaps = 9/255 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR +R+  +P+ V     A  +GA  +T+H R D+RHI+  D+  IR
Sbjct: 1   MIELGVNIDHVATLRQQRHTAYPDPVQAALRAEDAGADLITLHLREDRRHIQDADVYAIR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   +  +N+E       L +    KP  + LVP+   +LT++ G D    QA +T
Sbjct: 61  P-----LLRTRMNLECAVTPEMLEIACAVKPSDVCLVPEKRTELTTEGGLDVAGAQAAVT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V  L   G R+SLF D +  +   +AA   GA  IEL+TG Y     +    +  L +
Sbjct: 116 DAVQLLAEAGIRVSLFIDPDARQI--EAAARAGAPVIELHTGAYAEA-RDDAAVQAELAR 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +        +  L++NAGH L   N+   + A+  I+E+++GHA  A ++  G  +AV  
Sbjct: 173 VRAAVAEGLRHGLRVNAGHGLHYGNVQA-VAALDGIAELNIGHAIVAQSIFDGWDKAVRD 231

Query: 242 FRRACGQHLDNTMRL 256
            +    Q     +R 
Sbjct: 232 MKALMVQARLAAVRG 246


>gi|93005200|ref|YP_579637.1| pyridoxal phosphate biosynthetic protein PdxJ [Psychrobacter
           cryohalolentis K5]
 gi|122415960|sp|Q1QDV0|PDXJ_PSYCK RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|92392878|gb|ABE74153.1| pyridoxal phosphate biosynthetic protein PdxJ [Psychrobacter
           cryohalolentis K5]
          Length = 264

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 76/248 (30%), Positives = 124/248 (50%), Gaps = 12/248 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R + +P+ +    +  ++GA G+T+H R D+RHI+  D+ E+   +
Sbjct: 25  LGVNVDHVATLRQARGVGYPSPLAAALLCEKAGADGITIHLREDRRHIQDADVYEMAGQL 84

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   +N+E       L++  + KP  + LVP+   +LT++ G D     A LT  V
Sbjct: 85  T-----TRMNLEMAATTEMLDIACQVKPYWVCLVPEKRAELTTEGGLDVAGQLASLTDYV 139

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGAC----YNNPQQERIFLN 180
           ++L   G ++SLF D    +  ++AA    AD IEL+TG Y         +     +   
Sbjct: 140 SQLQAAGIKVSLFIDP--EDKQIEAAVNCSADAIELHTGSYAEAGLAGKTDRVNVELERI 197

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           K A+         L +NAGH LT  N+   I  I  I E+++GHA  A AL  G+++AV 
Sbjct: 198 KNAVITAKRLDSKLLVNAGHGLTRDNVHA-IAQIDGIYELNIGHALIADALFVGIEQAVI 256

Query: 241 CFRRACGQ 248
             + A  +
Sbjct: 257 MMKTAMHR 264


>gi|258648958|ref|ZP_05736427.1| pyridoxine 5'-phosphate synthase [Prevotella tannerae ATCC 51259]
 gi|260850561|gb|EEX70430.1| pyridoxine 5'-phosphate synthase [Prevotella tannerae ATCC 51259]
          Length = 237

 Score =  249 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 96/246 (39%), Positives = 138/246 (56%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P+++ +    ++ GA G+TVHPRPD+RHIR +D+  +R
Sbjct: 1   MTKLSVNINKIATLRNARGGNNPDVLAVALDCVRFGAQGITVHPRPDERHIRRSDVHLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +D      E NIEGYP++ F++L     P Q+TLVPD P QLTS+HGWD   N + LT
Sbjct: 61  PALD-----VEFNIEGYPSDDFIDLVCEVGPAQVTLVPDKPGQLTSNHGWDTRANLSQLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V R    G R S+F          + AK  GAD +ELYT PY A Y   ++    +  
Sbjct: 116 DIVGRFKEKGIRTSIFISA--ENEMAEYAKRAGADRVELYTEPYAANYATDREA--AIRP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
              TA   +++ L +NAGHDL++QN+      IP+  E+S+GHA  + AL  G+   +  
Sbjct: 172 FVETADYVRQIGLGLNAGHDLSLQNLSFFHQQIPWADEVSIGHALISDALYLGLHNTIQQ 231

Query: 242 FRRACG 247
           +     
Sbjct: 232 YLNCLK 237


>gi|332284260|ref|YP_004416171.1| pyridoxal phosphate biosynthetic protein PdxJ [Pusillimonas sp.
           T7-7]
 gi|330428213|gb|AEC19547.1| pyridoxal phosphate biosynthetic protein PdxJ [Pusillimonas sp.
           T7-7]
          Length = 244

 Score =  249 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 73/245 (29%), Positives = 123/245 (50%), Gaps = 9/245 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR +R   +P+ +     A ++GA  +T+H R D+RHI+  D+  +R
Sbjct: 1   MIELGVNIDHVATLRQQRYTSYPDPIQAALRAEEAGADLITLHLREDRRHIQDADVEAMR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   +  +N+E       L++  R +P+ + LVP+   +LT++ G D L     + 
Sbjct: 61  P-----LLRTRMNLECAVTSEMLDIACRVRPQDVCLVPEKRAELTTEGGLDVLGRFEQVR 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + VA+L + G R+SLF D    +    AA+  GA  IEL+TG Y             L +
Sbjct: 116 QAVAQLQDAGIRVSLFIDPEAEQI--DAAQRAGATVIELHTGAYADAGG-QAASDFELAR 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L     L  +  L++NAGH L   N+   I  +P ++E+++GHA  A A+  G ++AV  
Sbjct: 173 LRAGIALGVRHGLRVNAGHGLHYDNVQT-IAEMPGLAELNIGHAIVARAVFDGWEKAVRD 231

Query: 242 FRRAC 246
            +   
Sbjct: 232 MKALM 236


>gi|91207219|sp|Q3M9L4|PDXJ_ANAVT RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
          Length = 239

 Score =  249 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 72/246 (29%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ +A +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MATLGVNIDHIATIRQARRTVEPDPVAAAVLAELGGADGITVHLREDRRHIQDRDVQLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  +  LN+E    +  + +    KP+ +TLVP+   ++T++ G D +   A + 
Sbjct: 61  -----QTVRTHLNLEMAATDEMVGIALDIKPDYVTLVPEKREEVTTEGGLDIVGQIARIG 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V++L N    +SLF D    +   +A+    A  IEL+TG Y    +   +++     
Sbjct: 116 EVVSKLQNAAIPVSLFIDAEPAQI--EASVKVQAKFIELHTGRYAEATDETSRQQELAF- 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           LA   + A K  L++NAGH LT  N+   + A+P + E+++GH   + A   G++ AV  
Sbjct: 173 LATGCEQAIKAGLRVNAGHGLTYWNV-YPVAALPGMEELNIGHTIISRAALVGIERAVRE 231

Query: 242 FRRACG 247
            ++A  
Sbjct: 232 MKQAIR 237


>gi|113953542|ref|YP_730361.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. CC9311]
 gi|122945712|sp|Q0IB11|PDXJ_SYNS3 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|113880893|gb|ABI45851.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           CC9311]
          Length = 249

 Score =  249 bits (637), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 77/256 (30%), Positives = 133/256 (51%), Gaps = 10/256 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V +  +A   GA G+T+H R D+RHI+  DL  + 
Sbjct: 1   MASLGVNIDHIANVRQARRTVEPDPVPMALMAELGGADGITIHLREDRRHIQDRDLTLL- 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  +  LN+E       + +  R +P+ +TLVP+   ++T++ G D       L+
Sbjct: 60  ----GQTVRTRLNLEMAATTEMVEIALREQPDMVTLVPERREEVTTEGGLDVRSQCKSLS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             +  L +    +SLF D + N+  L+A + +GA  +EL+TG Y     + +++ I L +
Sbjct: 116 SVIDTLQSNDIPVSLFVDPDRNQ--LEACQQSGARWVELHTGRYAEA--SWREQPITLAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L    + A+ M L++NAGH LT QN+   I AI  + E+++GH   A AL  G++EAV  
Sbjct: 172 LIEATEQARSMGLRVNAGHGLTYQNVEP-IAAIAGMEELNIGHTIVARALCVGLQEAVRE 230

Query: 242 FRRACGQHLDNTMRLT 257
            +        + +  +
Sbjct: 231 MKCLVQNPRRDPLFGS 246


>gi|315225278|ref|ZP_07867095.1| pyridoxine 5'-phosphate synthase [Capnocytophaga ochracea F0287]
 gi|314944961|gb|EFS96993.1| pyridoxine 5'-phosphate synthase [Capnocytophaga ochracea F0287]
          Length = 238

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 93/242 (38%), Positives = 136/242 (56%), Gaps = 9/242 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P+L+ + K   Q GA G+T+HPRP++RHIRY D  ++ 
Sbjct: 1   MTKLSVNINKIATLRNARGGNIPDLLQVAKDVQQFGAEGITIHPRPNERHIRYQDAFDL- 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    E NIEG P   F++L  + KP Q+TLVPD    +TS+ GWD +++++ LT
Sbjct: 60  ----LKVVTTEYNIEGNPIPKFIDLVLQVKPTQVTLVPDAEDAITSNAGWDTVKHKSFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + VA     G R SLF D      +  AA  TGAD +ELYT  Y       + ++  +  
Sbjct: 116 EVVAEFKRNGIRTSLFVDPVEAMVT--AAATTGADRVELYTERY--AREYARGDKTQIAP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A  AQK+ L +NAGHDL++ N+    + IP + E+S+GHA    AL  G++  V  
Sbjct: 172 YIKAALEAQKVGLGLNAGHDLSLDNMKYFKDNIPNLLEVSIGHALICEALYLGLENVVQL 231

Query: 242 FR 243
           + 
Sbjct: 232 YL 233


>gi|317406701|gb|EFV86864.1| pyridoxine 5'-phosphate synthase [Achromobacter xylosoxidans C54]
          Length = 246

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 123/255 (48%), Gaps = 10/255 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR +R+  +P+ V     A  +GA  +T+H R D+RHI+  D+  IR
Sbjct: 1   MIELGVNIDHVATLRQQRHTTYPDPVAAALRAEDAGADLITLHLREDRRHIQDADVYAIR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E       L +    KP  + LVP+   +LT++ G +     + +T
Sbjct: 61  PRL-----RTRMNLECAVTPEMLEIACAVKPNDVCLVPEKRTELTTEGGLEVAGALSAVT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V  L   G R+SLF D +  +   +AA   GA  IEL+TG         +  +  L +
Sbjct: 116 DAVGLLTETGIRVSLFIDPDPAQI--EAAARAGAPVIELHTGA--YAEAEGEAAQAELER 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           + +      +  L++NAGH L   N+   + A+  ISE+++GHA  A A+  G ++AV  
Sbjct: 172 IRVAVAEGLRHGLRVNAGHGLHYGNVKP-VAALDGISELNIGHAIVAQAVFDGWEKAVRD 230

Query: 242 FRRACGQHLDNTMRL 256
            +    Q     +R 
Sbjct: 231 MKALMVQARLEALRG 245


>gi|86130760|ref|ZP_01049359.1| pyridoxine 5'-phosphate synthase [Dokdonia donghaensis MED134]
 gi|85818171|gb|EAQ39331.1| pyridoxine 5'-phosphate synthase [Dokdonia donghaensis MED134]
          Length = 240

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 93/246 (37%), Positives = 133/246 (54%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    P+L+ +     + GA G+T+HPRPD+RHIRY D  ++ 
Sbjct: 4   MTKLSVNINKVATLRNARGGNVPDLLKVASDLEKMGAQGITIHPRPDERHIRYQDARDL- 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                     E NIEG P + F++L    KP Q+TLVPD    +TS+ GWD ++++  L 
Sbjct: 63  ----VDVVTTEFNIEGNPIQKFIDLVLETKPTQVTLVPDAVDAITSNAGWDTIKHKDFLK 118

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +A   N G R S+F D       ++ AK TGAD IELYT  Y   Y     +   +  
Sbjct: 119 EVIAEFQNAGIRTSIFVDPV--LEMIEGAKETGADRIELYTEAYADGYTE--NKDEAIKP 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A LA  + + INAGHDL++ N+    N+IP + E+S+GHA  A +L  G +  V  
Sbjct: 175 YIAAAFLASDLGIGINAGHDLSLDNVAYFHNSIPDLLEVSIGHALMAESLYLGFETVVAS 234

Query: 242 FRRACG 247
           +     
Sbjct: 235 YLEKLQ 240


>gi|325293390|ref|YP_004279254.1| Pyridoxine 5'-phosphate synthase [Agrobacterium sp. H13-3]
 gi|325061243|gb|ADY64934.1| Pyridoxine 5'-phosphate synthase [Agrobacterium sp. H13-3]
          Length = 251

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 147/249 (59%), Positives = 183/249 (73%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++ H G IAL +GASGLTVHPRPDQRHIR++DLP +
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPDVAHFGHIALAAGASGLTVHPRPDQRHIRFSDLPVL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID+ FP AE NIEGYP E FL LCE+ +PEQ+TLVPDDP Q TSDHGWDF ++   L
Sbjct: 61  RALIDDSFPSAEFNIEGYPTEDFLVLCEQTQPEQVTLVPDDPSQATSDHGWDFRKHAVFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            + V RL   G R+SLFADG+G   +++ A  TGA  IELYTGPYG C+++PQ+    L 
Sbjct: 121 REAVGRLKAGGMRVSLFADGDGEREAVELAAETGAARIELYTGPYGGCFDDPQKGDALLE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL  TA  A  + L +NAGHDLT+ N+P L+  IPY++E+S+GH   A ALE G+ E V 
Sbjct: 181 KLGQTADYAAALGLAVNAGHDLTVANLPKLMKRIPYLAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQH 249
            F RACGQ 
Sbjct: 241 RFCRACGQA 249


>gi|148261612|ref|YP_001235739.1| pyridoxal phosphate biosynthetic protein PdxJ [Acidiphilium cryptum
           JF-5]
 gi|146403293|gb|ABQ31820.1| pyridoxine 5'-phosphate synthase [Acidiphilium cryptum JF-5]
          Length = 241

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 79/252 (31%), Positives = 123/252 (48%), Gaps = 15/252 (5%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VNL+ VA LRN R +  P+ +   +IA+++GA G+T+H R D+RHIR  D+   R L
Sbjct: 5   RLGVNLDHVATLRNARGIATPDPIRAARIAIEAGADGITLHLREDRRHIRDADIHAARAL 64

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
                    LN+E    +  + +    KP    LVP+   ++T++ G D       L   
Sbjct: 65  S------VPLNMEMAATDEMVGIACGLKPHASCLVPERRQEVTTEGGLDAAGTAESLAPR 118

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           +A L   G R+SLF D +  +  L+AA   GA  +EL+TG Y             L++L 
Sbjct: 119 IAALRAAGIRVSLFVDPDPVQ--LEAAARLGAPVVELHTGAYAEG------RAGELDRLR 170

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A  A  + L+++AGH L   N+   I A+P + E+++GH     A+  G+ EA+   R
Sbjct: 171 AAAARAAALGLEVHAGHGLNYDNVGP-IAALPEVRELNIGHFIVGEAVFVGLAEAIRRMR 229

Query: 244 RACGQHLDNTMR 255
                    T R
Sbjct: 230 AIMDAARRRTQR 241


>gi|149913465|ref|ZP_01901998.1| pyridoxal phosphate biosynthetic protein PdxJ [Roseobacter sp.
           AzwK-3b]
 gi|149812585|gb|EDM72414.1| pyridoxal phosphate biosynthetic protein PdxJ [Roseobacter sp.
           AzwK-3b]
          Length = 250

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 75/251 (29%), Positives = 124/251 (49%), Gaps = 10/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R   +P+ V   K+A ++GA G+T H R D+RHI   D+  + 
Sbjct: 6   KLRLGVNIDHVATVRNARGSAYPDPVRAAKLAEEAGADGITAHLREDRRHIADADIERLM 65

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             ++       LN E         +  R+KP  + +VP+   + T++ G D  +++A L 
Sbjct: 66  AALER-----PLNFEMAATAEMQAIALRHKPHAVCIVPEKREERTTEGGLDVARDEAALA 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNP--QQERIFL 179
             +A L + G R+SLF         ++AA   GA  +EL+TG Y   +      +    L
Sbjct: 121 GFIAPLSDAGCRVSLFIG--HEPRQIEAAARVGAAVVELHTGAYCDLHYEGRLNERDAEL 178

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             L   A LA  + L+++AGH LT + +   I AIP + E+++GH   A A+  G+  A+
Sbjct: 179 AALCEGAALAHSLGLEVHAGHGLTFETVKP-IAAIPQVIELNIGHFLIAEAIFLGLGPAI 237

Query: 240 FCFRRACGQHL 250
              RR   +  
Sbjct: 238 AEMRRLMDEAR 248


>gi|257486567|ref|ZP_05640608.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|331010049|gb|EGH90105.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 246

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 80/244 (32%), Positives = 122/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKS 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D +  + +  A+K  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLAKIGCEVSLFIDADERQIA--ASKRVGAPAIELHTGRYADA-QTPTEVAEELQRI 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ADGVAFGVAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVAEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|330877432|gb|EGH11581.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 246

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 80/244 (32%), Positives = 121/244 (49%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLK- 65

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 66  ----EVLQTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVSGQEARIKA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D +  + +  A+K  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLAKIGCEVSLFIDADERQIA--ASKRVGAPAIELHTGRYADA-QTPTEVAEELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ADGVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVSEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|167041986|gb|ABZ06723.1| putative Pyridoxal phosphate biosynthesis protein PdxJ [uncultured
           marine microorganism HF4000_141E02]
          Length = 258

 Score =  249 bits (635), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 76/248 (30%), Positives = 130/248 (52%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V I  IA ++GA  +TVH R D+RHI+ TD+  +  
Sbjct: 20  ILLGVNVDHVATLRQVRGTSYPDPVEIALIAEENGADSITVHLREDRRHIQDTDVERL-- 77

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  K  +N+E   N+  ++     KP    LVP+   +LT++ G D       L +
Sbjct: 78  ---IRLVKTRVNLEMAVNDGIIDFACSVKPSDCCLVPEKRQELTTEGGLDVFSQMDRLAE 134

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              RL N G R++ F D       ++++++ GA+ +EL+TG Y     + +Q++  LN++
Sbjct: 135 ASERLKNSGIRVAYFVDP--EPKQIESSRMAGAEVVELHTGTYADA-LSQKQKKYELNRI 191

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A    K+ L+++AGH L  +N    I AI  I E+++GHA  A +L+ G+ +AV   
Sbjct: 192 RECAAHGTKIGLKVHAGHGLHYENTAQ-IAAISEILELNIGHAIVAKSLDLGIAKAVADM 250

Query: 243 RRACGQHL 250
           ++      
Sbjct: 251 KKIMLGAR 258


>gi|289628147|ref|ZP_06461101.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289649887|ref|ZP_06481230.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|330871238|gb|EGH05947.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 246

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 80/244 (32%), Positives = 122/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKS 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D +  + +  A+K  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLAKIGCEVSLFIDADERQIA--ASKRVGAPAIELHTGRYADA-QTPTEVAEELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ADGVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKSAVAEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|114770103|ref|ZP_01447641.1| pyridoxal phosphate biosynthetic protein [alpha proteobacterium
           HTCC2255]
 gi|114548940|gb|EAU51823.1| pyridoxal phosphate biosynthetic protein [alpha proteobacterium
           HTCC2255]
          Length = 252

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 63/249 (25%), Positives = 119/249 (47%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R   +P+ +    +A ++GA G+T H R D+RHI   D+  +   
Sbjct: 10  RLGVNIDHVATVRNARGGKYPDPLRAALLAEKAGADGITAHLREDRRHITDQDIESLIDG 69

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +        LN E    +   ++  R+ P  + +VP+   + T++ G +  + +  +   
Sbjct: 70  L-----NVPLNFEMAATKEMQDIALRHIPHAVCIVPEKREERTTEGGLEVAREENKIGDF 124

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI--FLNK 181
           +A L   G R+S+F   +  +     A   GA  IEL+TG Y   +   + E     L +
Sbjct: 125 IAPLREAGCRVSIFIAADKRQIES--AARIGAPVIELHTGAYCDAHAEGRIEDCRAELQR 182

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L+  ++ A ++ L+++AGH LT   +   I A P + E+++GH     ++  G++ A+  
Sbjct: 183 LSEMSEYANELGLEVHAGHGLTFGCVKP-IAAFPQVMELNIGHFLIGESIYIGLEAAIKK 241

Query: 242 FRRACGQHL 250
            R       
Sbjct: 242 MRNLMNDAR 250


>gi|167041429|gb|ABZ06181.1| putative Pyridoxal phosphate biosynthesis protein PdxJ [uncultured
           marine microorganism HF4000_006O13]
          Length = 258

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 76/248 (30%), Positives = 130/248 (52%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V I  IA ++GA  +TVH R D+RHI+ TD+  +  
Sbjct: 20  ILLGVNVDHVATLRQVRGTSYPDPVEIALIAEENGADSITVHLREDRRHIQDTDVERL-- 77

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  K  +N+E   N+  ++     KP    LVP+   +LT++ G D       L +
Sbjct: 78  ---IRLVKTRVNLEMAVNDEIIDFACSVKPSDCCLVPEKRQELTTEGGLDVFSQMDRLAE 134

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              RL N G R++ F D       ++++++ GA+ +EL+TG Y     + +Q++  LN++
Sbjct: 135 ASERLKNSGIRVAYFVDP--EPKQIESSRMAGAEVVELHTGTYADA-LSQKQKKYELNRI 191

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A    K+ L+++AGH L  +N    I AI  I E+++GHA  A +L+ G+ +AV   
Sbjct: 192 RECAAHGTKIGLKVHAGHGLHYENTAQ-IAAISEILELNIGHAIVAKSLDLGIAKAVADM 250

Query: 243 RRACGQHL 250
           ++      
Sbjct: 251 KKIMLGAR 258


>gi|40063415|gb|AAR38226.1| pyridoxal phosphate biosynthetic protein PdxJ [uncultured marine
           bacterium 580]
          Length = 240

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 70/244 (28%), Positives = 122/244 (50%), Gaps = 10/244 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +R  R   +P+++    +A Q+GA  +T+H R D+RH++  DL E++   
Sbjct: 3   LGVNIDHIATIRQARGTNYPSVLDAATLAEQAGADSITLHLREDRRHMQDKDLYELKP-- 60

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K ++N+E  P    L +     PE + LVP+   + T++ G D ++    + K  
Sbjct: 61  ---LLKTKMNLELAPVPEMLKIALDVHPEDVCLVPERREERTTEGGLDLIKKFYDIKKIS 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L N G R+SLF     ++     A       IEL+TG Y     + + +   L K+  
Sbjct: 118 DYLTNAGIRVSLFIAPEIDQIDK--AIQMQVPIIELHTGNY--ADFDGELKNKELKKIQQ 173

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             + A+   L +NAGH L  +N+ N++  I  I E+++GHA  A AL  G + AV   ++
Sbjct: 174 AVEYAKNAGLLVNAGHGLHYENVQNIV-KIDGIHELNIGHAIVAKALFIGWENAVIEMKK 232

Query: 245 ACGQ 248
              +
Sbjct: 233 IIKE 236


>gi|213971116|ref|ZP_03399235.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas syringae
           pv. tomato T1]
 gi|301381867|ref|ZP_07230285.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063243|ref|ZP_07254784.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. tomato
           K40]
 gi|302132835|ref|ZP_07258825.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213924105|gb|EEB57681.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas syringae
           pv. tomato T1]
          Length = 246

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 79/244 (32%), Positives = 122/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D +  + +  A+K  GA  +EL+TG Y      P +    L ++
Sbjct: 122 AVERLAKIGCEVSLFIDADERQIA--ASKRVGAPAVELHTGRYADA-QTPTEVAEELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ADGVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVSEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|86135723|ref|ZP_01054302.1| pyridoxal phosphate biosynthetic protein [Roseobacter sp. MED193]
 gi|85826597|gb|EAQ46793.1| pyridoxal phosphate biosynthetic protein [Roseobacter sp. MED193]
          Length = 249

 Score =  248 bits (634), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 71/250 (28%), Positives = 119/250 (47%), Gaps = 10/250 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R    P+ V    +A  +GA G+T H R D+RHI   D+  +   
Sbjct: 7   RLGVNIDHVATVRNARGGDNPDPVRAAVLAQNAGADGITAHLREDRRHIVDADIDGLMAA 66

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     +  LN E    E    +  R+KP  + LVP+   + T++ G D   N   L   
Sbjct: 67  L-----RIPLNFEMAATEEMQAIALRHKPHAVCLVPEKREERTTEGGLDVAGNDNALADY 121

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFLNK 181
           +A L   GSR+S+F     ++  ++A+   GA  IEL+ G Y   +     ++    L K
Sbjct: 122 IAPLRAAGSRVSMFIGAEKSQ--VEASHRIGAPVIELHAGAYADAWAEGRWEERDAELAK 179

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A  A  + L+++ GH LT +++   I A+P + E+++GH     A+  G+  A+  
Sbjct: 180 ITEMATFAHGLGLEVHVGHGLTYESVGP-IAALPEVKELNIGHFLMGEAMFVGLPAALAE 238

Query: 242 FRRACGQHLD 251
            RR       
Sbjct: 239 MRRQMDLARQ 248


>gi|119944415|ref|YP_942095.1| pyridoxal phosphate biosynthetic protein PdxJ [Psychromonas
           ingrahamii 37]
 gi|119863019|gb|ABM02496.1| pyridoxal phosphate biosynthetic protein PdxJ [Psychromonas
           ingrahamii 37]
          Length = 244

 Score =  248 bits (634), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 77/249 (30%), Positives = 129/249 (51%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LRN R   +P   H+  IA  +GA G+T+H R D+RHI   D+  +  
Sbjct: 4   ILLGVNIDHIATLRNARGTCYPEPAHLAAIAECAGADGITIHLREDRRHINDRDVAVL-- 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               Q  +  +N+E    +  +++  + KP  + LVP+   +LT++ G + + + + +  
Sbjct: 62  ---AQTLQTRMNLEMAVTDEMVDIALKTKPAFVCLVPEKREELTTEGGLNVVASFSKIAS 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V+RL+    ++SLF D    +    AA  TGA  IEL+TG Y    +   Q+   L ++
Sbjct: 119 AVSRLNAAAIQVSLFIDPENAQI--DAAIKTGAAYIELHTGKYADAPSEDIQQ-FELMRV 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A  A +  +++NAGH L   N+   I A+P I E+++GHA  A AL  G   AV   
Sbjct: 176 AKAATYASQAGIKVNAGHGLNYHNVKP-IAALPEIIELNIGHAIVARALVDGFGPAVAEM 234

Query: 243 RRACGQHLD 251
           +R   +  +
Sbjct: 235 KRLMVEGRN 243


>gi|159185015|ref|NP_354993.2| pyridoxal phosphate biosynthetic protein PdxJ [Agrobacterium
           tumefaciens str. C58]
 gi|22653931|sp|Q8UDU5|PDXJ_AGRT5 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|159140289|gb|AAK87778.2| pyridoxal phosphate biosynthesis protein [Agrobacterium tumefaciens
           str. C58]
          Length = 251

 Score =  248 bits (634), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 142/248 (57%), Positives = 182/248 (73%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++ H G+IAL +GASGLTVHPRPDQRHIR++DLP +
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPDVAHFGQIALSAGASGLTVHPRPDQRHIRFSDLPVL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP AE NIEGYP E FL LCE+ +PEQ+TLVPDDP Q TSDHGWDF ++   L
Sbjct: 61  RALIDDRFPGAEFNIEGYPTEDFLVLCEKTQPEQVTLVPDDPSQATSDHGWDFRKHAVFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V RL   G R+SLFADG+G    ++ A  TGA  IELYTGPYG C+++ Q+  + + 
Sbjct: 121 KDVVGRLKAGGMRVSLFADGDGEREPVELAAETGAARIELYTGPYGGCFDDTQKADLLVE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL  TA  A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A A+E G+ E V 
Sbjct: 181 KLGQTADHAAALGLAVNAGHDLTVANLPKLMKRIPNLAEVSIGHGLTADAMEYGMAETVR 240

Query: 241 CFRRACGQ 248
            F +ACGQ
Sbjct: 241 RFCQACGQ 248


>gi|283780002|ref|YP_003370757.1| pyridoxal phosphate biosynthetic protein PdxJ [Pirellula staleyi
           DSM 6068]
 gi|283438455|gb|ADB16897.1| pyridoxal phosphate biosynthetic protein PdxJ [Pirellula staleyi
           DSM 6068]
          Length = 236

 Score =  248 bits (634), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 72/246 (29%), Positives = 126/246 (51%), Gaps = 10/246 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +R  R    P+ V    +A   GA  +TVH R D RHI+  D+  +R
Sbjct: 1   MPELGVNIDHVATIRQARKTYEPDPVAAAVLAELGGADTITVHLREDMRHIQTRDVRVLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    +LN+E       + L  + KP+Q TLVP+   ++T++ G D + ++A + 
Sbjct: 61  -----ETVHIKLNLELSVAPEIVELACQVKPDQATLVPERREEVTTEGGLDVVSHEAAVA 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + + +L   G  +SLF D +  +  L+AAK  G++ +EL+TG Y         +   L K
Sbjct: 116 RAMEKLQKAGIPVSLFLDPDSRQ--LEAAKRLGSEAVELHTGQY--ALTKGAAQHEELVK 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L     L + + + ++AGH L   N+   + AI  + E+++GH+  A A+  G++ AV  
Sbjct: 172 LTNAGALIRSLGMALHAGHGLNYYNVKP-VAAIDGMHELNIGHSIVARAVFVGLERAVRE 230

Query: 242 FRRACG 247
            ++  G
Sbjct: 231 MKQLIG 236


>gi|327398745|ref|YP_004339614.1| Pyridoxine 5'-phosphate synthase [Hippea maritima DSM 10411]
 gi|327181374|gb|AEA33555.1| Pyridoxine 5'-phosphate synthase [Hippea maritima DSM 10411]
          Length = 243

 Score =  248 bits (634), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 79/247 (31%), Positives = 135/247 (54%), Gaps = 9/247 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +R  R    P  ++   +  ++ A G+T+H R D+RHI+  D+ ++R  
Sbjct: 2   RLGVNIDHVATIREARKTNEPEPIYAALLVQEALADGITMHLREDRRHIQDRDVYQVR-- 59

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +  K  LN+E   NE  + +    KP Q TLVP++  ++T++ G D + N   +++ 
Sbjct: 60  ---EIVKIPLNLEMSLNEEIVRIALDVKPHQATLVPENRQEITTEGGLDVVANSDRVSEV 116

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           + RL   G  +SLF D    +     AK  GAD IEL+TG Y    ++  ++R+ L KL 
Sbjct: 117 IKRLKGEGILVSLFIDPQEWQIEQ--AKNLGADAIELHTGNYANAKHDM-EKRLELEKLI 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A+ A+ + L ++AGH LT +N+   + AI  I E+++GH+  A ++  G+KEAV   R
Sbjct: 174 DAAKYAKSLGLHVHAGHGLTYENVKP-VAAIKEIEELNIGHSIIAKSVFVGMKEAVSLMR 232

Query: 244 RACGQHL 250
           +   +  
Sbjct: 233 QLIHEAR 239


>gi|17227714|ref|NP_484262.1| pyridoxine 5'-phosphate synthase [Nostoc sp. PCC 7120]
 gi|20138999|sp|Q8Z080|PDXJ_ANASP RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|17135196|dbj|BAB77742.1| pyridoxal phosphate biosynthetic protein [Nostoc sp. PCC 7120]
          Length = 239

 Score =  248 bits (634), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 71/246 (28%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ +A +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MATLGVNIDHIATIRQARRTVEPDPVAAAVLAELGGADGITVHLREDRRHIQDRDVQLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  LN+E    +  + +    KP+ +TLVP+   ++T++ G D +   A + 
Sbjct: 61  HTV-----RTHLNLEMAATDEMVGIALDIKPDYVTLVPEKREEVTTEGGLDIVGQIARIG 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V++L N    +SLF D   ++   +A+    A  IEL+TG Y    +   +++     
Sbjct: 116 EVVSKLQNAAIPVSLFIDAEPSQI--EASVKVQAKFIELHTGRYAEATDETSRQQELAF- 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           LA   + A K  L++NAGH LT  N+   + A+P + E+++GH   + A   G++ AV  
Sbjct: 173 LAAGCEQAIKAGLRVNAGHGLTYWNV-YPVAALPGMEELNIGHTIISRAALVGIERAVRE 231

Query: 242 FRRACG 247
            ++A  
Sbjct: 232 MKQAIR 237


>gi|83951640|ref|ZP_00960372.1| pyridoxal phosphate biosynthetic protein [Roseovarius nubinhibens
           ISM]
 gi|83836646|gb|EAP75943.1| pyridoxal phosphate biosynthetic protein [Roseovarius nubinhibens
           ISM]
          Length = 249

 Score =  248 bits (634), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 70/249 (28%), Positives = 118/249 (47%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R   +P+ V   K+A ++GA G+T H R D+RHI   D+  +   
Sbjct: 8   RLGVNIDHVATIRNARGGAYPDPVRAAKLAEEAGADGITAHLREDRRHILDADIDGLM-- 65

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +     LN E    +    +  R+KP  + +VP+   + T++ G +  + +  L   
Sbjct: 66  ---EALTVPLNFEMAATDEMQAIALRHKPHAVCIVPEKREERTTEGGLEVAREENKLAHF 122

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGA--CYNNPQQERIFLNK 181
           +A L   G R+S+F   +  +   +AA   GA+ IEL+TG Y       +       L  
Sbjct: 123 IAPLREAGCRVSIFIAADRAQI--EAAHRIGAEVIELHTGAYCDYHAEGDFAARDRELVA 180

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   A  A  + L+++AGH LT   +   I A+P + E+++GH     A+  G+  A+  
Sbjct: 181 LTEMATFAHSLGLEVHAGHGLTYDTVAP-IAALPEVRELNIGHFLIGEAIFRGLTPAIAE 239

Query: 242 FRRACGQHL 250
            R A     
Sbjct: 240 MRAAMDAAR 248


>gi|28871356|ref|NP_793975.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|38257961|sp|Q87XG4|PDXJ_PSESM RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|28854607|gb|AAO57670.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|331015604|gb|EGH95660.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 246

 Score =  248 bits (633), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 79/244 (32%), Positives = 122/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D +  + +  A+K  GA  +EL+TG Y      P +    L ++
Sbjct: 122 AVERLAKIGCEVSLFIDADERQIA--ASKRVGAPAVELHTGRYADA-QTPTEVAEELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ADGVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVAEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|270159974|ref|ZP_06188630.1| pyridoxal phosphate biosynthetic protein PdxJ [Legionella
           longbeachae D-4968]
 gi|289165282|ref|YP_003455420.1| Pyridoxal phosphate biosynthetic protein pdxJ [Legionella
           longbeachae NSW150]
 gi|269988313|gb|EEZ94568.1| pyridoxal phosphate biosynthetic protein PdxJ [Legionella
           longbeachae D-4968]
 gi|288858455|emb|CBJ12333.1| Pyridoxal phosphate biosynthetic protein pdxJ [Legionella
           longbeachae NSW150]
          Length = 248

 Score =  248 bits (633), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 84/249 (33%), Positives = 133/249 (53%), Gaps = 9/249 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ +A +R  R   +P+ V     A ++GA G+T+H R D RHI+  D+  IR
Sbjct: 4   PIFLGVNIDHIATVRQARGTRYPDPVQAAIDAEEAGADGITLHMREDLRHIQARDVRLIR 63

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  +  +N+E    E  LN  E   PE   LVP+   +LT++ G D + +  ++ 
Sbjct: 64  -----QVLQTRMNLELAVTEAMLNFAEEISPEHTCLVPEKREELTTEGGLDIITHHKIVE 118

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V RL  +GS +SLF D +  +   +AA   GA  IEL+TG Y       +Q++  L +
Sbjct: 119 QAVRRLQAMGSEVSLFIDPDLEQI--KAAAEIGAPVIELHTGCYADATG-VEQQQHELER 175

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A+ A  ++L +NAGH L   N+ + I AI  + E+++GHA  A AL CG+KEAV  
Sbjct: 176 IKRAAEYAAGLNLIVNAGHGLNYHNVQS-IAAIKELHELNIGHAIIARALFCGMKEAVRH 234

Query: 242 FRRACGQHL 250
            R+   +  
Sbjct: 235 MRQLMQEAR 243


>gi|327402128|ref|YP_004342966.1| pyridoxine 5'-phosphate synthase [Fluviicola taffensis DSM 16823]
 gi|327317636|gb|AEA42128.1| pyridoxine 5'-phosphate synthase [Fluviicola taffensis DSM 16823]
          Length = 238

 Score =  248 bits (633), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 93/246 (37%), Positives = 138/246 (56%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A +RN R    PN+V +     + GA+G+TVHPRPD+RHI   D+ ++ 
Sbjct: 1   MTKLSVNINKIATIRNARGGNTPNVVQVAIDCERFGAAGITVHPRPDERHITGKDVMDLS 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    E NIEGYP+E F+ + E  +P Q TLVPD PH LTS+ GWD  +N A+L 
Sbjct: 61  -----KVVTTEFNIEGYPDERFMQMIEAIRPAQATLVPDPPHVLTSNAGWDTKENSAVLQ 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             + RL + G R S+F D +      + A  TG D IELYTGPY   ++  +++ I    
Sbjct: 116 DIIRRLKSWGVRTSIFVDTDLQNI--EYALETGTDRIELYTGPYADNFSINKEQAIEPFI 173

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A    +   + L +NAGHDL   N+      IP ++E+S+GHA  + AL  G++  +  
Sbjct: 174 IASKRAIE--LGLGLNAGHDLNQDNLRYFKQNIPELAEVSIGHALISDALYLGLENTIQR 231

Query: 242 FRRACG 247
           +     
Sbjct: 232 YNYLLR 237


>gi|87311245|ref|ZP_01093367.1| pyridoxal phosphate biosynthetic protein [Blastopirellula marina
           DSM 3645]
 gi|87285985|gb|EAQ77897.1| pyridoxal phosphate biosynthetic protein [Blastopirellula marina
           DSM 3645]
          Length = 237

 Score =  248 bits (633), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 75/246 (30%), Positives = 127/246 (51%), Gaps = 10/246 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ VA +R  R    P+ V    +A   GA  +T+H R D+RHI+  DL  IR
Sbjct: 1   MPNLGVNIDHVATVRQARQTNEPDPVWAAALAEMGGADCITLHLREDRRHIQDRDLRIIR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  K ++N+E    E  L +    KP+Q+TLVP+   ++T++ G D L+    + 
Sbjct: 61  -----ETAKVKVNLELATAEEVLKIACEVKPDQVTLVPEKREEVTTEGGLDLLRQPEKVK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             + RL + G  +SLF D    +  +  AK  GA  +EL+TG +         +   + K
Sbjct: 116 AAIERLQDAGIAVSLFLDPEPAQLLM--AKKLGATAVELHTGQF--ALTRGDAQLAEIEK 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L    Q   ++ L++ AGH LT  N+   I AIP +SE+++GH+  A ++  G+++AV  
Sbjct: 172 LTQAGQQICELGLELLAGHGLTYSNVLP-IAAIPKMSELNIGHSIIARSIMVGLQQAVRD 230

Query: 242 FRRACG 247
            ++   
Sbjct: 231 MKQLIA 236


>gi|298488680|ref|ZP_07006709.1| Pyridoxal phosphate biosynthetic protein pdxJ [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298156753|gb|EFH97844.1| Pyridoxal phosphate biosynthetic protein pdxJ [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
          Length = 246

 Score =  248 bits (633), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 80/244 (32%), Positives = 122/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D +  + +  A+K  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLAKIGCEVSLFIDADERQIA--ASKRVGAPAIELHTGRYADA-QTPTEVAEELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ADGVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKSAVAEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|126733744|ref|ZP_01749491.1| pyridoxal phosphate biosynthetic protein PdxJ [Roseobacter sp.
           CCS2]
 gi|126716610|gb|EBA13474.1| pyridoxal phosphate biosynthetic protein PdxJ [Roseobacter sp.
           CCS2]
          Length = 247

 Score =  248 bits (633), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 71/249 (28%), Positives = 120/249 (48%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R    P+ +    IA ++GA G+T H R D+RHI   D+  +   
Sbjct: 6   RLGVNIDHVATVRNARGGAMPDPIRAAVIAEEAGADGITAHLREDRRHISDADIEGLMAA 65

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     K  LN E    +    +  R+KP  + +VP+   + T++ G +  + +  L   
Sbjct: 66  L-----KGPLNFEMAATKEMQQIALRHKPHAVCIVPEKREERTTEGGLEVAREENSLAHY 120

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFLNK 181
           +A L   G R+S+F   +  +   +AA   GA+ IEL+TG Y   +      +    L K
Sbjct: 121 IAPLREAGCRVSIFIAADQRQI--EAAHRIGAEVIELHTGAYCDAHAEGRFDERDDELRK 178

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   A  A  + L+++AGH LT   +   + A+P + E+++GH     A+  G+  A+  
Sbjct: 179 LTDMAAFADDLGLEVHAGHGLTYDCVGP-VAALPQVVELNIGHFIIGEAIFRGLAPAISE 237

Query: 242 FRRACGQHL 250
            RR   Q  
Sbjct: 238 MRRVMDQAR 246


>gi|33861663|ref|NP_893224.1| pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus subsp. pastoris str. CCMP1986]
 gi|81575872|sp|Q7V0Y7|PDXJ_PROMP RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|33640031|emb|CAE19566.1| Pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus subsp. pastoris str. CCMP1986]
          Length = 238

 Score =  248 bits (633), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 70/245 (28%), Positives = 123/245 (50%), Gaps = 10/245 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ +A +R  R    P+ V    +A   GA  +T+H R D+RHI+  D+  ++
Sbjct: 1   MAKLGVNIDHIANVRQARQTVEPDPVQFAFLAELGGADSITIHLREDRRHIQDRDIYLLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     K +LN+E    E  L + ++  P+ +TLVP+   ++T++ G D   N+  L 
Sbjct: 61  DTI-----KTKLNLEMAATEEMLRISKKLLPDYVTLVPEKRKEITTEGGLDVKNNEKYLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V  L +    +S F D   ++ +   +   G D IEL+TG Y       Q + + L K
Sbjct: 116 NYVNSLKSSNIEVSAFIDPANDQINS--SGEIGFDFIELHTGKYAGL--KGQDQYVELQK 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +  ++  A  + L +NAGH L  QN+   I +I  ++E+++GH+  + AL  G++ AV  
Sbjct: 172 IIESSYYAVDIGLIVNAGHGLNYQNVKK-IASINNMNELNIGHSIVSRALAVGLERAVRE 230

Query: 242 FRRAC 246
            +   
Sbjct: 231 MKTLI 235


>gi|123968746|ref|YP_001009604.1| pyridoxine 5'-phosphate synthase [Prochlorococcus marinus str.
           AS9601]
 gi|166219107|sp|A2BRT6|PDXJ_PROMS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|123198856|gb|ABM70497.1| Pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. AS9601]
          Length = 238

 Score =  248 bits (633), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 68/245 (27%), Positives = 123/245 (50%), Gaps = 10/245 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ +A +R  R    P+ V    +A   GA  +TVH R D+RHI+  D+  ++
Sbjct: 1   MATLGVNIDHIANVRQARKTVEPDPVQFAFLAELGGADSITVHLREDRRHIQDRDVFLLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  K +LN+E    +  L + ++  P+ +TLVP+   ++T++ G D   N   L 
Sbjct: 61  -----ETIKTKLNLEMAATKEMLEIAKKILPDYVTLVPEKREEVTTEGGLDLKSNVQYLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           K V  L +    +S F D    + +   +K  G D IEL+TG Y     +   +   L +
Sbjct: 116 KAVGSLKDSNIEVSAFIDPLSEQINY--SKEIGFDFIELHTGKY--AELSGSNQHKELQR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +  +  +A  + L +NAGH L   N+   I +I  ++E+++GH+  A AL  G++++V  
Sbjct: 172 IIESTHIANDLGLVVNAGHGLNYNNVRK-IASINNMNELNIGHSIVARALAIGLEKSVRE 230

Query: 242 FRRAC 246
            +   
Sbjct: 231 MKSLI 235


>gi|124026180|ref|YP_001015296.1| pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. NATL1A]
 gi|166219104|sp|A2C3H1|PDXJ_PROM1 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|123961248|gb|ABM76031.1| Pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. NATL1A]
          Length = 245

 Score =  248 bits (633), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 75/251 (29%), Positives = 123/251 (49%), Gaps = 10/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  DL  ++
Sbjct: 1   MASLGVNIDHIANVREARKTFEPDPVKMVLLAELGGADGITVHLREDRRHIQDRDLNLLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +     LN+E    E   ++    KP+ +TLVP+   ++T++ G D ++N+  L 
Sbjct: 61  -----ETVHTRLNLEMAATEEMTSIALNLKPDMVTLVPEKREEVTTEGGLDVIKNKNKLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + + RL      +SLF D    +  L+      A  IEL+TG Y       +   + L+ 
Sbjct: 116 EIIQRLSGEDIPVSLFVDPVQAQ--LENCAEVKAAWIELHTGKY--AITKNKARDLELSI 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L      A+   L++NAGH LT QN+   I AI  I E+++GH   + AL  G+ +AV  
Sbjct: 172 LKENTAKAKSYGLRVNAGHGLTYQNVEP-IAAIEGIEELNIGHTIISRALSVGLSQAVKE 230

Query: 242 FRRACGQHLDN 252
            +        +
Sbjct: 231 MKSLIINPRKD 241


>gi|126663132|ref|ZP_01734130.1| pyridoxal phosphate biosynthetic protein [Flavobacteria bacterium
           BAL38]
 gi|126624790|gb|EAZ95480.1| pyridoxal phosphate biosynthetic protein [Flavobacteria bacterium
           BAL38]
          Length = 237

 Score =  247 bits (632), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 88/246 (35%), Positives = 136/246 (55%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    P+L+ + K   Q GA G+T+HPRPD+RHIRY D  +++
Sbjct: 1   MTKLSVNINKIATLRNSRGGNVPDLLKVAKDIQQFGAQGITIHPRPDERHIRYQDARDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++       E NIEG P   F++L    KP Q+TLVPD    LTS+ GWD +++Q+ L 
Sbjct: 61  PVVY-----TEYNIEGNPQHNFIDLVLECKPTQVTLVPDAIGALTSNAGWDTIKHQSYLL 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +        R S+F D +      + AK TG + IELYT  +   +      +  ++ 
Sbjct: 116 EVIQEFQRNNIRTSIFVDADERMI--EGAKATGTERIELYTESF--AHEFGLGNKAGIDS 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
              +A  A ++ L INAGHDL++ NI    + IP + E+S+GHA  + +L  G++  V  
Sbjct: 172 YVKSALKANELGLGINAGHDLSLDNIKFFKDNIPGLLEVSIGHALISESLYLGLENVVNM 231

Query: 242 FRRACG 247
           + +   
Sbjct: 232 YLQKLK 237


>gi|330957804|gb|EGH58064.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 246

 Score =  247 bits (632), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 81/244 (33%), Positives = 122/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D +  + +  A+K  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLVKIGCEVSLFIDADERQIA--ASKRVGAPAIELHTGRYADA-QTPAEVAEELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   I AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ADGVAFGLAQGLIVNAGHGLHYHNV-EAIAAIKGINELNIGHALVAHALFVGFKAAVSEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|330964517|gb|EGH64777.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 246

 Score =  247 bits (632), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 80/244 (32%), Positives = 122/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D +  + +  A+K  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLAKIGCEVSLFIDADERQIA--ASKRVGAPAIELHTGRYADA-QTPTEVAEELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ANGVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVSEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|89889542|ref|ZP_01201053.1| pyridoxal phosphate biosynthetic protein [Flavobacteria bacterium
           BBFL7]
 gi|89517815|gb|EAS20471.1| pyridoxal phosphate biosynthetic protein [Flavobacteria bacterium
           BBFL7]
          Length = 238

 Score =  247 bits (632), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 95/242 (39%), Positives = 141/242 (58%), Gaps = 9/242 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T++SVN+N +A LRN R    P+L+       Q GA G+T+HPRPD+RHIRY D  +++
Sbjct: 1   MTALSVNVNKIATLRNARGGNVPDLIKCSLDIEQFGAQGITIHPRPDERHIRYQDARDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  + ELNIEG PNE F+ L +  +P Q+TLVPD    +TSD GWD ++N+A LT
Sbjct: 61  -----KVIQTELNIEGNPNEKFIALVDEVQPAQVTLVPDAVDAITSDAGWDTVKNEAYLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           K V    + G R S+F D   +   ++ A  TG D IELYT  Y   Y   ++  I    
Sbjct: 116 KIVKHFKDQGIRTSIFVDP--SIEMVEGASKTGVDRIELYTEAYAHQYPTDKEAAIAPYI 173

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A    L   + L INAGHDL+++N+    + +P + E+S+GHA  + +L  G++  V  
Sbjct: 174 VAAQKALD--LGLGINAGHDLSLENMRYFKDNVPGLLEVSIGHALISESLYMGLENVVNM 231

Query: 242 FR 243
           ++
Sbjct: 232 YK 233


>gi|163753158|ref|ZP_02160282.1| pyridoxal phosphate biosynthetic protein [Kordia algicida OT-1]
 gi|161326890|gb|EDP98215.1| pyridoxal phosphate biosynthetic protein [Kordia algicida OT-1]
          Length = 239

 Score =  247 bits (632), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 88/248 (35%), Positives = 135/248 (54%), Gaps = 9/248 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+T +SVN+N +A LRN R    PNL+   K     GA G+T+HPRPD+RHIRY D  ++
Sbjct: 1   MTTKLSVNINKIATLRNSRGGDVPNLIKFAKDVQNYGAQGITIHPRPDERHIRYQDARDL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           + ++       E NIEG P + F++L    +P Q+TLVPD    +TS+ GW+ ++++  L
Sbjct: 61  KPIV-----HTEYNIEGNPIQKFMDLVLEVQPTQVTLVPDAVDAITSNAGWNTIKHKDFL 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T+ +A   N G R S+F D       +  AK  G D IELYT  +   +      +  + 
Sbjct: 116 TEVIAEFKNNGIRTSIFVDPV--LEMIDGAKAVGTDRIELYTEEF--AHQYSLGNKKAIQ 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
                A  + ++ + +NAGHDL++ NI      IP + E+S+GHA  A +L  GV+  V 
Sbjct: 172 PYIDCAVRSNELGIGVNAGHDLSLDNIQFFAKEIPALLEVSIGHALIAESLYLGVENVVN 231

Query: 241 CFRRACGQ 248
            +     +
Sbjct: 232 MYLNKLKR 239


>gi|149177295|ref|ZP_01855900.1| pyridoxal phosphate biosynthetic protein [Planctomyces maris DSM
           8797]
 gi|148843820|gb|EDL58178.1| pyridoxal phosphate biosynthetic protein [Planctomyces maris DSM
           8797]
          Length = 238

 Score =  247 bits (632), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 67/246 (27%), Positives = 131/246 (53%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ VA +R  R    P+ V    +A   GA G+T+H R D+RHI+  DL  ++
Sbjct: 1   MPALGVNIDHVATVRQARLTYEPDPVWAAVLAELGGADGITLHLREDRRHIQDHDLYTMK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  + +LN+E    E    +    +P+Q++LVP+   +LT++ G + + N   ++
Sbjct: 61  -----KTVQVKLNLEMAAEEEMTQIALDVRPDQVSLVPEKREELTTEGGLNVIANAERVS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V RL   G  +SLF D +  +   +A+K  G   +EL+TG Y    ++  ++   L+ 
Sbjct: 116 QCVHRLQQAGIEVSLFIDPDPAQI--EASKKAGVHAVELHTGRYADA-SSAGEQEQELSI 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   +    +  ++++ GH LT +N+   +  IP++SE+++GH+  + A+  G+++AV  
Sbjct: 173 LEKASAFTIEQGMKLHMGHGLTYRNVTP-VALIPHVSELNIGHSIISRAVLVGMEQAVRE 231

Query: 242 FRRACG 247
            +    
Sbjct: 232 MKALVN 237


>gi|161344770|ref|NP_440111.2| pyridoxine 5'-phosphate synthase [Synechocystis sp. PCC 6803]
          Length = 241

 Score =  247 bits (632), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 75/245 (30%), Positives = 127/245 (51%), Gaps = 9/245 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ VA +R  R    P+ +    +A  +GA G+T H R D+RHI+  D+  +R
Sbjct: 1   MLTLGVNIDHVATIRQARQTVEPDPIAAAVLAELAGADGITAHLREDRRHIQERDVEILR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  LN+E    +  + +    KP+ +TLVP+   ++T++ G D   N   L 
Sbjct: 61  -----KTVRTHLNLEMAATKEMVEIALNLKPDYVTLVPERREEVTTEGGLDVAGNLNYLL 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V +L +    +SLF D +  +  L+A+  TGA  IEL+TG Y        Q    L  
Sbjct: 116 GVVEQLQSRHIPVSLFIDPDVAQ--LKASAQTGAKFIELHTGKYANAPTADDQA-RELGS 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           LAI   +A ++ L+INAGH LT  N+   +  +P + E+++GH+  + A+  G++ AV  
Sbjct: 173 LAIACDIALELGLRINAGHGLTYWNVRP-VAELPGMEELNIGHSIMSRAILVGMERAVRE 231

Query: 242 FRRAC 246
            + A 
Sbjct: 232 MKLAM 236


>gi|330989029|gb|EGH87132.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 246

 Score =  247 bits (632), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 80/244 (32%), Positives = 122/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D +  + +  A+K  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLAKIGCEVSLFIDADERQIA--ASKRVGAPAIELHTGRYADA-QTPTEVAEELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ADGVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVAEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|148244711|ref|YP_001219405.1| pyridoxine 5'-phosphate synthase [Candidatus Vesicomyosocius
           okutanii HA]
 gi|146326538|dbj|BAF61681.1| pyridoxine 5-phosphate synthase [Candidatus Vesicomyosocius
           okutanii HA]
          Length = 241

 Score =  247 bits (631), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 69/251 (27%), Positives = 124/251 (49%), Gaps = 10/251 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   + +N++ +A +R  R   +P+LV    +  +SGA  +T+H R D+RHI+  D+  +
Sbjct: 1   MGIYLGINIDHIATIRQVRGTDYPSLVEAALLCEKSGADSITLHLREDRRHIQDADVEIL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R  +       ++N+E    +  + +  + KP+   LVP+   +LT++ G +     + +
Sbjct: 61  RGKLT-----TKMNLEMAATDEMIAIASKIKPQNCCLVPEKREELTTEGGLNVTSQISKI 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                +L      +SLF D   ++    AAK  GA  +EL+TG Y    N    +   L 
Sbjct: 116 CDICIQLKMSNIIVSLFIDAQKDQI--DAAKQCGAAVVELHTGHYANATNE--AQLTELE 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++ I A  A+ + LQ+NAGH LT+ NI N I  +P I E+++GH+  + A+   +  A+ 
Sbjct: 172 RIKIMATYARSIGLQVNAGHGLTLGNITN-IAKLPEIVELNIGHSIISRAIFVSLGTAIQ 230

Query: 241 CFRRACGQHLD 251
             +        
Sbjct: 231 EMKNLMIDARQ 241


>gi|229497114|ref|ZP_04390818.1| pyridoxine 5'-phosphate synthase [Porphyromonas endodontalis ATCC
           35406]
 gi|229316039|gb|EEN81968.1| pyridoxine 5'-phosphate synthase [Porphyromonas endodontalis ATCC
           35406]
          Length = 239

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 88/242 (36%), Positives = 132/242 (54%), Gaps = 8/242 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA +RN R    PN++ +     + GA G+TVHPRPD+RHIRY D+  ++
Sbjct: 1   MTKLSVNINKVATIRNARGGNIPNVLQVALNCERFGAQGITVHPRPDERHIRYADVRALK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q    E NIEG P  +F++L     P Q+TLVPD P  LTSD GW+  Q+   L 
Sbjct: 61  -----QVLSTEFNIEGNPIPSFVDLVLEVVPAQVTLVPDAPDALTSDAGWEVDQHFDFLR 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
            T+ R    G R S+F   + +  +   A   G   +ELYT PY   +    +    + +
Sbjct: 116 DTIRRFEAEGIRTSIFVGTDLDNIAR--AADAGCRRVELYTEPYATAFLE-GEVEPVIER 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
            A  A+ A    L++NAGHDL + N+   +  +  ++E+S+GHA  + AL  G++E +  
Sbjct: 173 FARAAEHAAACGLEVNAGHDLNLDNLNYFVRRVQPLAEVSIGHALISDALYLGLEETIRR 232

Query: 242 FR 243
           +R
Sbjct: 233 YR 234


>gi|330950053|gb|EGH50313.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae Cit 7]
          Length = 246

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 80/244 (32%), Positives = 121/244 (49%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  L   ER +P  I LVP+   +L ++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMLAFAERLRPAHICLVPETRQELPTEGGLDVAGQEARIKA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D +  + +  A+K  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLAKIGCEVSLFIDADERQIA--ASKRVGAPAIELHTGRYADA-QTPTEVAEELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  ISE+++GHA  A AL  G K AV   
Sbjct: 179 ADGVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGISELNIGHALVAHALFVGFKAAVAEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|307293618|ref|ZP_07573462.1| pyridoxal phosphate biosynthetic protein PdxJ [Sphingobium
           chlorophenolicum L-1]
 gi|306879769|gb|EFN10986.1| pyridoxal phosphate biosynthetic protein PdxJ [Sphingobium
           chlorophenolicum L-1]
          Length = 245

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 73/249 (29%), Positives = 123/249 (49%), Gaps = 10/249 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R    P+ V    +A+++GA G+T H R D+RHIR  D+  + 
Sbjct: 7   PLRLGVNIDHVATIRNARGGAHPDPVKAALLAVKAGADGITAHLREDRRHIRDEDIATLM 66

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +        LN+E    +  L +  R++P    +VP+   + T++ G D       L 
Sbjct: 67  AAMS-----VPLNLEMAATQEMLGIALRHRPHAACIVPEKREERTTEGGLDAAGQMEALR 121

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V  L+  G R+SLF + +  +   +AA   GA  +EL+TG Y   +    +    L +
Sbjct: 122 PIVGALNEAGVRVSLFIEPDAAQI--EAAIRLGAPVVELHTGRY--AHLEGSERAEELRR 177

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           LA  A LA K  ++ +AGH LT  N+   + AIP ++E+++GH     A+  G++ ++  
Sbjct: 178 LADAAALAAKNGIEPHAGHGLTFDNVGP-VAAIPQVAELNIGHFLIGEAIFGGLEGSIRE 236

Query: 242 FRRACGQHL 250
            RR      
Sbjct: 237 MRRQMDLAR 245


>gi|312114993|ref|YP_004012589.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311220122|gb|ADP71490.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 264

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 78/250 (31%), Positives = 124/250 (49%), Gaps = 10/250 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + +N++ VA LRN R    P+ +   ++A+++G  G+T H R D+RHIR  D+  I+
Sbjct: 6   PVRLGLNIDHVATLRNARGGARPDPIEAARVAVKAGVDGITAHLREDRRHIRDEDIRRIK 65

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I      A LN+E    E    +    KP    +VP+   +LT++ G D    +  L 
Sbjct: 66  AEIA-----APLNLEMAATEEMTGIALVTKPHACCIVPERREELTTEGGLDAAGGEDHLL 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQQERIFL 179
             V RL + G R+SLF D    +   +AA   GA  +EL+TG Y   +   +    R  L
Sbjct: 121 PIVKRLVDDGIRVSLFIDPEPRQI--EAAARMGAPVVELHTGQYCEAWLARDEATARAEL 178

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           ++LA  A LA    L+++AGH L  +     + A P I E+++GH     A+  G+ EA+
Sbjct: 179 DRLAKAATLAASAGLEVHAGHGLDFET-AKHLAAFPEIRELNIGHVIIGEAIFIGLSEAI 237

Query: 240 FCFRRACGQH 249
           +  R A  + 
Sbjct: 238 WRMRAAIAKG 247


>gi|326336684|ref|ZP_08202852.1| pyridoxal phosphate biosynthetic protein PdxJ [Capnocytophaga sp.
           oral taxon 338 str. F0234]
 gi|325691154|gb|EGD33125.1| pyridoxal phosphate biosynthetic protein PdxJ [Capnocytophaga sp.
           oral taxon 338 str. F0234]
          Length = 237

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 97/246 (39%), Positives = 134/246 (54%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PNL+ +     + G  G+T+HPRPD+RHIRY D  +++
Sbjct: 1   MTKLSVNINKIATLRNSRGGNVPNLLQVATDLQEFGVEGITIHPRPDERHIRYQDALDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q    E NIEG P   F++L  + KP Q+TLVPD    +TS+ GWD L +QA LT
Sbjct: 61  -----QIVHTEYNIEGNPIPKFMDLVLQIKPTQVTLVPDAEDAITSNAGWDTLIHQAYLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + VA     G R SLF D       ++AA  TG D +ELYT  Y   Y    +E I    
Sbjct: 116 EIVAEFKRNGIRTSLFVDPI--PKMIEAAAKTGTDRVELYTEAYAKGYAFGNKEAITPYI 173

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           LA   ++A  + L +NAGHDL + N+      IP + E+S+GHA  + AL  G++  V  
Sbjct: 174 LA--GKVADSIGLGLNAGHDLNLDNLHYFKENIPSLLEVSIGHALISEALYLGLQNVVSM 231

Query: 242 FRRACG 247
           +     
Sbjct: 232 YLYRLK 237


>gi|71733905|ref|YP_276081.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|91207557|sp|Q48EV6|PDXJ_PSE14 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|71554458|gb|AAZ33669.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|320325571|gb|EFW81633.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320327143|gb|EFW83157.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 246

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 80/244 (32%), Positives = 122/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIRS 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D +  + +  A+K  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLAKIGCEVSLFIDADERQIA--ASKRVGAPAIELHTGRYADA-QTPTEVAEELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ADGVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVAEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|72382481|ref|YP_291836.1| pyridoxine 5'-phosphate synthase [Prochlorococcus marinus str.
           NATL2A]
 gi|91207556|sp|Q46K45|PDXJ_PROMT RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|72002331|gb|AAZ58133.1| pyridoxine 5'-phosphate synthase [Prochlorococcus marinus str.
           NATL2A]
          Length = 245

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 74/251 (29%), Positives = 124/251 (49%), Gaps = 10/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  DL  ++
Sbjct: 1   MASLGVNIDHIANVREARKTFEPDPVKMVLLAELGGADGITVHLREDRRHIQDRDLNLLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +     LN+E    E   ++    KP+ +TLVP+   ++T++ G D ++N+  L 
Sbjct: 61  -----ETVHTRLNLEMAATEEMTSIALNLKPDIVTLVPEKREEVTTEGGLDVIKNKRKLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + + RL      +SLF D    +  L+      A  +EL+TG Y       +   + L+ 
Sbjct: 116 EIIQRLSGEDIPVSLFVDPVQAQ--LENCAEVKAAWVELHTGKY--AITKKKARDLELSI 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L  +   A+   L++NAGH LT QN+   I AI  I E+++GH   + AL  G+ +AV  
Sbjct: 172 LKESTAKAKSYGLRVNAGHGLTYQNVEP-IAAIEGIEELNIGHTIISRALSVGLSQAVKE 230

Query: 242 FRRACGQHLDN 252
            +        +
Sbjct: 231 MKSLIINPRKD 241


>gi|241205472|ref|YP_002976568.1| pyridoxine 5'-phosphate synthase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859362|gb|ACS57029.1| Pyridoxine 5'-phosphate synthase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 250

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 149/248 (60%), Positives = 187/248 (75%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVA+LRNRR+LPWP++  +G+IAL+SGASGLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPAKLSVNLNAVAMLRNRRDLPWPSVEALGRIALKSGASGLTVHPRPDQRHIRFSDLPVI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FPK E NIEGYP E F  LC    PEQ+TLVPDDP Q TSDHGWDF ++QA L
Sbjct: 61  RNLIDDEFPKTEFNIEGYPTEEFFELCAGAAPEQVTLVPDDPAQATSDHGWDFRKHQAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL  +G R+SLFADG+G+  +++ AK  GAD IELYTGPYG C++ P++    L 
Sbjct: 121 TDAVARLKTMGCRVSLFADGDGDAQAVEIAKAVGADRIELYTGPYGGCFDAPERAGPILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A ++ L +NAGHDLT++N+P L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ALGRTADAALEIGLAVNAGHDLTVENLPALVRRIPQLAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQ 248
            F RACGQ
Sbjct: 241 RFCRACGQ 248


>gi|75908921|ref|YP_323217.1| pyridoxine 5'-phosphate synthase [Anabaena variabilis ATCC 29413]
 gi|75702646|gb|ABA22322.1| pyridoxine 5'-phosphate synthase [Anabaena variabilis ATCC 29413]
          Length = 248

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 72/243 (29%), Positives = 125/243 (51%), Gaps = 9/243 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R   
Sbjct: 13  LGVNIDHIATIRQARRTVEPDPVAAAVLAELGGADGITVHLREDRRHIQDRDVQLLR--- 69

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  LN+E    +  + +    KP+ +TLVP+   ++T++ G D +   A + + V
Sbjct: 70  --QTVRTHLNLEMAATDEMVGIALDIKPDYVTLVPEKREEVTTEGGLDIVGQIARIGEVV 127

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ++L N    +SLF D    +   +A+    A  IEL+TG Y    +   +++     LA 
Sbjct: 128 SKLQNAAIPVSLFIDAEPAQI--EASVKVQAKFIELHTGRYAEATDETSRQQELAF-LAT 184

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             + A K  L++NAGH LT  N+   + A+P + E+++GH   + A   G++ AV   ++
Sbjct: 185 GCEQAIKAGLRVNAGHGLTYWNV-YPVAALPGMEELNIGHTIISRAALVGIERAVREMKQ 243

Query: 245 ACG 247
           A  
Sbjct: 244 AIR 246


>gi|84515160|ref|ZP_01002523.1| pyridoxal phosphate biosynthetic protein [Loktanella vestfoldensis
           SKA53]
 gi|84511319|gb|EAQ07773.1| pyridoxal phosphate biosynthetic protein [Loktanella vestfoldensis
           SKA53]
          Length = 246

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 69/249 (27%), Positives = 118/249 (47%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R    P+ V    +A  +GA G+T H R D+RHI  +D+  +   
Sbjct: 5   RLGVNIDHVATVRNARGGDVPDPVRAALMAQDAGADGITAHLREDRRHIIDSDIERLMAA 64

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     +  LN E         +  R+KP  + LVP+   + T++ G +    Q+ L   
Sbjct: 65  L-----RIPLNFEMAATAEMQAIALRHKPHAVCLVPEKREERTTEGGLEVAGQQSALAAY 119

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQQERIFLNK 181
           +A L + G R+SLF   +  +   +AA   GA  IEL++G Y   +   + Q     L K
Sbjct: 120 IAPLRDAGCRVSLFIAADEAQI--RAAHSIGAPVIELHSGAYADAWAEGDWQMRDDELRK 177

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +      A  + L+++ GH LT   +   I A+P ++E+++GH     ++  G+  A+  
Sbjct: 178 ITDMTAFATDLGLEVHVGHGLTYDCVTP-IAALPQVAELNIGHFLIGESIFRGLGPAIAE 236

Query: 242 FRRACGQHL 250
            RR      
Sbjct: 237 MRRLMDAAR 245


>gi|67922975|ref|ZP_00516470.1| Pyridoxal phosphate biosynthetic protein PdxJ [Crocosphaera
           watsonii WH 8501]
 gi|67855194|gb|EAM50458.1| Pyridoxal phosphate biosynthetic protein PdxJ [Crocosphaera
           watsonii WH 8501]
          Length = 240

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 73/246 (29%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ VA +R  R    P+ V    +A   GA+G+T H R D+RHI+  D+  +R
Sbjct: 1   MLTLGVNIDHVATVRQARRTVEPDPVAAAVLAELGGANGITAHLREDRRHIQDRDIRLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  LN+E    E  +++    KP+ +TLVP+   ++T++ G D   +   L 
Sbjct: 61  -----ETVRTHLNLEMAATEEMVSIALDVKPDYVTLVPEKREEVTTEGGLDIAGSLEKLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V RL +    +SLF D + ++   +A+  T A  IEL+TG Y     NP+  +  L  
Sbjct: 116 NVVDRLQSANIPVSLFIDADESQI--KASADTQAKFIELHTGKYADA-PNPEIRQKELES 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L +  + A  + L++NAGH LT  N+   +  +P + E+++GH   + A+  G++ AV  
Sbjct: 173 LKLGCEQALNLGLRVNAGHGLTYINV-YPVGCLPGMEELNIGHTIVSRAVLVGMERAVKE 231

Query: 242 FRRACG 247
            + A  
Sbjct: 232 MKLAMR 237


>gi|220909905|ref|YP_002485216.1| pyridoxine 5'-phosphate synthase [Cyanothece sp. PCC 7425]
 gi|254781561|sp|B8HKL1|PDXJ_CYAP4 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|219866516|gb|ACL46855.1| pyridoxal phosphate biosynthetic protein PdxJ [Cyanothece sp. PCC
           7425]
          Length = 240

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 122/247 (49%), Gaps = 10/247 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M T + VN++ VA +R  R    P+ +    +A   GA G+TVH R D+RHI+  D+  +
Sbjct: 1   MPT-LGVNIDHVATIRQARRTVEPDPIAAAVLAELGGADGITVHLREDRRHIQERDVRLL 59

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R     Q  +  LN+E       + +    KP+ ITLVP+   ++T++ G D       L
Sbjct: 60  R-----QTVRTHLNLEMAATAEMVAIALELKPDYITLVPERREEITTEGGLDVNGQPERL 114

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              +  L   G  +SLF D       ++ A   GA  IEL+TG Y     +PQ ++  L 
Sbjct: 115 QTVIDTLQQAGIPVSLFIDA--EAKQIETAARLGAKFIELHTGRYAEA-GSPQAQQRELE 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            LA     A  + +++NAGH LT  N+   +  +P + E+++GH   + A+  G++ AV 
Sbjct: 172 TLAQGCARAIDLGVRVNAGHGLTYWNVRP-VALLPGMEELNIGHTIVSRAVLVGMERAVR 230

Query: 241 CFRRACG 247
             ++A  
Sbjct: 231 EMKQAIQ 237


>gi|66047175|ref|YP_237016.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. syringae
           B728a]
 gi|75500900|sp|Q4ZPE4|PDXJ_PSEU2 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|63257882|gb|AAY38978.1| Pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas syringae
           pv. syringae B728a]
          Length = 246

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 80/244 (32%), Positives = 122/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEDMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D +  + +  A+K  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLAKIGCEVSLFIDADERQIA--ASKRVGAPAIELHTGRYADA-QTPTEVAEELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ADGVAFGLAQGLVVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVAEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|255533558|ref|YP_003093930.1| pyridoxine 5'-phosphate synthase [Pedobacter heparinus DSM 2366]
 gi|255346542|gb|ACU05868.1| pyridoxal phosphate biosynthetic protein PdxJ [Pedobacter heparinus
           DSM 2366]
          Length = 240

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 95/249 (38%), Positives = 136/249 (54%), Gaps = 10/249 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              +SVN+N +A LRN R    P+LV +     + GA G+TVHPRPD+RHIRY D+ +++
Sbjct: 1   MAHLSVNINKIATLRNSRGGNNPDLVKVALDCERFGAEGITVHPRPDERHIRYQDVFDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNET-FLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
            +I       E NIEG   E  F+ L    KP Q+TLVPD   QLTS+HGWD +++ A L
Sbjct: 61  AVIA-----TEFNIEGNCREQKFIELVLANKPAQVTLVPDAEGQLTSNHGWDTIKHAAYL 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            + V      G R+S+F D       ++AA LTG D IELYT  Y   +N        + 
Sbjct: 116 KEMVGLFKAEGIRVSIFVDPV--VEMVEAAVLTGTDRIELYTEAY--AHNYYDNREKAVL 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
                A  A ++ L INAGHDL + N+     +IP + E+S+GHA  + AL  G++  + 
Sbjct: 172 PYVAAAHKAHELGLGINAGHDLDLHNLKYFAESIPGLLEVSIGHALISDALYLGLENTIQ 231

Query: 241 CFRRACGQH 249
            + +    +
Sbjct: 232 MYLKQLKHN 240


>gi|302186920|ref|ZP_07263593.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. syringae
           642]
          Length = 246

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 80/244 (32%), Positives = 123/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D +  + +  A+K  GA  IEL+TG Y    + P +    L ++
Sbjct: 122 AVERLAKIGCEVSLFIDADERQIA--ASKRVGAPAIELHTGRYADA-HTPTEVAEELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ADGVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVAEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|150397184|ref|YP_001327651.1| pyridoxine 5'-phosphate synthase [Sinorhizobium medicae WSM419]
 gi|150028699|gb|ABR60816.1| Pyridoxal phosphate biosynthetic protein PdxJ [Sinorhizobium
           medicae WSM419]
          Length = 250

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 145/249 (58%), Positives = 187/249 (75%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+IALQ+GASGLTVHPRPDQRHIR++DL  I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVTGLGRIALQAGASGLTVHPRPDQRHIRFSDLQPI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP AE N+EG+PNE FL L ER++PEQ+TLVPDDP Q TSDHGWDF ++  LL
Sbjct: 61  RNLIDDEFPAAEFNMEGFPNEAFLELVERHEPEQVTLVPDDPAQATSDHGWDFHKSHNLL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V  L   G R+SLFADG  +  +L+ AK TGAD IELYTGPYG CY++P++      
Sbjct: 121 GNVVGSLKKKGYRVSLFADGTPDLQALKIAKETGADRIELYTGPYGGCYDDPEKAERVAT 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +L  TA++A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ELGRTAEIAIGLGLAVNAGHDLTVANLPLLVKYIPELAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQH 249
            FRRACG+ 
Sbjct: 241 RFRRACGEA 249


>gi|94496065|ref|ZP_01302644.1| pyridoxal phosphate biosynthetic protein PdxJ [Sphingomonas sp.
           SKA58]
 gi|94424757|gb|EAT09779.1| pyridoxal phosphate biosynthetic protein PdxJ [Sphingomonas sp.
           SKA58]
          Length = 242

 Score =  247 bits (630), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 74/252 (29%), Positives = 122/252 (48%), Gaps = 12/252 (4%)

Query: 1   MST--SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLP 58
           M T   + VN++ VA +RN R    P+ V    +A+++GA G+T H R D+RHIR  D+ 
Sbjct: 1   MPTPLRLGVNIDHVATIRNARGGAHPDPVKAALLAVKAGADGITAHLREDRRHIRDEDIA 60

Query: 59  EIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQA 118
            +   +D       LN+E    +  L +  R+KP    +VP+   + T++ G D      
Sbjct: 61  MLMAALD-----VPLNLEMAATQEMLEIALRHKPHAACIVPEKREERTTEGGLDAAGQYE 115

Query: 119 LLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF 178
            L   V +L   G R+SLF + +  +         GA  +E +TG Y   + +       
Sbjct: 116 ALAPIVEKLDEAGIRVSLFIEADAAQIDAAI--RLGAPVVEFHTGAY--AHLDGAARAGE 171

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           L ++A  A LA K  ++ +AGH LT  N+   + AIP I+E+++GH     A+  G++ +
Sbjct: 172 LRRIADAAALAAKNGIEPHAGHGLTFDNVGP-VAAIPQIAELNIGHFLIGEAIFGGLEGS 230

Query: 239 VFCFRRACGQHL 250
           +   RR      
Sbjct: 231 IREMRRQMDLAR 242


>gi|330811507|ref|YP_004355969.1| Pyridoxal phosphate biosynthetic protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379615|gb|AEA70965.1| Pyridoxal phosphate biosynthetic protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 247

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 79/244 (32%), Positives = 123/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  +   ER +P  I LVP+   +LT++ G D    +A ++ 
Sbjct: 67  VL-----QTRMNFEMGVTEEMMAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARISM 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G+ +SLF D +  +   +A+K  GA  IEL+TG Y      P      L ++
Sbjct: 122 AVERLSKIGAEVSLFIDADERQI--EASKRVGAPAIELHTGRYADA-QTPTDVADELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ADGVACGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKSAVAEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|91202475|emb|CAJ72114.1| strongly similar to pyridoxal phosphate biosynthetic protein PdxJ
           (PNP synthase) [Candidatus Kuenenia stuttgartiensis]
          Length = 249

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 74/248 (29%), Positives = 131/248 (52%), Gaps = 9/248 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR  R    P+ V     A+  GA  +TVH R D+RHI+  D+  +R
Sbjct: 1   MIKLGVNIDHVATLRQARKTYEPDPVTAASFAILGGADIITVHLREDRRHIQDRDILLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    +LN+E    +  +++  + KPEQ+ LVP+   ++T++ G D    ++++ 
Sbjct: 61  -----ETVFTKLNLEMSIADEIVDIAIKTKPEQVALVPEKRQEVTTEGGLDVASQKSVIG 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V RL + G  ISLF D    +    AAK  G+  IEL+TG Y     +      +  K
Sbjct: 116 RVVKRLADAGILISLFIDPEEEQII--AAKEVGSQFIELHTGNYANA-KDVNLRAKWTEK 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L    ++A  + L++NAGH LT QN+ +++ ++  + E+ +GH+  + ++  G+K+AV  
Sbjct: 173 LRQGIKIAHGLGLRVNAGHGLTYQNVGHIVESLD-VEELHIGHSIVSRSVFVGIKKAVQE 231

Query: 242 FRRACGQH 249
            +    +H
Sbjct: 232 MKDLIFRH 239


>gi|149926463|ref|ZP_01914724.1| pyridoxal phosphate biosynthetic protein PdxJ [Limnobacter sp.
           MED105]
 gi|149824826|gb|EDM84040.1| pyridoxal phosphate biosynthetic protein PdxJ [Limnobacter sp.
           MED105]
          Length = 246

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 78/254 (30%), Positives = 129/254 (50%), Gaps = 10/254 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +R  R    P+ +    +A + GA  +TVH R D+RH++  D+  IR
Sbjct: 1   MIELGVNIDHVATIRQARRGHEPDPLRAALLAEEYGADAITVHVREDRRHMQDDDVRRIR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            LI        +N E    E  + L E  KP+ +  VP+   ++T++ G D +    L+ 
Sbjct: 61  PLIS-----TRMNFECAVVEEMIRLVEDVKPQDVCFVPERREEVTTEGGLDVIGGFHLIA 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             VARL + G RISLF D + ++   +AA   GAD IEL+TG Y     +  +  + L++
Sbjct: 116 PAVARLKDQGMRISLFIDPDLDQI--EAALKCGADAIELHTGRYAHALGSAVE--LELSR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +  +A       L++NAGH L   N+   + AI  ISE+++GH+  A A+  G + A+  
Sbjct: 172 IRKSANFGVAEGLRVNAGHGLNYDNVQP-VAAIETISELNIGHSIVANAVFMGWEGAIKK 230

Query: 242 FRRACGQHLDNTMR 255
            +        + +R
Sbjct: 231 MKELMISAKLDAIR 244


>gi|146306510|ref|YP_001186975.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           mendocina ymp]
 gi|166219109|sp|A4XSC7|PDXJ_PSEMY RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|145574711|gb|ABP84243.1| pyridoxine 5'-phosphate synthase [Pseudomonas mendocina ymp]
          Length = 248

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 76/244 (31%), Positives = 120/244 (49%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  +  
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQDRDVRVLAD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    +  L   E+ +P  + LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTDFMLGFAEQIRPAHVCLVPETRQELTTEGGLDVAGQEARIAA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL   G  +SLF D    +   +AA   GA  IEL+TG Y    +  ++    L+++
Sbjct: 122 AVERLTLAGCEVSLFIDAEERQI--EAAMRVGAPAIELHTGRYADA-HTAEEAAQELSRI 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
                      L +NAGH L   N    + AIP I+E+++GHA  A AL  G K+AV   
Sbjct: 179 RDGVICGLNHGLIVNAGHGLHYHN-AEAVAAIPGINELNIGHAIVAHALFVGFKQAVAEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|163786492|ref|ZP_02180940.1| pyridoxal phosphate biosynthetic protein [Flavobacteriales
           bacterium ALC-1]
 gi|159878352|gb|EDP72408.1| pyridoxal phosphate biosynthetic protein [Flavobacteriales
           bacterium ALC-1]
          Length = 237

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 87/246 (35%), Positives = 133/246 (54%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PN+V   +   + GA G+T+HPRPD+RHIRY D  +++
Sbjct: 1   MTKLSVNINKIATLRNSRGGDVPNVVQFARDVQRYGAEGVTIHPRPDERHIRYQDAYDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +       E NIEG P   F+ +    KP Q+TLVPD    +TS+ GWD L+++  L 
Sbjct: 61  SEVY-----TEYNIEGNPIPKFIEMVLEIKPTQVTLVPDAVDAITSNAGWDTLKHKDFLV 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +    + G R S+F D + ++   + AK TG D IELYT  +   +      +  +  
Sbjct: 116 EVIKEFKDNGIRTSIFVDPDLHQI--EGAKATGTDRIELYTEAF--AHQYGLGNKEAIKP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A LA  + L +NAGHDL+++NI    + I  + E+S+GHA  A +L  GV+  +  
Sbjct: 172 YMECAGLANAIQLGVNAGHDLSLENIEFFKDNITGLLEVSIGHALIAESLYLGVENVIAM 231

Query: 242 FRRACG 247
           +     
Sbjct: 232 YLDKLK 237


>gi|330973035|gb|EGH73101.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 246

 Score =  246 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 80/244 (32%), Positives = 122/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEDMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D +  + +  A+K  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLAKIGCEVSLFIDADERQIA--ASKRVGAPAIELHTGRYADA-QTPTEVAEELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ADGVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVAEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|330898518|gb|EGH29937.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 246

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 80/244 (32%), Positives = 122/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D +  + +  A+K  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLAKIGCEVSLFIDADERQIA--ASKRVGAPAIELHTGRYADA-QTPTEVAEELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ADGVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVAEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|16125804|ref|NP_420368.1| pyridoxal phosphate biosynthetic protein PdxJ [Caulobacter
           crescentus CB15]
 gi|221234563|ref|YP_002516999.1| pyridoxine 5'-phosphate synthase [Caulobacter crescentus NA1000]
 gi|20139117|sp|Q9A808|PDXJ_CAUCR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|254781560|sp|B8H623|PDXJ_CAUCN RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|13422944|gb|AAK23536.1| pyridoxal phosphate biosynthetic protein PdxJ [Caulobacter
           crescentus CB15]
 gi|220963735|gb|ACL95091.1| pyridoxal phosphate biosynthetic protein pdxJ [Caulobacter
           crescentus NA1000]
          Length = 254

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 73/252 (28%), Positives = 126/252 (50%), Gaps = 7/252 (2%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MS  + VN++ VA +RN R   +P  V   ++AL +GA G+T H R D+RHI   D+  +
Sbjct: 1   MSLRLGVNIDHVATIRNARGASYPEPVRAAELALIAGADGITAHLREDRRHISDADIAVL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
             L  ++     LN E    +  + +    +P    LVP+   ++T++ G D ++ Q  +
Sbjct: 61  TDLCHKRGK--PLNFEMAVTDEMVGIALNARPHAACLVPERREEVTTEGGLDVIKGQKRI 118

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYN--NPQQERIF 178
               ARL  +G+R+SLF + + ++   +A    GA  +EL+TG Y          +    
Sbjct: 119 ADATARLRTVGARVSLFIEPDPDQI--RACVTAGAQVVELHTGAYCDAARAGETARAEAI 176

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           L +L   A LA ++ L+++AGH +    +   + AIP I+E+++GH     A+  G+ EA
Sbjct: 177 LKRLKAGAALAHELGLEVHAGHGIDYATVKP-VAAIPQIAELNIGHFLIGEAIFVGLPEA 235

Query: 239 VFCFRRACGQHL 250
           +   R       
Sbjct: 236 IHRMRALMEAAR 247


>gi|148549491|ref|YP_001269593.1| pyridoxine 5'-phosphate synthase [Pseudomonas putida F1]
 gi|166219110|sp|A5W8E9|PDXJ_PSEP1 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|148513549|gb|ABQ80409.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas putida
           F1]
          Length = 240

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 76/242 (31%), Positives = 121/242 (50%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 3   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVVLLKDVL 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  +   E+ +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 63  -----QTRMNFEMGVTEEMMAFAEKIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+ +SLF D +  +   +A++  GA  IEL+TG Y      P +    L ++  
Sbjct: 118 ERLARTGAEVSLFIDADERQI--EASRRVGAPAIELHTGRYADA-ETPTEVAEELQRIVE 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   + 
Sbjct: 175 GVAFGVGHGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVAEMKA 233

Query: 245 AC 246
             
Sbjct: 234 LI 235


>gi|163781630|ref|ZP_02176630.1| pyridoxal phosphate biosynthetic protein [Hydrogenivirga sp.
           128-5-R1-1]
 gi|159882850|gb|EDP76354.1| pyridoxal phosphate biosynthetic protein [Hydrogenivirga sp.
           128-5-R1-1]
          Length = 245

 Score =  246 bits (628), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 71/246 (28%), Positives = 131/246 (53%), Gaps = 9/246 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +R  R    P+ V    I  Q+GA  +T+H R D+RHI+  DL  I+  
Sbjct: 2   RLGVNIDHVATVRQARRTFEPSPVFAALIVQQAGADQITLHLREDRRHIQDRDLELIK-- 59

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +     +N+E  P E   ++  R KP+++TLVP+   ++T++ G D    +  L + 
Sbjct: 60  ---ELVILPVNLEMAPVEEMRSIALRVKPDRVTLVPEKREEITTEGGLDVAGMKGYLREY 116

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ--QERIFLNK 181
           +    ++G  +SLF D   ++  ++A+   GAD IEL+TG Y   +N  +  +  + + +
Sbjct: 117 IEPFKSVGIEVSLFIDPEESQ--VRASAEVGADAIELHTGTYANLWNEHRFEEAEVEIER 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L    +LA+++ +++ AGH LT QN+  ++     I E+++GH+  A ++  G++ AV  
Sbjct: 175 LKRAGELAKELGMKVYAGHGLTYQNVKGVLELSGIIEELNIGHSIIANSVIFGLERAVKE 234

Query: 242 FRRACG 247
                 
Sbjct: 235 MLNLMR 240


>gi|110633846|ref|YP_674054.1| pyridoxal phosphate biosynthetic protein PdxJ [Mesorhizobium sp.
           BNC1]
 gi|123353678|sp|Q11I86|PDXJ_MESSB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|110284830|gb|ABG62889.1| pyridoxine 5'-phosphate synthase [Chelativorans sp. BNC1]
          Length = 248

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 140/246 (56%), Positives = 180/246 (73%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVA+LRNRR+LPWP++  +G+IAL +GA GLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPVKLSVNLNAVAMLRNRRDLPWPSVTALGRIALGAGAHGLTVHPRPDQRHIRFSDLPHI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP  E NIEGYP+E FL L E  +PEQ+TLVPDDP Q TSDHGW F +++  L
Sbjct: 61  RALIDDEFPDREFNIEGYPSEDFLRLVEETQPEQVTLVPDDPSQATSDHGWQFQEHERFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V RL   G R+SLFAD + +E +L  AK  GAD +ELYTGPYGACY++ ++    L 
Sbjct: 121 AAAVGRLKRRGFRVSLFADPDADEAALAVAKAVGADRVELYTGPYGACYDDAEKAAKELR 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL  TA+ AQ + L +NAGHDLT+ N+P L+  +P ++E+S+GHA  A ALE G+ E V 
Sbjct: 181 KLEKTAKTAQGLGLAVNAGHDLTVANLPALVEHVPSLAEVSIGHALTADALEYGMAETVR 240

Query: 241 CFRRAC 246
            +  AC
Sbjct: 241 RYLSAC 246


>gi|325286844|ref|YP_004262634.1| Pyridoxine 5'-phosphate synthase [Cellulophaga lytica DSM 7489]
 gi|324322298|gb|ADY29763.1| Pyridoxine 5'-phosphate synthase [Cellulophaga lytica DSM 7489]
          Length = 237

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 87/246 (35%), Positives = 131/246 (53%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PNL  +       GA G+T+HPRPD+RHIRY D  +++
Sbjct: 1   MTKLSVNVNKIATLRNSRGGNVPNLCKVATDIESFGAEGITIHPRPDERHIRYQDARDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    E NIEG P + F++L    +P Q+TLVPD    +TS+ GWD ++++  L 
Sbjct: 61  -----KIVTTEFNIEGNPIKKFVDLVLETQPTQVTLVPDAVDAITSNAGWDTIKHKDFLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             +A       R S+F +   +   ++ A  TG D IELYT  Y   Y    +  +    
Sbjct: 116 DVIATFKAHNIRTSIFVNA--DLKMVEGAAETGTDRIELYTESYADAYAEGNKNGV--QP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A LA K++L INAGHDL++ NI      +P++ E+S+GHA  + +L  G++  V  
Sbjct: 172 FTDAAILAHKLNLGINAGHDLSLDNIAFFKEKVPHLLEVSIGHALISESLYLGLENVVNM 231

Query: 242 FRRACG 247
           +     
Sbjct: 232 YLNKLK 237


>gi|332291473|ref|YP_004430082.1| pyridoxal phosphate biosynthetic protein PdxJ [Krokinobacter
           diaphorus 4H-3-7-5]
 gi|332169559|gb|AEE18814.1| pyridoxal phosphate biosynthetic protein PdxJ [Krokinobacter
           diaphorus 4H-3-7-5]
          Length = 237

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 89/246 (36%), Positives = 131/246 (53%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA LRN R    P+L+ +     + GA G+T+HPRPD+RHIRY D  ++ 
Sbjct: 1   MTKLSVNINKVATLRNARGGNVPDLLKVASDLEKMGAQGITIHPRPDERHIRYQDARDL- 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                     E NIEG P + F++L    KP Q+TLVPD    +TS+ GWD +++++ L 
Sbjct: 60  ----VDVVTTEFNIEGNPIQKFIDLVLETKPTQVTLVPDAVDAITSNAGWDTIKHKSFLQ 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +      G R S+F D       ++ AK TGAD IELYT  Y         +   +  
Sbjct: 116 EVIQEFKEAGIRTSIFVDPV--LEMVEGAKETGADRIELYTESY--ADGYVLNKEEAIKP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A  A  + + INAGHDL++ NI    N+IP + E+S+GHA  A +L  G +  +  
Sbjct: 172 FIAAAFHASDIGIGINAGHDLSLDNIEYFHNSIPDLLEVSIGHALMAESLYLGFETVITS 231

Query: 242 FRRACG 247
           + +   
Sbjct: 232 YLKKLQ 237


>gi|330502448|ref|YP_004379317.1| pyridoxine 5'-phosphate synthase [Pseudomonas mendocina NK-01]
 gi|328916734|gb|AEB57565.1| pyridoxine 5'-phosphate synthase [Pseudomonas mendocina NK-01]
          Length = 248

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 77/250 (30%), Positives = 121/250 (48%), Gaps = 9/250 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  +  
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQDRDVRVLAD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    +  L   E+ +P  + LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTDFMLGFAEQIRPAHVCLVPETRQELTTEGGLDVAGQEARIAA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL   G  +SLF D    +   +AA   GA  IEL+TG Y    +  ++    L+++
Sbjct: 122 AVERLTLAGCEVSLFIDAEERQI--EAAMRVGAPAIELHTGRYADA-HTAEEAAHELSRI 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
                      L +NAGH L   N    + AIP I+E+++GHA  A AL  G K+AV   
Sbjct: 179 RDGVICGLNHGLIVNAGHGLHYHN-AEAVAAIPGINELNIGHAIVAHALFVGFKQAVAEM 237

Query: 243 RRACGQHLDN 252
           +       D 
Sbjct: 238 KALIVAAADR 247


>gi|89053007|ref|YP_508458.1| pyridoxine 5'-phosphate synthase [Jannaschia sp. CCS1]
 gi|122499605|sp|Q28V29|PDXJ_JANSC RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|88862556|gb|ABD53433.1| pyridoxine 5'-phosphate synthase [Jannaschia sp. CCS1]
          Length = 248

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 68/251 (27%), Positives = 116/251 (46%), Gaps = 10/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LRN R    P+ V    +A Q+GA G+T H R D+RHIR  D+  I 
Sbjct: 6   KLRLGVNIDHVATLRNARGGALPDPVRAAVLAEQAGADGITAHLREDRRHIRDADIAAIM 65

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +     LN E    +    +   + P    +VP+   + T++ G +   +   L 
Sbjct: 66  -----EAITIPLNFEMAATDEMQEIALGHLPHAACIVPERREERTTEGGLEVAGDDNRLA 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG--ACYNNPQQERIFL 179
           + +A L + G R+SLF     ++   +AA   GA  IEL+TG Y       +       L
Sbjct: 121 QYIAPLKDAGIRVSLFIAAERSQI--EAAARIGAPVIELHTGAYCDYDAEGDVAARDAEL 178

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            +L   A+L  ++ L+++ GH L    +   I A+P ++E+++GH     ++  G++ A+
Sbjct: 179 ARLIAGAKLGVELGLEVHMGHGLNYDTVAP-IAALPEVAELNIGHFLIGESIFVGLEAAM 237

Query: 240 FCFRRACGQHL 250
              R       
Sbjct: 238 TEMRARMDAAR 248


>gi|119356502|ref|YP_911146.1| pyridoxine 5'-phosphate synthase [Chlorobium phaeobacteroides DSM
           266]
 gi|166219090|sp|A1BE95|PDXJ_CHLPD RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|119353851|gb|ABL64722.1| pyridoxine 5'-phosphate synthase [Chlorobium phaeobacteroides DSM
           266]
          Length = 236

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 77/244 (31%), Positives = 128/244 (52%), Gaps = 9/244 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            ++VN++ +A LRN R    P+ V    +A + GA+G+  H R D+RHI+  DL  +R  
Sbjct: 2   RLAVNIDHIATLRNARGEQEPDPVAAALLAERCGAAGIVCHLREDRRHIKDLDLARLR-- 59

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +    +L++E         +  + KPE ITLVP+   +LT++ G+D  ++ A+L + 
Sbjct: 60  ---EAVTTKLDLEMAMTGELQEIALKTKPELITLVPEKREELTTEGGFDVARHFAVLKEF 116

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           +  L++ G  +SLF +    + ++  A+  GAD +EL+TG Y           + L ++ 
Sbjct: 117 LKPLNDNGIEVSLFIEP--EKKAVDLAREAGADLVELHTGLYAQKELE-NNTDLELQRIR 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A  A+ + L++ AGH L  +NI      IP I E+S+GHA  A A+  G+ EAV    
Sbjct: 174 EAATYAKSIGLRVVAGHGLNYRNIGPF-REIPEIEEVSIGHAIIARAVFTGLDEAVREML 232

Query: 244 RACG 247
           R   
Sbjct: 233 RLIQ 236


>gi|264677120|ref|YP_003277026.1| pyridoxal phosphate biosynthetic protein PdxJ [Comamonas
           testosteroni CNB-2]
 gi|262207632|gb|ACY31730.1| Pyridoxal phosphate biosynthetic protein PdxJ [Comamonas
           testosteroni CNB-2]
          Length = 516

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 101/248 (40%), Positives = 144/248 (58%), Gaps = 4/248 (1%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA+LRN R+L  P+++   +I L++GA G+T+HPRPD+RHIR  D+ E+  
Sbjct: 268 TALSVNVNKVALLRNTRHLGIPSVMRAAQICLEAGAQGITIHPRPDERHIRAQDVFEL-H 326

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            + + +P AE NIEG P +  ++   + +P Q T VPD   Q TSDHGW F Q+   L  
Sbjct: 327 ELLKNWPGAEFNIEGNPTQNLMDFIRQTRPHQATFVPDSEDQFTSDHGWSFPQDAERLKP 386

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A    LG R+SLF D    + +  AAK  GAD +ELYT P+ A      ++   L   
Sbjct: 387 LIAECKALGVRVSLFMDPIPEQMA--AAKAVGADRVELYTEPF-AANWGKAEQEQQLQTY 443

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  AQ A    L INAGHDL   N+   +  +P ++E+S+GHA  A ALE G  E V  +
Sbjct: 444 ARAAQAALDAGLGINAGHDLNRDNLAAFVARVPGLAEVSIGHALIADALELGYAETVKAY 503

Query: 243 RRACGQHL 250
           +      +
Sbjct: 504 QACIDAGM 511


>gi|116252964|ref|YP_768802.1| pyridoxine 5'-phosphate synthase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115257612|emb|CAK08709.1| putative pyridoxal phosphate biosynthetic protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 250

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 148/250 (59%), Positives = 187/250 (74%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+IAL SGASGLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVEALGRIALASGASGLTVHPRPDQRHIRFSDLPVI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FPKAE N+EGYP E F  LC    PEQ+TLVPDDP Q TSDHGWDF ++QA L
Sbjct: 61  RNLIDDEFPKAEFNMEGYPTEEFFELCAGAAPEQVTLVPDDPAQATSDHGWDFRKHQAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL  +G R+SLFADG+G+  +++ AK  GAD IELYTGPYG C++ P++    L 
Sbjct: 121 TDAVARLKTMGCRVSLFADGDGDAQAVEIAKAVGADRIELYTGPYGGCFDAPERAAPILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A  + L +NAGHDLT++N+P L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ALGRTADAALAIGLAVNAGHDLTVENLPALVKRIPQLAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQHL 250
            F RACGQ +
Sbjct: 241 RFCRACGQAV 250


>gi|220934269|ref|YP_002513168.1| pyridoxal phosphate biosynthetic protein PdxJ [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|254781565|sp|B8GPL4|PDXJ_THISH RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|219995579|gb|ACL72181.1| pyridoxal phosphate biosynthetic protein PdxJ [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 246

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 79/248 (31%), Positives = 124/248 (50%), Gaps = 9/248 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ +A +R  R  P+P+LV   +I  ++GA  +T+H R D+RHI+  D+  +R  
Sbjct: 8   RLGVNIDHIATIRQARGTPYPDLVEAVRIVEEAGADIITLHLREDRRHIQDRDVEMLRER 67

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I        +N+E    E    +  R +P+   +VP+   +LT++ G D L  +A L   
Sbjct: 68  IT-----TGMNLEMAATEEMQAIALRIRPQACCIVPERREELTTEGGLDVLGQEARLKAF 122

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
            A L   G  +SLF + +     L AA   GA  +EL+TG Y +    P +E     ++ 
Sbjct: 123 CAPLLAAGIEVSLFVEPDLAH--LDAALRIGAPVVELHTGAYASAAPGPDREAHLE-RIV 179

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A       L +NAGH L  +N+   I AIP + E+++GHA  A AL  G+ EAV   R
Sbjct: 180 AAAAHGHARGLVVNAGHGLDYENVLP-IAAIPVMHELNIGHAIVARALFTGIGEAVRAMR 238

Query: 244 RACGQHLD 251
            A  +   
Sbjct: 239 AAMDRARR 246


>gi|104783260|ref|YP_609758.1| pyridoxine 5'-phosphate synthase [Pseudomonas entomophila L48]
 gi|122402121|sp|Q1I5W1|PDXJ_PSEE4 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|95112247|emb|CAK16974.1| Pyridoxine 5'-phosphate (PNP) synthase; homooctomer [Pseudomonas
           entomophila L48]
          Length = 240

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 76/242 (31%), Positives = 120/242 (49%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 3   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKDVL 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  +   E+ +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 63  -----QTRMNFEMGVTEEMMLFAEKIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+ +SLF D +  +   +A++  GA  IEL+TG Y      P      L ++  
Sbjct: 118 ERLSRTGAEVSLFIDADERQI--EASRRVGAPAIELHTGRYADA-ETPTDVAEELKRIVD 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   + 
Sbjct: 175 GVAFGVGQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVAEMKA 233

Query: 245 AC 246
             
Sbjct: 234 LI 235


>gi|107100234|ref|ZP_01364152.1| hypothetical protein PaerPA_01001257 [Pseudomonas aeruginosa PACS2]
          Length = 238

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 75/239 (31%), Positives = 122/239 (51%), Gaps = 9/239 (3%)

Query: 8   NLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQ 67
           N++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++     +
Sbjct: 2   NIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVRVLK-----E 56

Query: 68  FPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARL 127
             +  +N E    E  L   E  +P    LVP+   +LT++ G D    +  +   V RL
Sbjct: 57  VLQTRMNFEMGVTEEMLAFAEEIRPAHSCLVPERREELTTEGGLDVAGQEQRIRDAVRRL 116

Query: 128 HNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQ 187
             +GS +SLF D +  +   +A+   GA  IEL+TG Y     +P+++   L ++     
Sbjct: 117 AAVGSEVSLFIDPDPRQI--EASARVGAPAIELHTGRYADA-EDPEEQARELQRVREGVA 173

Query: 188 LAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRAC 246
           L + + L +NAGH L   N+   + AI  I+E+++GHA  A AL  G ++AV   +   
Sbjct: 174 LGRSLGLIVNAGHGLHYHNVEP-VAAIDGINELNIGHAIVAHALFVGFRQAVAEMKALM 231


>gi|170720262|ref|YP_001747950.1| pyridoxine 5'-phosphate synthase [Pseudomonas putida W619]
 gi|229485647|sp|B1J4E3|PDXJ_PSEPW RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|169758265|gb|ACA71581.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas putida
           W619]
          Length = 246

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 76/242 (31%), Positives = 121/242 (50%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVVLLKDVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  +   E+ +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 69  -----QTRMNFEMGVTEEMMAFAEKIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+ +SLF D +  +   +A++  GA  IEL+TG Y      P +    L ++  
Sbjct: 124 ERLSRTGAEVSLFIDADERQI--EASRRVGAPAIELHTGRYADA-QTPTEVAEELKRIVD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   + 
Sbjct: 181 GVAFGVAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVAEMKA 239

Query: 245 AC 246
             
Sbjct: 240 LI 241


>gi|77359686|ref|YP_339261.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudoalteromonas
           haloplanktis TAC125]
 gi|91207559|sp|Q3IDK9|PDXJ_PSEHT RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|76874597|emb|CAI85818.1| pyridoxine 5'-phosphate (PNP) synthase [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 243

 Score =  246 bits (627), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 74/248 (29%), Positives = 123/248 (49%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LR  R   +P+  H   +A  +GA G+T+H R D+RHI+  D+     
Sbjct: 4   ILLGVNVDHIATLRQARGTSYPDPAHAASVAEHAGADGITIHLREDRRHIQDRDVY---- 59

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +  +  +  +N+E    +  +N+    KPE + LVP+   +LT++ G D   N   +T 
Sbjct: 60  -VMAKTIQTRMNLETAVTDEMINIALEVKPEYVCLVPEKREELTTEGGLDVAGNLEKITA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
               L + G ++SLF D +  +  L AAK TGA  +E++TG Y     +       L  +
Sbjct: 119 ATKTLSDAGIKVSLFIDADKAQ--LDAAKATGAPYVEIHTGAYADATTDEA-ISKELEHI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               + A  + L +NAGH L   N+   I A+  I E+++GHA  A A   G+ +AV   
Sbjct: 176 RQGVKYAASIGLIVNAGHGLHYHNVKP-IAAMEEIYELNIGHAIIARAAIDGLDKAVRDM 234

Query: 243 RRACGQHL 250
           +R   +  
Sbjct: 235 KRLMLEAR 242


>gi|152986759|ref|YP_001350088.1| pyridoxine 5'-phosphate synthase [Pseudomonas aeruginosa PA7]
 gi|166219108|sp|A6VAK3|PDXJ_PSEA7 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|150961917|gb|ABR83942.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa PA7]
          Length = 248

 Score =  245 bits (626), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 77/239 (32%), Positives = 122/239 (51%), Gaps = 9/239 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVRMLK- 65

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  +  +N E    E  L   E  +P    LVP+   +LT++ G D    +  +  
Sbjct: 66  ----EVLQTRMNFEMGVTEEMLAFAEEIRPAHSCLVPERREELTTEGGLDVAGQEQRIRD 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +GS +SLF D +  +   +A+   GA  IEL+TG Y     NP ++   L ++
Sbjct: 122 AVRRLAAVGSEVSLFIDPDPRQI--EASARVGAPAIELHTGRYADA-ENPGEQARELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
                L + + L +NAGH L   N+   + AI  I+E+++GHA  A AL  G ++AV  
Sbjct: 179 REGVALGRSLGLIVNAGHGLHYHNVEP-VAAIEGINELNIGHAIVAHALFVGFRQAVAE 236


>gi|159903621|ref|YP_001550965.1| pyridoxine 5'-phosphate synthase [Prochlorococcus marinus str. MIT
           9211]
 gi|238687109|sp|A9BAZ9|PDXJ_PROM4 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|159888797|gb|ABX09011.1| Pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. MIT 9211]
          Length = 243

 Score =  245 bits (626), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 76/251 (30%), Positives = 127/251 (50%), Gaps = 10/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+ VN++ +A +R  R    P  V +  +A   GA G+TVH R D+RHI+  DL  +R
Sbjct: 1   MASLGVNIDHIANVRQARLASEPEPVQMAFLAELGGADGITVHLREDRRHIQDKDLKLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I        LN+E    +  + +  + KP+ +T+VP+   ++T++ G + + N+  L 
Sbjct: 61  ATI-----NTRLNLEMAATKEMVEIALQVKPDMVTIVPESREEITTEGGLEVVNNKEKLR 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +  LH+   + S+F D    +   +A+K  GA  +E++TG Y        ++ I L K
Sbjct: 116 EIINNLHSAKIQTSIFIDPIEAQI--KASKEIGAGWVEIHTGCYANASWE--KQEIELAK 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +  +   A+ M L +NAGH LT  N+   I AI  I E+++GH   A AL  G++ AV  
Sbjct: 172 IKASCAQARSMGLHVNAGHGLTYLNVEP-IAAIEGIEELNIGHTIVARALAVGLQNAVKE 230

Query: 242 FRRACGQHLDN 252
            +        N
Sbjct: 231 MKSLVTNPRRN 241


>gi|163857571|ref|YP_001631869.1| pyridoxine 5'-phosphate synthase [Bordetella petrii DSM 12804]
 gi|226700969|sp|A9IUY4|PDXJ_BORPD RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|163261299|emb|CAP43601.1| pyridoxal phosphate biosynthetic protein [Bordetella petrii]
          Length = 246

 Score =  245 bits (626), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 75/255 (29%), Positives = 122/255 (47%), Gaps = 10/255 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR +R+  +P+ V     A  +GA  +T+H R D+RHI   D+  IR
Sbjct: 1   MIELGVNIDHVATLRQQRHTVYPDPVQAALRAEDAGADLITLHLREDRRHILDADVHAIR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   +  +N+E       L++    +P  + LVP+   +LT++ G +       + 
Sbjct: 61  P-----LLRTRMNLECAITPEMLDIACAVRPSDVCLVPEKRTELTTEGGLEVAGALDAVR 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             VARLH+ G R+SLF D +  +    A    GA  IEL+TG Y        Q    L++
Sbjct: 116 DAVARLHDAGIRVSLFIDPDIAQIQAAA--QAGATVIELHTGAYAEAP--DGQAGPELDR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L        +  +++NAGH L   N+   I A+  I+E+++GHA  A A+  G ++AV  
Sbjct: 172 LRAALAEGLRHGMRVNAGHGLHYGNVAP-IAALDGIAELNIGHAIVAQAVFDGWEKAVRD 230

Query: 242 FRRACGQHLDNTMRL 256
            +    Q     +R 
Sbjct: 231 MKALMVQARQQALRG 245


>gi|167035364|ref|YP_001670595.1| pyridoxine 5'-phosphate synthase [Pseudomonas putida GB-1]
 gi|189036752|sp|B0KV24|PDXJ_PSEPG RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|166861852|gb|ABZ00260.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas putida
           GB-1]
          Length = 246

 Score =  245 bits (626), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 76/242 (31%), Positives = 121/242 (50%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVVVLKDVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  +   E+ +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 69  -----QTRMNFEMGVTEEMMAFAEKIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+ +SLF D +  +   +A++  GA  IEL+TG Y      P +    L ++  
Sbjct: 124 ERLARTGAEVSLFIDADERQI--EASRRVGAPAIELHTGRYADA-QTPTEVAEELKRIVD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   + 
Sbjct: 181 GVAFGVGQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVAEMKA 239

Query: 245 AC 246
             
Sbjct: 240 LI 241


>gi|90419217|ref|ZP_01227127.1| pyridoxal phosphate biosynthesis protein pdxJ [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336154|gb|EAS49895.1| pyridoxal phosphate biosynthesis protein pdxJ [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 247

 Score =  245 bits (625), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 145/249 (58%), Positives = 183/249 (73%), Gaps = 2/249 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MST++SVNLNAVA+LRNRR+LPWP++V  G+IAL++GA GLTVHPRPDQRHIR++DLPE+
Sbjct: 1   MSTALSVNLNAVAMLRNRRDLPWPSVVDFGRIALRAGAHGLTVHPRPDQRHIRFSDLPEL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID +FP AE NIEGYP E FL L E   PEQ+TLVPDDP Q TSDHGWDF    A L
Sbjct: 61  RALIDNEFPAAEFNIEGYPTEDFLALVETVSPEQVTLVPDDPSQPTSDHGWDFAGEGAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL   G+R+SLFAD + +  +++AA  TG D IELYTGPYG  + +P+  +  + 
Sbjct: 121 TPIVARLQAGGARVSLFADADPS--AMKAAAATGCDRIELYTGPYGGTHADPEAAKAEIE 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +L  TA  A    L +NAGHDLT+ N+P L+  IP ++E+S+GH   A ALE G++ +V 
Sbjct: 179 RLGATADAALAAGLGVNAGHDLTVANLPALVARIPELAEVSIGHGLTADALEYGMETSVR 238

Query: 241 CFRRACGQH 249
            FR ACGQ 
Sbjct: 239 RFRAACGQG 247


>gi|254497720|ref|ZP_05110494.1| pyridoxal phosphate biosynthetic protein PdxJ [Legionella
           drancourtii LLAP12]
 gi|254353067|gb|EET11828.1| pyridoxal phosphate biosynthetic protein PdxJ [Legionella
           drancourtii LLAP12]
          Length = 240

 Score =  245 bits (625), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 83/243 (34%), Positives = 131/243 (53%), Gaps = 9/243 (3%)

Query: 8   NLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQ 67
           N++ +A +R  R   +P+ V     A ++GA G+T+H R D RHI+  D+  I+     Q
Sbjct: 2   NIDHIATVRQARGTRYPDPVQAALDAEEAGADGITLHMREDLRHIQARDVRVIK-----Q 56

Query: 68  FPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARL 127
             +  +N+E    E  L+  E   PE   LVP+   +LT++ G D L +Q  +   V RL
Sbjct: 57  VLQTRMNLELAVTEAMLDFAEEISPEHTCLVPEKREELTTEGGLDVLTHQKSVEHAVKRL 116

Query: 128 HNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQ 187
             +GS +SLF D + ++   +AA   GA  IEL+TG Y    +  +Q++  L ++   A+
Sbjct: 117 QAMGSEVSLFIDPDPHQI--KAAAEIGASVIELHTGCYADATH-VEQQQHELKRIKQAAE 173

Query: 188 LAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACG 247
            A  ++L +NAGH L   N+   I AI  + E+++GHA  A AL CG+KEAV   R+   
Sbjct: 174 YAASLNLTVNAGHGLNYHNVQP-IAAINELLELNIGHAIIARALFCGMKEAVKHMRQLML 232

Query: 248 QHL 250
           +  
Sbjct: 233 EAR 235


>gi|237798716|ref|ZP_04587177.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|237806149|ref|ZP_04592853.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331021569|gb|EGI01626.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331027262|gb|EGI07317.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 246

 Score =  245 bits (625), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 80/244 (32%), Positives = 122/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQVRGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D +  + +  A+K  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLARIGCEVSLFIDADERQIA--ASKRVGAPAIELHTGRYADA-QTPTEVAEELQRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ADGVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVSEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KALI 241


>gi|240124108|ref|ZP_04737064.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID332]
 gi|240126275|ref|ZP_04739161.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae SK-92-679]
 gi|268682732|ref|ZP_06149594.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID332]
 gi|268684858|ref|ZP_06151720.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae SK-92-679]
 gi|268623016|gb|EEZ55416.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID332]
 gi|268625142|gb|EEZ57542.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae SK-92-679]
          Length = 242

 Score =  245 bits (625), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 74/246 (30%), Positives = 123/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFA 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  +EL+TG Y     +  ++     +L  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAAYDVGAPVVELHTGAYADA-QSHAEQLKQFERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  + AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLISQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|261749673|ref|YP_003257359.1| pyridoxal phosphate biosynthetic protein [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
 gi|261497766|gb|ACX84216.1| pyridoxal phosphate biosynthetic protein [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
          Length = 243

 Score =  245 bits (625), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 99/248 (39%), Positives = 141/248 (56%), Gaps = 9/248 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              +SVNLN +A LRN R    PNL+ + K   + GA+G+T+HPRPD+RHI Y D+ +++
Sbjct: 1   MVKLSVNLNKIATLRNARGGNIPNLLQVAKDVQKYGANGITIHPRPDERHITYKDVYDLK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   K ELNIEG P   F+NL     P Q+TLVPD  + +TS+ GW+ +  Q LLT
Sbjct: 61  -----SIVKTELNIEGRPINKFMNLVLDILPNQVTLVPDPNNVITSNSGWNTICYQDLLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           +TV +L N G R S+F D +       A+  TGAD IELYT  +   Y N +     ++ 
Sbjct: 116 ETVKKLKNHGIRTSIFLDPDPKLVPYAAS--TGADRIELYTENFAVGYANKKWNC--IDP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
             ITA+ A    L INAGH L ++NI  LI  IP I E+S+G A  + +L  G++  +  
Sbjct: 172 YIITAKEAINHHLLINAGHGLNLENISFLIENIPSIVEVSIGQALISDSLYMGLENTIQT 231

Query: 242 FRRACGQH 249
           + +   + 
Sbjct: 232 YLKRIYKA 239


>gi|261391961|emb|CAX49425.1| pyridoxal phosphate biosynthetic protein PdxJ (PNP synthase)
           [Neisseria meningitidis 8013]
          Length = 242

 Score =  245 bits (625), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 75/246 (30%), Positives = 123/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  +EL+TG Y     +  ++     +L  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAAYDVGAPVVELHTGAYADA-RSHAEQLKQFERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  + AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLISQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|71064912|ref|YP_263639.1| pyridoxine 5'-phosphate synthase [Psychrobacter arcticus 273-4]
 gi|91207561|sp|Q4FUV3|PDXJ_PSYA2 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|71037897|gb|AAZ18205.1| putative pyridoxal phosphate biosynthetic protein [Psychrobacter
           arcticus 273-4]
          Length = 264

 Score =  245 bits (625), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 78/248 (31%), Positives = 121/248 (48%), Gaps = 12/248 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R + +P+ +    +  ++GA G+T+H R D+RHI+  D+ E+   +
Sbjct: 25  LGVNVDHVATLRQARGVSYPSPLAAALLCEKAGADGITIHLREDRRHIQDADVYEMAGQL 84

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   +N+E       L +  R KP  + LVP+   +LT++ G D      LL   V
Sbjct: 85  T-----TRMNLEMAATTEMLEIACRVKPYWVCLVPEKRAELTTEGGLDVAGQLDLLKDYV 139

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGAC----YNNPQQERIFLN 180
           A+L   G ++SLF D    +  + AA   GAD IEL+TG Y               +   
Sbjct: 140 AKLQAAGIKVSLFIDP--EDKQINAAVTCGADAIELHTGSYAEAGLAGDIEKGSVELERI 197

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           K A+         L +NAGH LT  N+   I  I  I E+++GHA  A AL  G+++AV 
Sbjct: 198 KTAVITAKRIDSKLLVNAGHGLTHDNVNA-IAQIDGIYELNIGHALIADALFVGIEQAVI 256

Query: 241 CFRRACGQ 248
             + A  +
Sbjct: 257 MMKIAMHR 264


>gi|226943502|ref|YP_002798575.1| pyridoxine 5'-phosphate synthase [Azotobacter vinelandii DJ]
 gi|259530335|sp|C1DQS7|PDXJ_AZOVD RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|226718429|gb|ACO77600.1| pyridoxal phosphate biosynthetic protein PdxJ [Azotobacter
           vinelandii DJ]
          Length = 248

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 74/244 (30%), Positives = 116/244 (47%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ +     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPLKAALDAEEAGADGITVHLREDRRHIQERDVRVLK- 65

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  +  +N E    E  L   E  +P     VP+   +LT++ G D    +A +  
Sbjct: 66  ----EVLQTRMNFEMGVTEEMLAFAELIRPAHACFVPETRQELTTEGGLDVAGQEARIRA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +G  +SLF D    +   +AA   GA  +EL+TG Y      P +    L ++
Sbjct: 122 AVERLARIGCEVSLFIDAEPQQI--EAAARIGAPAVELHTGRYADA-RTPAETARELARI 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               +      L +NAGH L   N+   + AIP + E+++GHA  A AL  G K AV   
Sbjct: 179 RDGVEYGLSHGLIVNAGHGLHYHNVEP-VAAIPGMHELNIGHAIVAHALFVGFKAAVQEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KLLM 241


>gi|325268087|ref|ZP_08134733.1| pyridoxine 5'-phosphate synthase [Kingella denitrificans ATCC
           33394]
 gi|324980472|gb|EGC16138.1| pyridoxine 5'-phosphate synthase [Kingella denitrificans ATCC
           33394]
          Length = 305

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 126/247 (51%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R + +P+ +    IA   GA  +T+H R D+RHI+  D+  I+   
Sbjct: 64  LGVNIDHVATLRNARGVSYPSPLEAALIAETYGADLITLHLREDRRHIKDDDVALIK--- 120

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    E  L    R +PE + +VP+   ++T++ G D +     +   +
Sbjct: 121 --QAIRTRMNLEMAMTEEMLAHALRIRPEDVCIVPEKRAEVTTEGGLDVIGQAGKVRHYI 178

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L     R+S+F   +  +     A   GA  +EL+TG Y      P+Q R  L ++  
Sbjct: 179 YELQAASIRVSIFIAPDKPQIQK--AFDMGARVVELHTGAYADA-ATPEQCRNELQRIRE 235

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            AQ A ++ + +NAGH LTI N+   I  IP I+E+++GH+  A A+  G+ +A+   + 
Sbjct: 236 AAQFAAQLGMTVNAGHGLTIHNVAP-IAQIPEIAELNIGHSLIAQAVFLGLPKAIAQMKE 294

Query: 245 ACGQHLD 251
              +  +
Sbjct: 295 VMYRARN 301


>gi|163793306|ref|ZP_02187281.1| Pyridoxal phosphate biosynthetic protein PdxJ [alpha
           proteobacterium BAL199]
 gi|159181108|gb|EDP65623.1| Pyridoxal phosphate biosynthetic protein PdxJ [alpha
           proteobacterium BAL199]
          Length = 273

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 113/259 (43%), Positives = 165/259 (63%), Gaps = 6/259 (2%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T++SVNLN VA LRN R+   P+++   +I L++GA+G+TVHPRPD RHIR  D+ ++ 
Sbjct: 16  MTALSVNLNKVATLRNTRHHDAPSVLKAARIVLEAGAAGVTVHPRPDARHIRERDVFDLA 75

Query: 62  RLID-EQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
            L+   ++   E N+EGYP++ FL+L ER +P+Q+TLVPD P Q TSDHGWD   +  +L
Sbjct: 76  ELLKAPEWADREFNVEGYPDDRFLDLIERVRPDQVTLVPDAPEQSTSDHGWDLPADAGIL 135

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              VARL  +G R+SLFAD + +    + AK  GAD +ELYTGPY   +  P+Q  +   
Sbjct: 136 APIVARLKKIGCRVSLFADPDVSVI--EGAKAVGADRVELYTGPYYDAFGGPKQAEVLAV 193

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
                AQ A+ + L +NAGHDLT+ N+P L +AIP+I E+S+GH     AL  G+  +V 
Sbjct: 194 -FVGAAQRARDLGLGLNAGHDLTLDNLPTLSSAIPWIDEVSIGHHLIGDALWMGLAASVK 252

Query: 241 CFRRAC--GQHLDNTMRLT 257
            +++    GQ L  +++  
Sbjct: 253 AYQKCLEAGQSLRASLKTA 271


>gi|253996997|ref|YP_003049061.1| pyridoxine 5'-phosphate synthase [Methylotenera mobilis JLW8]
 gi|253983676|gb|ACT48534.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylotenera
           mobilis JLW8]
          Length = 241

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 119/247 (48%), Gaps = 9/247 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +R  R   +P++V     A QSGA  +T+H R D+RH++  D+  +R
Sbjct: 1   MIKLGVNIDHVATIRQARGTKYPSVVQAALRAEQSGADSITLHLREDRRHMQDADIFALR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + ++N+E    +  L++  +  P+ + LVP+   + T++ G D + N   + 
Sbjct: 61  P-----LLQTKMNLECAVTDEMLDIAIKVMPQDVCLVPERREERTTEGGLDVIGNFDKVQ 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V +L + G R+SLF   +  +    AA   GA  IEL+TG +        Q    L++
Sbjct: 116 HAVKKLSDAGIRVSLFIAPDLAQI--DAAVKVGAPVIELHTGTFADAETERAQ-TSELDR 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +      A+   L +NAGH L   N+ + I  +    E+++GHA  A AL  G   AV  
Sbjct: 173 IERALHHAKDARLVVNAGHGLHYHNVHH-IARMYGFEELNIGHAIVAHALFVGWDNAVRE 231

Query: 242 FRRACGQ 248
            +    +
Sbjct: 232 MKALIKE 238


>gi|325275441|ref|ZP_08141372.1| pyridoxine 5'-phosphate synthase [Pseudomonas sp. TJI-51]
 gi|324099417|gb|EGB97332.1| pyridoxine 5'-phosphate synthase [Pseudomonas sp. TJI-51]
          Length = 246

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 76/242 (31%), Positives = 121/242 (50%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVVLLKDVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  +   E+ +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 69  -----QTRMNFEMGVTEEMMAFAEKIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+ +SLF D +  +   +A++  GA  IEL+TG Y      P +    L ++  
Sbjct: 124 ERLARTGAEVSLFIDADERQI--EASRRVGAPAIELHTGRYADA-QTPAEVADELRRIVD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   + 
Sbjct: 181 GVAFGVGQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVAEMKA 239

Query: 245 AC 246
             
Sbjct: 240 LI 241


>gi|77457224|ref|YP_346729.1| pyridoxine 5'-phosphate synthase [Pseudomonas fluorescens Pf0-1]
 gi|91207560|sp|Q3KHL6|PDXJ_PSEPF RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|77381227|gb|ABA72740.1| pyridoxine 5'-phosphate synthase [Pseudomonas fluorescens Pf0-1]
          Length = 247

 Score =  244 bits (624), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 79/244 (32%), Positives = 122/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  +   ER +P  I LVP+   +LT++ G D    +  +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMMAFAERIRPAHICLVPETRQELTTEGGLDVAGQEERIRA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +GS +SLF D +  + +  A+K  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLSKIGSEVSLFIDADERQIA--ASKRVGAPAIELHTGRYADA-ETPSEVAEELKRV 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 ADGVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKSAVSEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KTLI 241


>gi|296444868|ref|ZP_06886830.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylosinus
           trichosporium OB3b]
 gi|296257536|gb|EFH04601.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylosinus
           trichosporium OB3b]
          Length = 249

 Score =  244 bits (624), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 65/249 (26%), Positives = 115/249 (46%), Gaps = 10/249 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA +RN R    P+ +    +A+++GA G+T H R D+RHIR  D+  ++ 
Sbjct: 5   IRLGVNVDHVATIRNARGGLAPDPIRAALLAIEAGADGITAHLREDRRHIRDEDMARLKA 64

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            I +      LN E    E  L++  + +P  + LVP+   + T++ G D       L  
Sbjct: 65  SISK-----PLNFEMAATEQMLDIALKTQPHAVCLVPERRTERTTEGGLDVFGGHDHLVP 119

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYN--NPQQERIFLN 180
            V  L+    R+SLF + N    ++ AA    A  +EL+TG +       +         
Sbjct: 120 FVDELNRAHIRVSLFIEPNPA--AIDAAASIRAPVVELHTGAWCHAVEIGDAALAEREYA 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++   A    +  ++ +AGH L        I  +P I E+++GH     A+  G+ +++ 
Sbjct: 178 RIVAAAAHTAERGIECHAGHGLDYATARR-IAGLPQIVELNIGHFLIGEAVFVGLSDSIR 236

Query: 241 CFRRACGQH 249
             RRA  + 
Sbjct: 237 QMRRAIDEG 245


>gi|304321230|ref|YP_003854873.1| pyridoxal phosphate biosynthetic protein [Parvularcula bermudensis
           HTCC2503]
 gi|303300132|gb|ADM09731.1| pyridoxal phosphate biosynthetic protein [Parvularcula bermudensis
           HTCC2503]
          Length = 266

 Score =  244 bits (624), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 115/247 (46%), Gaps = 6/247 (2%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA LRN R    P+ V   ++A+ +GA G+T H R D+RHI+  D+  ++  
Sbjct: 21  RLGVNIDHVATLRNARGGTDPDPVRAAQLAIAAGADGITAHLREDRRHIQDADMIRLKDE 80

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           ID       LN E    E    +C +  P    LVP+  ++ T++ G D +  Q  LT  
Sbjct: 81  IDR-----PLNFEMAATEEMAEICLQVSPHAACLVPEKRNERTTEGGLDVVGGQQTLTPI 135

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           + RL   G R+SLF D    +    AA       +      + A    P +       + 
Sbjct: 136 IDRLKEAGIRVSLFIDPEDAQVRAAAALGVPVVELHTGAYHHAALSTTPSRIEAAWRAID 195

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A LA  + L+++AGH LT  N+   I +IP + E+++GH     A+  G+ +AV   R
Sbjct: 196 EAATLADDLGLEVHAGHGLTFHNV-PNIASIPAMRELNIGHFLIGEAVFMGLDQAVREMR 254

Query: 244 RACGQHL 250
           R      
Sbjct: 255 RLITDAR 261


>gi|313500336|gb|ADR61702.1| PdxJ [Pseudomonas putida BIRD-1]
          Length = 246

 Score =  244 bits (624), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 76/242 (31%), Positives = 120/242 (49%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVVLLKDVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  +   E+ +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 69  -----QTRMNFEMGVTEEMMAFAEKIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+ +SLF D +  +   +A++  GA  IEL+TG Y      P      L ++  
Sbjct: 124 ERLARTGAEVSLFIDADERQI--EASRRVGAPAIELHTGRYADA-ETPTDVAEELKRIVE 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   + 
Sbjct: 181 GVAFGVGQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVAEMKA 239

Query: 245 AC 246
             
Sbjct: 240 LI 241


>gi|225024984|ref|ZP_03714176.1| hypothetical protein EIKCOROL_01873 [Eikenella corrodens ATCC
           23834]
 gi|224942214|gb|EEG23423.1| hypothetical protein EIKCOROL_01873 [Eikenella corrodens ATCC
           23834]
          Length = 257

 Score =  244 bits (624), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 76/249 (30%), Positives = 130/249 (52%), Gaps = 9/249 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +    +A   GA  +T+H R D+RHI+  D+  I+   
Sbjct: 17  LGVNIDHVATLRNARGTRYPSPLEAALVAETHGADLITLHLREDRRHIKDADVFAIK--- 73

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E       L+   + +PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 74  --QAIRTRMNLEMALTTEMLDNALQVQPEDVCIVPEKRQEVTTEGGLDVLAQQQTVAEFT 131

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL+  G R+SLF D +  +   +AA+  GA  IEL+TG Y    ++  ++   L +L  
Sbjct: 132 QRLNTAGIRVSLFIDADEQQI--KAARDVGAQAIELHTGAYADATSHTVRQ-NELLRLEE 188

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A ++ L +NAGH LTI N+  +   +P I E+++GHA  A A+  G+ EA+   + 
Sbjct: 189 AAYFASELGLVVNAGHGLTIHNVAPVARILP-IRELNIGHALIAQAVFLGLPEAIRQMKE 247

Query: 245 ACGQHLDNT 253
              +     
Sbjct: 248 EIYRARSQP 256


>gi|257093156|ref|YP_003166797.1| pyridoxine 5'-phosphate synthase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257045680|gb|ACV34868.1| pyridoxal phosphate biosynthetic protein PdxJ [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 251

 Score =  244 bits (624), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 73/259 (28%), Positives = 130/259 (50%), Gaps = 14/259 (5%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +R  R    P+ V     A   GA G+T+H R D+RHI+  D+ ++R
Sbjct: 1   MIELGVNIDHVATIRQARCTYEPDPVWAAVEAHLGGADGITIHLREDRRHIQDADVEKLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  + +LN+E    +  L +  R KP+   LVP+  H++T++ G D L  +  L 
Sbjct: 61  -----ELAQIKLNLEMAATDEMLAIACRIKPQMAMLVPEGRHEVTTEGGLDILAQEERLR 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI---- 177
             V RL + G   S+F D +  +  ++AA   GA   EL+TGPY   + +  ++      
Sbjct: 116 AAVQRLADAGIVTSVFIDADPAQ--VEAAARIGARVCELHTGPYAHAFYHQGRDAESPAV 173

Query: 178 --FLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
              L+K+    +  +++ ++ NAGH L   N+   +  +  I E+ +GHA  + A+  G+
Sbjct: 174 VGELDKIRRAGETIRQLGMRFNAGHALNYFNVQP-VARLAGIRELHIGHAIISRAVFVGL 232

Query: 236 KEAVFCFRRACGQHLDNTM 254
           +EAV   +R   +  + + 
Sbjct: 233 REAVREMKRLLREAQERSR 251


>gi|15965839|ref|NP_386192.1| pyridoxal phosphate biosynthetic protein PdxJ [Sinorhizobium
           meliloti 1021]
 gi|307309596|ref|ZP_07589249.1| Pyridoxine 5'-phosphate synthase [Sinorhizobium meliloti BL225C]
 gi|307321873|ref|ZP_07601258.1| Pyridoxine 5'-phosphate synthase [Sinorhizobium meliloti AK83]
 gi|20139052|sp|Q92NT6|PDXJ_RHIME RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|15075108|emb|CAC46665.1| Probable pyridoxal phosphate biosynthetic protein [Sinorhizobium
           meliloti 1021]
 gi|306892484|gb|EFN23285.1| Pyridoxine 5'-phosphate synthase [Sinorhizobium meliloti AK83]
 gi|306899931|gb|EFN30553.1| Pyridoxine 5'-phosphate synthase [Sinorhizobium meliloti BL225C]
          Length = 250

 Score =  244 bits (624), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 145/248 (58%), Positives = 187/248 (75%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+ ALQ+GASGLTVHPRPDQRHIR++DL  I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVTGLGRTALQAGASGLTVHPRPDQRHIRFSDLQPI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP AE N+EG+PNE FL L ER++PEQ+TLVPDDP Q TSDHGWDF ++  LL
Sbjct: 61  RDLIDDEFPAAEFNMEGFPNEAFLELVERHEPEQVTLVPDDPAQATSDHGWDFRKSHNLL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V RL   G R+SLFADG  +  +L+ AK TGAD IELYTGPYG CY++P++      
Sbjct: 121 GNVVGRLKKRGFRVSLFADGIPDPEALKLAKETGADRIELYTGPYGGCYDDPEKAERIAI 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +L  TA++A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ELGRTAEIAIGLGLAVNAGHDLTVANLPLLVEHIPELAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQ 248
            FRRACG+
Sbjct: 241 RFRRACGE 248


>gi|227822537|ref|YP_002826509.1| pyridoxine 5'-phosphate synthase [Sinorhizobium fredii NGR234]
 gi|227341538|gb|ACP25756.1| pyridoxal phosphate biosynthetic protein PdxJ [Sinorhizobium fredii
           NGR234]
          Length = 292

 Score =  244 bits (624), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 145/250 (58%), Positives = 190/250 (76%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+IALQ+GASGLTVHPRPDQRHIR++DL  I
Sbjct: 43  MPAKLSVNLNAIAMLRNRRDLPWPSVTGVGRIALQAGASGLTVHPRPDQRHIRFSDLQPI 102

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP+AE N+EGYPNE FL L ER++PEQ+TLVPDDP Q TSDHGW+F +N+ALL
Sbjct: 103 RDLIDDEFPEAEFNMEGYPNEEFLQLVERHEPEQVTLVPDDPTQATSDHGWNFRENRALL 162

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V RL   G R+SLFADG+ +  +L+ A+ TGAD IELYTGPYG C+++P        
Sbjct: 163 ASVVGRLKKKGFRVSLFADGDPDPEALKFARETGADRIELYTGPYGGCHDDPDGAERIAG 222

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +L  TA++A  + L +NAGHDL + N+P L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 223 ELGRTAEIAIGLGLGVNAGHDLRVANLPLLVKHIPALAEVSIGHGLTADALEYGMAETVR 282

Query: 241 CFRRACGQHL 250
            FRRACG+ +
Sbjct: 283 RFRRACGEAV 292


>gi|150026129|ref|YP_001296955.1| pyridoxal phosphate biosynthetic protein PdxJ [Flavobacterium
           psychrophilum JIP02/86]
 gi|149772670|emb|CAL44153.1| Pyridoxal phosphate biosynthetic protein PdxJ [Flavobacterium
           psychrophilum JIP02/86]
          Length = 242

 Score =  244 bits (624), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 88/245 (35%), Positives = 131/245 (53%), Gaps = 10/245 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            +SVN+N +A LRN R    P+L+ +     + GA G+T+HPRPD+RHIRY D  +++  
Sbjct: 7   KLSVNINKIATLRNSRGGNVPDLLKVAADIQKFGAQGITIHPRPDERHIRYQDARDLK-- 64

Query: 64  IDEQFPKAELNIEGYPNET-FLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
              Q    E NIEG P E  F++L    KP Q+TLVPD    LTS+ GW+ + N+  LT+
Sbjct: 65  ---QIVYTEYNIEGNPLERSFIDLVLETKPTQVTLVPDGNDNLTSNAGWNTIANKEFLTE 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
                     R+S+F D       ++ AK+TG D IELYT  +   +      +  +   
Sbjct: 122 ITQEFQRHNIRVSIFVDPV--LEMIEGAKITGTDRIELYTEAF--AHQYGLGNKNAIEPY 177

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A LA ++ + +NAGHDL++ NI      IP + E+S+GHA  A +L  G+   V  +
Sbjct: 178 TKAAVLAHELGIGVNAGHDLSLDNIQFFNQNIPNLMEVSIGHALIAESLYLGLDNVVNMY 237

Query: 243 RRACG 247
            +   
Sbjct: 238 LQRLK 242


>gi|313673400|ref|YP_004051511.1| pyridoxine 5'-phosphate synthase [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312940156|gb|ADR19348.1| pyridoxine 5'-phosphate synthase [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 243

 Score =  244 bits (624), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 126/247 (51%), Gaps = 9/247 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +R  R    P+ VH   +A   GA G+TVH R D+RHI   DL  +R
Sbjct: 1   MIKLGVNIDHVATVRQARRGKEPDPVHAAVLAELGGADGITVHLREDRRHIHDRDLFILR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     K +LN+E   N+  +N+    KP+  TLVP+   +LT++ G D + N   + 
Sbjct: 61  DTV-----KVKLNLEMATNDEIINIALSVKPDICTLVPEKREELTTEGGLDVIHNFDRVA 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           +TV  L + G  +S+F D   ++  ++ A  TGA  IE++TG Y        +    L K
Sbjct: 116 RTVEILKSNGIEVSIFIDP--DKKQIEKAVETGARYIEIHTGRYADATTE-DESLEELKK 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   ++ A  +   +NAGH L  +N+  L    P+  E ++GH+  + ++  G+K+AV  
Sbjct: 173 IEAASKYAADLGFVVNAGHGLNYKNVIPLCRIFPF-HEFNIGHSIISKSILVGLKDAVRE 231

Query: 242 FRRACGQ 248
            +    +
Sbjct: 232 MKDILEK 238


>gi|15606602|ref|NP_213982.1| pyridoxal phosphate biosynthetic protein PdxJ [Aquifex aeolicus
           VF5]
 gi|6225837|sp|O67417|PDXJ_AQUAE RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|2983816|gb|AAC07372.1| pyridoxal phosphate synthetase [Aquifex aeolicus VF5]
          Length = 242

 Score =  244 bits (623), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 72/247 (29%), Positives = 126/247 (51%), Gaps = 10/247 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +R  R    P+ V    IA Q+GA  +T+H R D+RHI+  DL  I+  
Sbjct: 2   RLGVNVDHVATVRQARRTFEPSPVFAALIAQQAGADQITLHLREDRRHIQDRDLELIK-- 59

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +     +N+E  P E    +  R KP++ITLVP+   ++T++ G D +  +  L + 
Sbjct: 60  ---ELITIPVNLEMAPTEEMREIALRVKPDRITLVPERREEITTEGGLDVVSLKEKLKEY 116

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ--QERIFLNK 181
           +  +   G  +SLF +    +    A+   GAD IE++TG Y   +N  +  + +  LN+
Sbjct: 117 LKPIKEAGIEVSLFIEAQKEQI--DASVEVGADAIEIHTGRYANLWNEHRFEEAKEELNR 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPY-ISEISVGHAFAATALECGVKEAVF 240
           +   A  A++  L++ AGH LT  N+ + +  +   + E+++GH+  A A+  G + AV 
Sbjct: 175 IKEAAIYAKEKGLKVYAGHGLTYHNVKDFVRELKGYVEELNIGHSIVANAVIFGFERAVK 234

Query: 241 CFRRACG 247
                  
Sbjct: 235 EMLNLIK 241


>gi|26988169|ref|NP_743594.1| pyridoxine 5'-phosphate synthase [Pseudomonas putida KT2440]
 gi|38258003|sp|Q88MY2|PDXJ_PSEPK RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|24982903|gb|AAN67058.1|AE016334_7 pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas putida
           KT2440]
          Length = 246

 Score =  244 bits (623), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 76/242 (31%), Positives = 121/242 (50%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVVLLKDVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  +   E+ +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 69  -----QTRMNFEMGVTEEMMAFAEKIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+ +SLF D +  +   +A++  GA  IEL+TG Y      P +    L ++  
Sbjct: 124 ERLARTGAEVSLFIDADERQI--EASRRVGAPAIELHTGRYADA-ETPTEVAEELKRIVE 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   + 
Sbjct: 181 GVAFGVGHGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAVAEMKA 239

Query: 245 AC 246
             
Sbjct: 240 LI 241


>gi|189218778|ref|YP_001939419.1| pyridoxine 5'-phosphate synthase [Methylacidiphilum infernorum V4]
 gi|189185636|gb|ACD82821.1| Pyridoxal phosphate biosynthesis protein [Methylacidiphilum
           infernorum V4]
          Length = 256

 Score =  244 bits (623), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 81/255 (31%), Positives = 131/255 (51%), Gaps = 16/255 (6%)

Query: 2   STSVSVNLNAVAVLRNRRNLP-------WPNLVHIGKIALQSGASGLTVHPRPDQRHIRY 54
              + +N++ VA LR  R           P+ +   KIA ++GA  +T H R D+RHI+ 
Sbjct: 11  MIRLGLNIDHVATLRQARYKHAPFSSFAEPSPLQAAKIAQEAGAHSITAHLREDRRHIQD 70

Query: 55  TDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFL 114
            D+  IR+ +        LN+E  P    +      KP ++ LVP+   ++T++ G D  
Sbjct: 71  EDMRLIRQAVK------HLNMEMAPISEMVEKAIDIKPNEVCLVPEKREEITTEGGLDVS 124

Query: 115 QNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQ 174
           +N++ L K V  L   G  +SLF D   +   L+AAK TGA CIEL+TG Y       ++
Sbjct: 125 RNESTLRKVVQELSQAGITVSLFIDP--DPIQLKAAKQTGAHCIELHTGQYALAT-EQKR 181

Query: 175 ERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECG 234
               + K  + A LA+ ++LQ+NAGH L   N+   I ++P++  +++GHA  + AL  G
Sbjct: 182 IEEEIEKHKLCAYLAKDLNLQVNAGHGLNYSNLATYIRSVPFLHTVNIGHAIISEALFSG 241

Query: 235 VKEAVFCFRRACGQH 249
           +K AV    +   + 
Sbjct: 242 LKNAVRKMLQLLEKQ 256


>gi|254672797|emb|CBA06901.1| pyridoxine biosynthesis [Neisseria meningitidis alpha275]
 gi|308388651|gb|ADO30971.1| pyridoxal phosphate biosynthetic protein [Neisseria meningitidis
           alpha710]
 gi|325198869|gb|ADY94325.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis G2136]
          Length = 242

 Score =  244 bits (623), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 76/246 (30%), Positives = 123/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  +EL+TG Y     +  ++     +L  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAAYDVGAPVVELHTGAYADA-RSHAEQLKQFERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|296136813|ref|YP_003644055.1| pyridoxal phosphate biosynthetic protein PdxJ [Thiomonas intermedia
           K12]
 gi|295796935|gb|ADG31725.1| pyridoxal phosphate biosynthetic protein PdxJ [Thiomonas intermedia
           K12]
          Length = 257

 Score =  244 bits (623), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 75/248 (30%), Positives = 134/248 (54%), Gaps = 10/248 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ V   + A+++GA  +T H R D+RHIR  D+  ++  +
Sbjct: 14  LGVNIDHVATLRNARGGSFPDPVLAAQQAVEAGADIITFHLREDRRHIRDADVERLKTTL 73

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                 A LN E       L++  R +P+ + LVP+   ++T++ G D       + +  
Sbjct: 74  S-----APLNFESALAPEMLDIICRVRPQMVCLVPERRQEVTTEGGLDVAGQFDRVREAC 128

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYN--NPQQERIFLNKL 182
           ARL + G R+SLF + +  +   +A+   GA CIEL+TG Y   ++  +    +   +++
Sbjct: 129 ARLADFGCRVSLFIEPSIRQI--EASAQAGAPCIELHTGAYANAFDAADEAARQREFDRI 186

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               +L + + LQ NAGH L++Q+    I A+P +SE+ +GHA    A+  G+K++V  F
Sbjct: 187 VAGLKLGRSLGLQTNAGHGLSLQS-TPAIAALPEVSELHIGHALIGHAVFVGLKQSVRDF 245

Query: 243 RRACGQHL 250
           +    + +
Sbjct: 246 QAVIARAV 253


>gi|168702271|ref|ZP_02734548.1| pyridoxal phosphate biosynthetic protein PdxJ [Gemmata
           obscuriglobus UQM 2246]
          Length = 246

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 70/256 (27%), Positives = 122/256 (47%), Gaps = 10/256 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR  R    P+ V    +A   GA G+T+H R D+RHI+  D+  +R
Sbjct: 1   MIRLGVNIDHVATLRQARRAHEPDTVAAAVLATLGGADGITIHLREDRRHIQDRDVFRLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +     LN+E    +  + +  + +P+++TLVP+   +LT++ G D + N A + 
Sbjct: 61  -----ETVTTRLNLEMAAYDEIVEIALKARPDEVTLVPEKRQELTTEGGLDVVANAASVR 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V RL   G  +SLF D +  +    A+   GAD IE  T  Y        +  +   K
Sbjct: 116 GAVERLKGAGVHVSLFIDPDPAQI--DASAQFGADAIEFQTASYSEAKGAAVEAELE--K 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L      A  + L ++ GH L   N+  ++  I  + E+++GH+  + A+  G++ AV  
Sbjct: 172 LRTATARAVGLGLHVHMGHGLNYWNVQPIV-RIAGVEELNIGHSIVSRAVLVGMERAVRE 230

Query: 242 FRRACGQHLDNTMRLT 257
            ++   +H  N  +  
Sbjct: 231 MKQVMQEHYPNPRKSG 246


>gi|149198630|ref|ZP_01875674.1| pyridoxal phosphate biosynthetic protein [Lentisphaera araneosa
           HTCC2155]
 gi|149138345|gb|EDM26754.1| pyridoxal phosphate biosynthetic protein [Lentisphaera araneosa
           HTCC2155]
          Length = 238

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 98/246 (39%), Positives = 142/246 (57%), Gaps = 8/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T++SVN+N VA+LRN R    PN++   +  ++ GA G+T+HPRPD RH  Y+D+ E++
Sbjct: 1   MTALSVNINKVALLRNSRGCDEPNVLQFSQDLIKLGAEGITLHPRPDGRHALYSDVYELK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    ELN+EGYP+E FL +    KP+Q TLVPD P  LTSD GWD  +N   L 
Sbjct: 61  -----KNIDVELNVEGYPSEDFLEMVCEVKPDQCTLVPDPPGALTSDSGWDCEKNMDFLQ 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           K VARL   G R+S+F D +  + +   A  TG D IELYT  Y   Y     E++F   
Sbjct: 116 KVVARLQAEGVRVSIFLDPDPVQVNF--AMKTGTDRIELYTQSYAESYGTDSFEKVFAGY 173

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
            A TA  A ++ + +NAGHDL  +N+  L   +P ++E+S+GHA  +  L  G++  +  
Sbjct: 174 FA-TAARAVELGVGVNAGHDLNQENLTYLKQNLPGLAEVSIGHALISEMLYQGMETTIKN 232

Query: 242 FRRACG 247
           +     
Sbjct: 233 YLDCLK 238


>gi|158423625|ref|YP_001524917.1| pyridoxine 5'-phosphate synthase [Azorhizobium caulinodans ORS 571]
 gi|158330514|dbj|BAF87999.1| pyridoxal phosphate biosynthetic protein [Azorhizobium caulinodans
           ORS 571]
          Length = 253

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 71/253 (28%), Positives = 117/253 (46%), Gaps = 10/253 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + +N++ VA +RN R    P+ V    +A ++G  G+T H R D+RHIR  D+  IR
Sbjct: 4   PIRLGLNVDHVATVRNARGGLNPDPVRAALLAAEAGVDGITAHLREDRRHIRDADIARIR 63

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +        LN E    +  + +    KP    LVP+   + T++ G D     A L 
Sbjct: 64  SEVA-----LPLNFEMAATDEMIAIALSVKPHACCLVPERREERTTEGGLDVAGQAADLK 118

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGA--CYNNPQQERIFL 179
             +A L+  G R+SLF   +  + +  AA+   A  IEL+TG +       +  +     
Sbjct: 119 PRIAALNAAGIRVSLFIAADPVQIA--AARALQASVIELHTGAWCEALAAGHLAEASAEF 176

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            +L   A+ A  + L+++AGH L  +     I A+P I+E+++GH     A+  G+   V
Sbjct: 177 ERLRTGAREAAALGLEVHAGHGLDYET-AEQIAALPEIAELNIGHFMIGEAIFEGLPGVV 235

Query: 240 FCFRRACGQHLDN 252
              R A  +  D 
Sbjct: 236 SLMREAMARGQDR 248


>gi|218768787|ref|YP_002343299.1| pyridoxine 5'-phosphate synthase [Neisseria meningitidis Z2491]
 gi|12644549|sp|Q9RQV9|PDXJ_NEIMA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|6274540|gb|AAF06688.1|AF163663_13 PdxJ [Neisseria meningitidis]
 gi|121052795|emb|CAM09141.1| pyridoxal phophate biosynthetic protein [Neisseria meningitidis
           Z2491]
          Length = 242

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 74/246 (30%), Positives = 124/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQDKIAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA+  GA  +EL+TG Y     +  ++     ++  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAARDVGAPVVELHTGAYADA-RSHAEQIRQFERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  + AL  G+ EAV   + 
Sbjct: 175 GAHFASDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLISQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|121635409|ref|YP_975654.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis FAM18]
 gi|12644548|sp|Q9RML6|PDXJ_NEIMC RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|166219099|sp|A1KVH8|PDXJ_NEIMF RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|6449093|gb|AAF08822.1|AF194079_9 PdxJ [Neisseria meningitidis]
 gi|120867115|emb|CAM10882.1| pyridoxal phophate biosynthetic protein [Neisseria meningitidis
           FAM18]
 gi|254671053|emb|CBA07917.1| pyridoxine biosynthesis [Neisseria meningitidis alpha153]
 gi|319411026|emb|CBY91425.1| pyridoxal phosphate biosynthetic protein PdxJ (PNP synthase)
           [Neisseria meningitidis WUE 2594]
 gi|325128808|gb|EGC51668.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis N1568]
 gi|325132872|gb|EGC55550.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis M6190]
 gi|325138817|gb|EGC61368.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis ES14902]
 gi|325202742|gb|ADY98196.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis M01-240149]
 gi|325203554|gb|ADY99007.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis M01-240355]
 gi|325208738|gb|ADZ04190.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis NZ-05/33]
          Length = 242

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 76/246 (30%), Positives = 122/246 (49%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  +    
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAGFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  +EL+TG Y     +  ++     +L  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAAYDVGAPVVELHTGAYADA-RSHAEQLKQFERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|88801348|ref|ZP_01116876.1| pyridoxal phosphate biosynthetic protein [Polaribacter irgensii
           23-P]
 gi|88782006|gb|EAR13183.1| pyridoxal phosphate biosynthetic protein [Polaribacter irgensii
           23-P]
          Length = 237

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 91/242 (37%), Positives = 135/242 (55%), Gaps = 9/242 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PNL+   +   + G  G+T+HPRPD+RHI+Y D  ++ 
Sbjct: 1   MTKLSVNINKIATLRNSRGGNVPNLLKFAEDIERFGGQGITIHPRPDERHIKYQDARDL- 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   K E NIEG P ++F++L    KP Q+TLVPD    LTS+ GWD +++Q+ L 
Sbjct: 60  ----VSVVKTEFNIEGNPIQSFIDLVLETKPTQVTLVPDAIDALTSNAGWDTIKHQSFLQ 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V      G R S+F     +   ++AA  TG+D IELYT  + A +N   +E   +  
Sbjct: 116 EVVQEFQQNGIRTSIFIG--TDLKLVEAAAKTGSDRIELYTEDFAAQFNIGNKE--AIKP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A LA  + L INAGHDL++ NI      IP ++E+S+GH+    +L  G++  V  
Sbjct: 172 YTTAAVLAHTLGLGINAGHDLSLDNIQFFKENIPNLAEVSIGHSLIVESLYLGIENVVNM 231

Query: 242 FR 243
           + 
Sbjct: 232 YL 233


>gi|296122565|ref|YP_003630343.1| pyridoxine 5'-phosphate synthase [Planctomyces limnophilus DSM
           3776]
 gi|296014905|gb|ADG68144.1| Pyridoxine 5'-phosphate synthase [Planctomyces limnophilus DSM
           3776]
          Length = 255

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 104/248 (41%), Positives = 149/248 (60%), Gaps = 4/248 (1%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N VA+LRN R+L  P+++    + + +GA G+TVHPRPD+RHIR +D+ E+ 
Sbjct: 4   KTKLSVNVNKVALLRNSRHLGIPSVLRAASLCIAAGAEGITVHPRPDERHIRRSDVRELS 63

Query: 62  RLIDEQFPKAELNIEGYP-NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
            LI +  P  ELNIEG P  + FL+L     P+Q T+VPD P Q TSDHGW+ L ++  L
Sbjct: 64  ALIRQHHPHIELNIEGNPLADGFLDLVFEVVPDQCTMVPDSPEQSTSDHGWNVLADREKL 123

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              + +L   G R SLF D +  +  + AAK  GAD IELYT PY A     +     L 
Sbjct: 124 VPVLEKLRAAGIRSSLFLDPDVTQ--VAAAKEVGADRIELYTEPY-ASSYGKENAGEILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +   TA++A +  L +NAGHDL ++N+   +  +P + E+S+GHA  A ALE G    V 
Sbjct: 181 QYVATAKMALEHGLGVNAGHDLNLENLGKFLREVPAVLEVSIGHALIADALELGYATTVA 240

Query: 241 CFRRACGQ 248
            +R+   +
Sbjct: 241 AYRKVIRE 248


>gi|22002558|gb|AAM82709.1| PdxJ [Synechococcus elongatus PCC 7942]
          Length = 257

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 66/243 (27%), Positives = 118/243 (48%), Gaps = 9/243 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +R  R    P+ +    +A  +GA G+T H R D+RHI+  D+  +R   
Sbjct: 21  LGVNIDHVATVRQARRTVEPDPIAAAVLAELAGAEGITAHLREDRRHIQDRDVRLLR--- 77

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  LN+E    +  + +    +P+ +TLVP+   ++T++ G + +  +  L   V
Sbjct: 78  --QTVRTRLNLEMAATDEMVAIALDIRPDYVTLVPERREEVTTEGGLNVVGQRDRLALVV 135

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L + G  +SLF D   ++ +  A     A  IEL+TG Y        Q +        
Sbjct: 136 DQLQSAGIPVSLFIDAEPDQIAASA--AIQAQWIELHTGRYAEAETEAAQAQELAAL-RQ 192

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             + A    L++NAGH LT  N+   +  +P + E+++GH   + A+  G++ AV   + 
Sbjct: 193 GCEQAIAAGLRVNAGHGLTYWNV-YPVAQLPGMEELNIGHTIISRAVLVGLERAVREMKL 251

Query: 245 ACG 247
           A  
Sbjct: 252 AMQ 254


>gi|86358373|ref|YP_470265.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhizobium etli CFN
           42]
 gi|86282475|gb|ABC91538.1| pyridoxal phosphate biosynthetic (pyridoxine 5`-phosphate synthase)
           protein [Rhizobium etli CFN 42]
          Length = 250

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 151/250 (60%), Positives = 189/250 (75%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+IAL SGASGLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVETLGRIALASGASGLTVHPRPDQRHIRFSDLPVI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FPKAE NIEGYP E FL LC    PEQ+TLVPDDP Q TSDHGWDF ++QA L
Sbjct: 61  RNLIDDEFPKAEFNIEGYPTEEFLELCAGAAPEQVTLVPDDPSQATSDHGWDFRKHQAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL  +G R+SLFADG+G+  +++ AK+ GAD IELYTGPYG CY+ P++    L 
Sbjct: 121 TDVVARLKKMGCRVSLFADGDGDAEAVKIAKVVGADRIELYTGPYGGCYDAPERAAPILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A  + L +NAGHDLT+ N+P+L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ALGKTADAALAIGLDVNAGHDLTVANLPDLVKRIPDLAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQHL 250
            F RACGQ +
Sbjct: 241 RFCRACGQKV 250


>gi|218682862|ref|ZP_03530463.1| pyridoxine 5'-phosphate synthase [Rhizobium etli CIAT 894]
          Length = 250

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 150/250 (60%), Positives = 188/250 (75%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+IAL +GASGLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVEALGRIALAAGASGLTVHPRPDQRHIRFSDLPVI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FPKAE NIEGYP E FL+LC    PEQ+TLVPDDP Q TSDHGWDF ++QA L
Sbjct: 61  RNLIDDEFPKAEFNIEGYPTEEFLDLCAGAAPEQVTLVPDDPSQATSDHGWDFRKHQAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL  +G R+SLFADG+G+  +++ AK  GAD IELYTGPYG CY+ P++    L 
Sbjct: 121 TDVVARLKKMGCRVSLFADGDGDVEAVEIAKAVGADRIELYTGPYGGCYDAPERAAPILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ALGKTADAALAIGLAVNAGHDLTVANLPALVKRIPALAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQHL 250
            F RACGQ +
Sbjct: 241 RFCRACGQKV 250


>gi|294340982|emb|CAZ89377.1| Pyridoxal phosphate biosynthetic protein pdxJ (PNP synthase)
           [Thiomonas sp. 3As]
          Length = 254

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 75/248 (30%), Positives = 134/248 (54%), Gaps = 10/248 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ V   + A+++GA  +T H R D+RHIR  D+  ++  +
Sbjct: 11  LGVNIDHVATLRNARGGSFPDPVLAAQQAVEAGADIITFHLREDRRHIRDADVERLKATL 70

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                 A LN E       L++  R +P+ + LVP+   ++T++ G D       + +  
Sbjct: 71  S-----APLNFESALAPEMLDIICRVRPQMVCLVPERRQEVTTEGGLDVAGQFDRVREAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYN--NPQQERIFLNKL 182
           ARL + G R+SLF + +  +   +A+   GA CIEL+TG Y   ++  +    +   +++
Sbjct: 126 ARLADFGCRVSLFIEPSIWQI--EASAQAGAPCIELHTGAYANAFDAADEAARQREFDRI 183

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               +L + + LQ NAGH L++Q+    I A+P +SE+ +GHA    A+  G+K++V  F
Sbjct: 184 VAGLKLGRSLGLQTNAGHGLSLQS-TPAIAALPEVSELHIGHALIGHAVFVGLKQSVRDF 242

Query: 243 RRACGQHL 250
           +    + +
Sbjct: 243 QAVIARAV 250


>gi|240128775|ref|ZP_04741436.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae SK-93-1035]
 gi|268687159|ref|ZP_06154021.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae SK-93-1035]
 gi|268627443|gb|EEZ59843.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae SK-93-1035]
          Length = 242

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 73/246 (29%), Positives = 122/246 (49%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFA 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  +EL+TG Y     +  ++     ++  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAAYDVGAPVVELHTGAYADA-QSHAEQIRQFERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  A AL  G+ E V   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLIAQALFLGLPETVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|70728456|ref|YP_258205.1| pyridoxine 5'-phosphate synthase [Pseudomonas fluorescens Pf-5]
 gi|91207558|sp|Q4KHS8|PDXJ_PSEF5 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|68342755|gb|AAY90361.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           fluorescens Pf-5]
          Length = 248

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 79/240 (32%), Positives = 122/240 (50%), Gaps = 9/240 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  +   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMMAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +GS +SLF D +  +   +A+K  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLSKIGSEVSLFIDADERQI--EASKRVGAPAIELHTGRYADA-QTPSEVAEELQRI 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
                +     L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 VDGVAVGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKGAVAEM 237


>gi|56750365|ref|YP_171066.1| pyridoxine 5'-phosphate synthase [Synechococcus elongatus PCC 6301]
 gi|81300003|ref|YP_400211.1| pyridoxine 5'-phosphate synthase [Synechococcus elongatus PCC 7942]
 gi|56685324|dbj|BAD78546.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus
           elongatus PCC 6301]
 gi|81168884|gb|ABB57224.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus
           elongatus PCC 7942]
          Length = 265

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 66/243 (27%), Positives = 118/243 (48%), Gaps = 9/243 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +R  R    P+ +    +A  +GA G+T H R D+RHI+  D+  +R   
Sbjct: 29  LGVNIDHVATVRQARRTVEPDPIAAAVLAELAGAEGITAHLREDRRHIQDRDVRLLR--- 85

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  LN+E    +  + +    +P+ +TLVP+   ++T++ G + +  +  L   V
Sbjct: 86  --QTVRTRLNLEMAATDEMVAIALDIRPDYVTLVPERREEVTTEGGLNVVGQRDRLALVV 143

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L + G  +SLF D   ++ +  A     A  IEL+TG Y        Q +        
Sbjct: 144 DQLQSAGIPVSLFIDAEPDQIAASA--AIQAQWIELHTGRYAEAETEAAQAQELAAL-RQ 200

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             + A    L++NAGH LT  N+   +  +P + E+++GH   + A+  G++ AV   + 
Sbjct: 201 GCEQAIAAGLRVNAGHGLTYWNV-YPVAQLPGMEELNIGHTIISRAVLVGLERAVREMKL 259

Query: 245 ACG 247
           A  
Sbjct: 260 AMQ 262


>gi|282895579|ref|ZP_06303713.1| Pyridoxal phosphate biosynthetic protein PdxJ [Raphidiopsis brookii
           D9]
 gi|281199419|gb|EFA74283.1| Pyridoxal phosphate biosynthetic protein PdxJ [Raphidiopsis brookii
           D9]
          Length = 249

 Score =  243 bits (621), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 73/250 (29%), Positives = 123/250 (49%), Gaps = 10/250 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M T + VN++ +A +R  R    P+ +    +A   GA G+T H R D+RHI+  D+  +
Sbjct: 1   MPT-LGVNIDHIATIRQARRTIEPDPIVAAMLAELGGADGITAHLREDRRHIQDRDVRLL 59

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           +     Q  +  LN+E    +  L +    KP+ +TLVP+   ++T++ G D L   A +
Sbjct: 60  K-----QTVRTHLNLEMAATDEMLAIALDIKPDYVTLVPEKREEITTEGGLDILGQIARI 114

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V +L +    +SLF D    + +  AA    A  IEL+TG Y    +   +    L 
Sbjct: 115 GMIVDKLQSANIPVSLFIDAEPAQIA--AAVKVQAKFIELHTGKYAEAKDETTR-HQELA 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            LA   + A    L++N+GH LT  N+   + A+P + E+++GH   + A   G++ AV 
Sbjct: 172 LLAKGCEQAIATGLRVNSGHGLTYWNV-FPVAALPGMEELNIGHTIISRAALVGIERAVR 230

Query: 241 CFRRACGQHL 250
             ++A G   
Sbjct: 231 EMKQAMGNSR 240


>gi|154253311|ref|YP_001414135.1| pyridoxine 5'-phosphate synthase [Parvibaculum lavamentivorans
           DS-1]
 gi|154157261|gb|ABS64478.1| pyridoxal phosphate biosynthetic protein PdxJ [Parvibaculum
           lavamentivorans DS-1]
          Length = 265

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 73/250 (29%), Positives = 125/250 (50%), Gaps = 10/250 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R    P+ V   ++A  +GA G+T H R D+RHIR  D+  ++  
Sbjct: 10  RLGVNIDHVATIRNARGGDHPDPVRAAEVAAAAGADGITAHLREDRRHIRDADIARLKGE 69

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I        LN+E       LN+  R+ P    +VP+   ++T++ G D       L   
Sbjct: 70  I-----GLPLNLEMAATPEMLNIALRHVPHACCIVPERREEVTTEGGLDAAGLHNHLKPI 124

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGAC--YNNPQQERIFLNK 181
           V RL + G R+SLF + +  +  L+AA   GA  +EL+TG Y          +    L +
Sbjct: 125 VQRLGDAGIRVSLFINADRRQ--LEAACSLGAPVVELHTGAYCDAAVARESAKRDAELAR 182

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           LA+ A+   ++ L+++AGH LT   +   + A+P ++E+++GH     A+  G+  ++  
Sbjct: 183 LAMAAREGAELGLEVHAGHGLTFDTVTP-VAALPELAELNIGHFLVGEAIFIGLDASIKQ 241

Query: 242 FRRACGQHLD 251
            R A  +   
Sbjct: 242 MRAAMDEARK 251


>gi|288576346|ref|ZP_05978630.2| pyridoxine 5'-phosphate synthase [Neisseria mucosa ATCC 25996]
 gi|288565708|gb|EFC87268.1| pyridoxine 5'-phosphate synthase [Neisseria mucosa ATCC 25996]
          Length = 265

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 75/246 (30%), Positives = 124/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 26  LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 82

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  P+ + +VP+   ++T++ G D L  Q  + +  
Sbjct: 83  --NAIRTRLNLEMALTEEMLENALKVMPQDVCIVPEKRQEITTEGGLDVLAQQEKIAEFT 140

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D + ++   QAA   GA  IEL+TG Y    ++  ++     +L  
Sbjct: 141 KILTDAGIRVSLFIDADNDQI--QAAYDVGAPVIELHTGAYADA-HSHAEQIQQFERLQN 197

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 198 GAHFASDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 256

Query: 245 ACGQHL 250
              +  
Sbjct: 257 TMFRAR 262


>gi|240118564|ref|ZP_04732626.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID1]
 gi|268604273|ref|ZP_06138440.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID1]
 gi|268588404|gb|EEZ53080.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID1]
          Length = 242

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 74/246 (30%), Positives = 123/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFA 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  +EL+TG Y     +  ++     ++  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAAYDVGAPVVELHTGAYADA-QSHAEQIRQFERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|254494291|ref|ZP_05107462.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae 1291]
 gi|226513331|gb|EEH62676.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae 1291]
          Length = 242

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 74/246 (30%), Positives = 124/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFA 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  +EL+TG Y    ++  ++     +L  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAAYDVGAPVVELHTGAYADA-HSHAEQIRQFERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  + AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLISQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|90407382|ref|ZP_01215567.1| pyridoxal phosphate biosynthetic protein [Psychromonas sp. CNPT3]
 gi|90311533|gb|EAS39633.1| pyridoxal phosphate biosynthetic protein [Psychromonas sp. CNPT3]
          Length = 246

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 82/246 (33%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P   H+  IA  SGA G+T+H R D+RHI   D+  +    
Sbjct: 6   LGVNIDHVATLRNARGTCYPEPAHLAGIAETSGADGITIHLREDRRHIIDRDVAIL---- 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  +++  + KP  + LVP+   +LT++ G D           V
Sbjct: 62  -AQTLQTRMNLEMAITDEMIDIAIKTKPAFVCLVPEKRAELTTEGGLDVAGALDKTRSAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D + N+    AA  +GA  IEL+TG Y    ++  Q  + L ++A 
Sbjct: 121 QRLTQAGIQVSLFIDADKNQI--DAALASGAPYIELHTGKYADALDDEMQA-LELQRVAS 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH L   N+   I A+P I E+++GHA  A AL  G+  AV   +R
Sbjct: 178 MATYAHGLGLKVNAGHGLNYHNV-KAIAALPEIIELNIGHAIIARALVDGLSVAVQEMKR 236

Query: 245 ACGQHL 250
              +  
Sbjct: 237 LMIEGR 242


>gi|254805523|ref|YP_003083744.1| pyridoxine 5-phosphate synthase [Neisseria meningitidis alpha14]
 gi|254669065|emb|CBA07570.1| pyridoxine 5-phosphate synthase [Neisseria meningitidis alpha14]
 gi|325134815|gb|EGC57451.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis M13399]
 gi|325144986|gb|EGC67269.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis M01-240013]
 gi|325205514|gb|ADZ00967.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis M04-240196]
          Length = 242

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 75/246 (30%), Positives = 123/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQDKIAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  +EL+TG Y     +  ++     ++  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAAYDVGAPVVELHTGAYADA-RSHAEQIRQFERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|172038213|ref|YP_001804714.1| pyridoxine 5'-phosphate synthase [Cyanothece sp. ATCC 51142]
 gi|226700970|sp|B1WY64|PDXJ_CYAA5 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|171699667|gb|ACB52648.1| pyridoxal phosphate biosynthetic protein [Cyanothece sp. ATCC
           51142]
          Length = 240

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 71/246 (28%), Positives = 124/246 (50%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             ++ VN++ VA +R  R    P+ V    +A   GA+G+T H R D+RH++  D+  +R
Sbjct: 1   MLTLGVNIDHVATIRQARRTVEPDPVAAAVLAELGGANGITAHLREDRRHMQDRDIRILR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  +  LN+E    E  + +    KP+ +TLVP+   ++T++ G D   +   L 
Sbjct: 61  -----ETVRTHLNLEMAATEEMVAIALDIKPDYVTLVPEKREEVTTEGGLDIAGSLEKLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V RL +    +SLF D +  +   +A+  T A  IEL+TG Y    N   ++   L  
Sbjct: 116 NVVDRLQSANIPVSLFIDADEAQI--KASAETQAKFIELHTGKYADAPNAEIRQ-KELES 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L +  + A  + L++NAGH LT  N+   +  +P + E+++GH   + A+  G++ AV  
Sbjct: 173 LKLGCEQALSLGLRVNAGHGLTYINV-YPVACLPGMEELNIGHTIVSRAVLVGMERAVRE 231

Query: 242 FRRACG 247
            + A  
Sbjct: 232 MKLAMR 237


>gi|319953657|ref|YP_004164924.1| pyridoxine 5'-phosphate synthase [Cellulophaga algicola DSM 14237]
 gi|319422317|gb|ADV49426.1| pyridoxine 5'-phosphate synthase [Cellulophaga algicola DSM 14237]
          Length = 242

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 92/249 (36%), Positives = 130/249 (52%), Gaps = 10/249 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVN+N +A LRN R    PNL+ + K     GA G+T+HPRPD+RHIRY D  E++
Sbjct: 1   MTKLSVNINKIATLRNARGGNVPNLLVVAKDIEDFGAQGITIHPRPDERHIRYADARELK 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +       E NIEG PN+ F+ L    KP Q+TLVPD    +TS+ GW+ +++   L 
Sbjct: 61  DTVM-----TEYNIEGNPNKNFIALVLDVKPTQVTLVPDAEDAITSNAGWNTIKHHDFLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY---NNPQQERIF 178
             +      G R S+F D +     ++ A   GAD IELYT  +   Y    N + +   
Sbjct: 116 DVIKTFKENGIRTSIFVDPDTA--MVEGAAKVGADRIELYTESFAHNYGIAKNLEDKNAA 173

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           +      A+ A K+ L INAGHDL++ NI      IP + E+S+GHA    AL  G+   
Sbjct: 174 IQPFIDAAKTATKLGLGINAGHDLSLDNIKFFKENIPNLLEVSIGHALICEALYFGLDNV 233

Query: 239 VFCFRRACG 247
           V  +     
Sbjct: 234 VNMYLHKLK 242


>gi|161870626|ref|YP_001599799.1| pyridoxine 5'-phosphate synthase [Neisseria meningitidis 053442]
 gi|189036750|sp|A9M276|PDXJ_NEIM0 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|161596179|gb|ABX73839.1| pyridoxal phophate biosynthetic protein [Neisseria meningitidis
           053442]
          Length = 242

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 76/246 (30%), Positives = 123/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  +    
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAGFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  IEL+TG Y    ++  ++     ++  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAAYDVGAPVIELHTGAYADA-HSHAEQMKQFERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHYASDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|240116278|ref|ZP_04730340.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID18]
 gi|260439908|ref|ZP_05793724.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae DGI2]
 gi|268601943|ref|ZP_06136110.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID18]
 gi|291043182|ref|ZP_06568905.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae DGI2]
 gi|268586074|gb|EEZ50750.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID18]
 gi|291012788|gb|EFE04771.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae DGI2]
          Length = 242

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 75/246 (30%), Positives = 125/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA+  GA  IEL+TG Y    ++  ++     +L  
Sbjct: 118 KILTDAGIRVSLFIDADNEQI--QAARDVGAPVIELHTGAYADA-HSHAEQIRQFERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  + AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLISQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|325136836|gb|EGC59434.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis M0579]
          Length = 242

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 77/246 (31%), Positives = 124/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTIYPSPVEAALIAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQDKIAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA+  GA  +EL+TG Y     +  ++     +L  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAARDVGAPVVELHTGAYADA-RSHAEQLKQFERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|325130815|gb|EGC53549.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis OX99.30304]
          Length = 242

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 75/246 (30%), Positives = 123/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  +EL+TG Y     +  ++     ++  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAAYDVGAPVVELHTGAYADA-RSHAEQIRQFERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|59801846|ref|YP_208558.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           gonorrhoeae FA 1090]
 gi|239999575|ref|ZP_04719499.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae 35/02]
 gi|240113376|ref|ZP_04727866.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae MS11]
 gi|268595388|ref|ZP_06129555.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae 35/02]
 gi|268599449|ref|ZP_06133616.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae MS11]
 gi|293398515|ref|ZP_06642693.1| pyridoxal phosphate biosynthesis protein PdxJ [Neisseria
           gonorrhoeae F62]
 gi|75432413|sp|Q5F6P1|PDXJ_NEIG1 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|59718741|gb|AAW90146.1| putative pyridoxal phosphate biosynthetic protein [Neisseria
           gonorrhoeae FA 1090]
 gi|268548777|gb|EEZ44195.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae 35/02]
 gi|268583580|gb|EEZ48256.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae MS11]
 gi|291610986|gb|EFF40083.1| pyridoxal phosphate biosynthesis protein PdxJ [Neisseria
           gonorrhoeae F62]
 gi|317164826|gb|ADV08367.1| pyridoxine 5''''-phosphate synthase [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 242

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 74/246 (30%), Positives = 124/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFA 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA+  GA  +EL+TG Y     +  ++     ++  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAARDVGAPVVELHTGAYADA-QSHAEQIRQFERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|194099317|ref|YP_002002415.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae NCCP11945]
 gi|193934607|gb|ACF30431.1| pyridoxal phosphate biosynthetic protein [Neisseria gonorrhoeae
           NCCP11945]
          Length = 255

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 74/246 (30%), Positives = 123/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 16  LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 72

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 73  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFA 130

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  +EL+TG Y     +  ++     ++  
Sbjct: 131 KILTDAGIRVSLFIDADDRQI--QAAYDVGAPVVELHTGAYADA-QSHAEQIRQFERIQN 187

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 188 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 246

Query: 245 ACGQHL 250
           A  +  
Sbjct: 247 AMFRAR 252


>gi|325142931|gb|EGC65290.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis 961-5945]
          Length = 242

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 75/246 (30%), Positives = 124/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA+  GA  +EL+TG Y     +  ++     ++  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAARDVGAPVVELHTGAYADA-RSHAEQIRQFERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|294789556|ref|ZP_06754791.1| pyridoxine 5'-phosphate synthase [Simonsiella muelleri ATCC 29453]
 gi|294482493|gb|EFG30185.1| pyridoxine 5'-phosphate synthase [Simonsiella muelleri ATCC 29453]
          Length = 242

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 78/249 (31%), Positives = 126/249 (50%), Gaps = 10/249 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  I+   
Sbjct: 3   LGVNIDHVATLRNARGAGYPSPVEAALVAETHGADLITLHLREDRRHIKDADVFAIK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  K  +N+E    E  L      +PE + +VP+   ++T++ G D +  Q  +   V
Sbjct: 60  --QAIKTRMNLEMAMTEEMLANAINVQPEDVCIVPEKRQEITTEGGLDIVAQQDKVADYV 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           A+L     R+SLF D +  +   QAA   GA  IE++TG Y             L ++  
Sbjct: 118 AKLQQNQIRVSLFIDADLAQI--QAAYDVGARVIEIHTGAY--AEKAAHDRAAELARIRQ 173

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A+K+ + +NAGH LTIQN+   I  IP I E+++GH+  A A+  G+ +A+   + 
Sbjct: 174 AAEFAEKLGITVNAGHGLTIQNVAP-IAQIPQIVELNIGHSIIAQAVFLGLPKAIEQMKE 232

Query: 245 ACGQHLDNT 253
              +     
Sbjct: 233 TMFRARFQA 241


>gi|240014752|ref|ZP_04721665.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae DGI18]
 gi|240017200|ref|ZP_04723740.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae FA6140]
 gi|240121275|ref|ZP_04734237.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID24-1]
          Length = 242

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 75/246 (30%), Positives = 122/246 (49%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  +    
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAGFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  +EL+TG Y     +  ++     +L  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAAYDVGAPVVELHTGAYADA-RSHAEQIRQFERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|240081162|ref|ZP_04725705.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae FA19]
 gi|268597272|ref|ZP_06131439.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae FA19]
 gi|268551060|gb|EEZ46079.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae FA19]
          Length = 242

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 75/246 (30%), Positives = 123/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFA 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  +EL+TG Y     +  ++     +L  
Sbjct: 118 KILTDAGIRVSLFIDADNEQI--QAAYDVGAPVVELHTGAYADA-RSHAEQIRQFERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|159042752|ref|YP_001531546.1| pyridoxine 5'-phosphate synthase [Dinoroseobacter shibae DFL 12]
 gi|157910512|gb|ABV91945.1| pyridoxine 5'-phosphate synthase [Dinoroseobacter shibae DFL 12]
          Length = 254

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 69/249 (27%), Positives = 118/249 (47%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R    P+ V    +A Q+GA G+T H R D+RHI   D+  +   
Sbjct: 13  RLGVNIDHVATVRNARGGAVPDPVRAAVLAQQAGADGITAHLREDRRHIGDADIEALMAA 72

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +        LN E    +    +  R+ P  + +VP+   + T++ G +  +++  L   
Sbjct: 73  LT-----VPLNFEMAATDEMQAIALRHVPHAVCIVPEKREERTTEGGLEVARDENRLAHF 127

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG--ACYNNPQQERIFLNK 181
           +A L   G R+S+F   +  +   +AA   GA  IEL+TG Y   A   +       L +
Sbjct: 128 IAPLREAGCRVSIFIAADRAQI--EAAHRIGAPVIELHTGAYCDAAAEGDIAARDAELAR 185

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   A  A  + L+++AGH L+   +   I A+P + E+++GH     A+  G+ +A+  
Sbjct: 186 LTEMAAFAYDLGLEVHAGHGLSYDTVAP-IAALPQVRELNIGHFLIGEAIFRGLPDAMAE 244

Query: 242 FRRACGQHL 250
            RR      
Sbjct: 245 MRRRMDAAR 253


>gi|114704820|ref|ZP_01437728.1| pyridoxal phosphate biosynthetic protein [Fulvimarina pelagi
           HTCC2506]
 gi|114539605|gb|EAU42725.1| pyridoxal phosphate biosynthetic protein [Fulvimarina pelagi
           HTCC2506]
          Length = 250

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 143/248 (57%), Positives = 180/248 (72%), Gaps = 2/248 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M T +SVNLNAVA+LRNRR+LPWP++  +G+IAL +GA GLTVHPRPDQRHIR++DLPEI
Sbjct: 1   MPTQLSVNLNAVAMLRNRRDLPWPSVTGLGRIALNAGAHGLTVHPRPDQRHIRFSDLPEI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R+LID++FP AELNIEG+P++ FLNL E   PEQ+TLVPDDP Q TSDHG+DF      L
Sbjct: 61  RKLIDDEFPDAELNIEGFPSDEFLNLVETISPEQVTLVPDDPSQPTSDHGFDFKAELERL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V RL +  +R+S+F+D + N+   +AA  TG D IELYTGPYGA Y+NP      L 
Sbjct: 121 KPIVRRLKDGNTRVSIFSDADPNQM--EAAAATGCDRIELYTGPYGATYDNPDAAESELR 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A  + L +NAGHDLT+ N+P LI  IP+++E+S+GH   A ALE G+ E V 
Sbjct: 179 ALGATADRALSLGLGVNAGHDLTVSNLPPLIERIPFLAEVSIGHGLTADALEFGMAETVH 238

Query: 241 CFRRACGQ 248
            FR AC Q
Sbjct: 239 RFRAACDQ 246


>gi|222149066|ref|YP_002550023.1| pyridoxine 5'-phosphate synthase [Agrobacterium vitis S4]
 gi|254781556|sp|B9JXN7|PDXJ_AGRVS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|221736051|gb|ACM37014.1| pyridoxal phosphate biosynthetic protein PdxJ [Agrobacterium vitis
           S4]
          Length = 250

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 150/248 (60%), Positives = 188/248 (75%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++ H G++ALQ+GA GLTVHPRPDQRH+R++DLP +
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPDVRHFGRLALQAGAQGLTVHPRPDQRHVRFSDLPLL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FPKAE NIEGYP+E FL LCE  +PEQ+TLVPDDP Q TSDHGWDF  +Q  L
Sbjct: 61  RALIDDEFPKAEFNIEGYPSEDFLQLCEEAQPEQVTLVPDDPSQATSDHGWDFAAHQVFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL   G R+SLFADG+GN  ++  AK TGAD IELYTGPYG+CY+ P++    L 
Sbjct: 121 TDVVARLKAAGMRVSLFADGDGNAQAVATAKATGADRIELYTGPYGSCYDAPEKAARELA 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A  + + +N GHDLTI N+P L   IP+++E+S+GHA  A ALE G+ E V 
Sbjct: 181 LLGATADAAHALGMGVNGGHDLTIANLPALAERIPFLAEVSIGHALTADALEFGMAETVR 240

Query: 241 CFRRACGQ 248
            FRRACG+
Sbjct: 241 RFRRACGE 248


>gi|90416531|ref|ZP_01224462.1| pyridoxal phosphate biosynthetic protein [marine gamma
           proteobacterium HTCC2207]
 gi|90331730|gb|EAS46958.1| pyridoxal phosphate biosynthetic protein [marine gamma
           proteobacterium HTCC2207]
          Length = 248

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 102/253 (40%), Positives = 149/253 (58%), Gaps = 12/253 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +S+NLN +A++RN R   +P++V   K+ +  GA+G+TVHPRPDQRHIR  D+  + 
Sbjct: 1   MTDLSINLNKIALIRNSREGNYPDVVEFAKVCIDQGANGITVHPRPDQRHIRPDDVRRLA 60

Query: 62  RLIDEQFPKAELNIEGYP-------NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFL 114
            L+ +     E N+EG P          F+ L     P+Q TLVPD   QLTSDHG+D  
Sbjct: 61  ALV-KPLTNVEFNVEGNPFAPAIGDYPGFIELVAETMPDQCTLVPDGDDQLTSDHGFDLT 119

Query: 115 QNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQ 174
            +   L   + RLH+LG R+SLF D +  +   + AK  GAD IELYTGPY A + + Q 
Sbjct: 120 SSGEQLQPIIERLHSLGMRVSLFMDPDLAQI--ELAKEIGADRIELYTGPYAAAWGSDQL 177

Query: 175 ERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECG 234
           E +F   LA  A+L+ ++ + +NAGHDL + N+     +IP + E+S+GHAF   +L  G
Sbjct: 178 EPLFQQHLA-AAELSTRLGMGVNAGHDLNLHNLAKF-ASIPNLLEVSIGHAFTVDSLSLG 235

Query: 235 VKEAVFCFRRACG 247
           + + V  ++   G
Sbjct: 236 MAQTVQRYKALLG 248


>gi|288817594|ref|YP_003431941.1| pyridoxal phosphate synthetase [Hydrogenobacter thermophilus TK-6]
 gi|288786993|dbj|BAI68740.1| pyridoxal phosphate synthetase [Hydrogenobacter thermophilus TK-6]
 gi|308751193|gb|ADO44676.1| pyridoxal phosphate biosynthetic protein PdxJ [Hydrogenobacter
           thermophilus TK-6]
          Length = 242

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 70/247 (28%), Positives = 123/247 (49%), Gaps = 10/247 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA LR  R    P+ V    IA Q+GA  +T+H R D+RHI+  DL  I+  
Sbjct: 2   RLGVNIDHVATLRQARKTFEPSPVFAALIAQQAGADQITLHLREDRRHIQDRDLELIK-- 59

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +     +N+E  P +    +  R KP +ITLVP+   ++T++ G +  +    L   
Sbjct: 60  ---ELVNLPVNLEMAPTQEMREIALRVKPSRITLVPERRQEITTEGGLNVPEMMDFLRSY 116

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQ--ERIFLNK 181
           +         +SLF + N +   ++A+K  GAD +EL+TG Y   +    +   +  + +
Sbjct: 117 LKPFKEKKIEVSLFIEPNVDH--VRASKDVGADAVELHTGRYANLWKEGNKLLIKEEIER 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPY-ISEISVGHAFAATALECGVKEAVF 240
           +      A+ + L++ AGH LT QN+   +  +   + E++VGH+  + A+  G++ AV 
Sbjct: 175 IKRAGMEAKSLGLKVYAGHGLTYQNVGEFVTELKGVVEELNVGHSIISNAVIFGLERAVK 234

Query: 241 CFRRACG 247
            F     
Sbjct: 235 EFLHLIR 241


>gi|297250773|ref|ZP_06865025.2| pyridoxine 5'-phosphate synthase [Neisseria polysaccharea ATCC
           43768]
 gi|296837988|gb|EFH21926.1| pyridoxine 5'-phosphate synthase [Neisseria polysaccharea ATCC
           43768]
          Length = 255

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 123/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 16  LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 72

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  P+ + +VP+   ++T++ G D L  Q  + +  
Sbjct: 73  --NAIRTRLNLEMALTEEMLENALKVMPQDVCIVPEKRQEITTEGGLDVLAQQDKIAEFT 130

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA+  GA  IEL+TG Y     +  ++     +L  
Sbjct: 131 KILTDAGIRVSLFIDADDRQI--QAARDVGAPVIELHTGAYADA-RSHAEQLKQFERLQN 187

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  + AL  G+ EAV   + 
Sbjct: 188 GAHFASDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLISQALFLGLPEAVRQMKE 246

Query: 245 ACGQHLD 251
              +   
Sbjct: 247 TMFRARM 253


>gi|115525031|ref|YP_781942.1| pyridoxine 5'-phosphate synthase [Rhodopseudomonas palustris
           BisA53]
 gi|115518978|gb|ABJ06962.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodopseudomonas
           palustris BisA53]
          Length = 255

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 67/251 (26%), Positives = 116/251 (46%), Gaps = 10/251 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ +A LRN R    P+ +     A+++GA G+T H R D+RHIR  D+  ++  
Sbjct: 8   RLGVNVDHIATLRNARGGKHPDPLRAALTAIEAGADGITAHLREDRRHIRDADMARLKAE 67

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I +      LN E    +  + +    KP  + LVP+   +LT++ G D +     L   
Sbjct: 68  IAK-----PLNFEMGVTDEMVAIALATKPHAVCLVPERRQELTTEGGLDVVGQHNHLAPA 122

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYN--NPQQERIFLNK 181
           +AR ++ G R+SLF   +  +   + A    A  IE++TG +          +      +
Sbjct: 123 IARFNDAGIRVSLFIAADPAQI--EMAAKLKAPVIEIHTGAWCDAIEAGEQARAEAEWQR 180

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A  A  + L+++AGH L        I A+  I E+++G      AL  G+ E+V  
Sbjct: 181 IKAGAAQANSLGLEVHAGHGLDF-TTAETIAALLQIVELNIGFHMIGEALFIGLAESVLR 239

Query: 242 FRRACGQHLDN 252
            R A  +  + 
Sbjct: 240 MRAAMDRGREA 250


>gi|53804234|ref|YP_114110.1| pyridoxine 5'-phosphate synthase [Methylococcus capsulatus str.
           Bath]
 gi|91207538|sp|Q3V8A2|PDXJ_METCA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|53757995|gb|AAU92286.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylococcus
           capsulatus str. Bath]
          Length = 247

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 86/249 (34%), Positives = 130/249 (52%), Gaps = 9/249 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +R  R+ P+P+++H   +A Q+GA G+T H R D+RHI+  D+  +R
Sbjct: 6   PIRLGVNIDHVATIRQARHTPYPSVLHAAFVAEQAGAGGITAHLREDRRHIQDRDIELLR 65

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I+       LN+E    +  + +  R  P    LVP+   +LT++ G D   +   + 
Sbjct: 66  EHIE-----TRLNLEMAVTDEMVAIACRIHPHACCLVPERREELTTEGGLDVAGHLDRIG 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           +T  RL + G  +SLF D    +   +AA   GA  IEL+TG Y    N+ Q+  I L K
Sbjct: 121 ETCRRLGDAGIEVSLFIDPEPAQI--EAAARAGAPVIELHTGRYADARND-QERSIELEK 177

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   A +A+ + LQ+NAGH LT  N+   I  IP I E+++GHA  A A   G+KEAV  
Sbjct: 178 LRHAASVAEALGLQVNAGHGLTYANVGA-ICRIPQIVELNIGHAIVARAFFSGLKEAVAD 236

Query: 242 FRRACGQHL 250
                    
Sbjct: 237 MVTLLHTAR 245


>gi|218462778|ref|ZP_03502869.1| pyridoxine 5'-phosphate synthase [Rhizobium etli Kim 5]
          Length = 250

 Score =  242 bits (619), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 149/250 (59%), Positives = 185/250 (74%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVA+LRNRR+LPWP++  +G+IAL +GASGLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPAKLSVNLNAVAMLRNRRDLPWPSVEALGRIALAAGASGLTVHPRPDQRHIRFSDLPVI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP AE NIEGYP E FL LC    PEQ+TLVPDDP Q TSDHGWDF ++Q  L
Sbjct: 61  RNLIDDEFPGAEFNIEGYPTEEFLELCAGAAPEQVTLVPDDPAQATSDHGWDFRKHQVFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL  +GSR+SLFADG+G+  +++ AK  GAD IELYTGPYG CY+ P++    L 
Sbjct: 121 TDVVARLKKMGSRVSLFADGDGDAQAVEIAKAVGADRIELYTGPYGGCYDAPERAAPILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A  + L +NAGHDLT+ N+  L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ALGKTADAALAIGLAVNAGHDLTVANLSALVKRIPDLAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQHL 250
            F RACGQ +
Sbjct: 241 RFCRACGQAV 250


>gi|39996903|ref|NP_952854.1| pyridoxine 5'-phosphate synthase [Geobacter sulfurreducens PCA]
 gi|91207236|sp|Q3V8C9|PDXJ_GEOSL RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|39983791|gb|AAR35181.1| pyridoxal phosphate biosynthetic protein PdxJ [Geobacter
           sulfurreducens PCA]
 gi|298505916|gb|ADI84639.1| pyridoxine 5'-phosphate synthase [Geobacter sulfurreducens KN400]
          Length = 239

 Score =  242 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 76/246 (30%), Positives = 124/246 (50%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +R  R    P+ V    IA  +GA G+TVH R D+RHI+  DL  +R
Sbjct: 1   MAKLGVNIDHVATIRQARGGVEPDPVAAAAIAEFAGADGITVHLREDRRHIQDRDLRLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  K +LN+E    +  + +    KP+  TLVP+   +LT++ G D       L 
Sbjct: 61  -----QTVKTKLNLEMAATDEMVGIALSVKPDMCTLVPERRQELTTEGGLDVRVGMQALA 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             + RL + G  +SLF D + ++  ++A+   GAD IE++TG +       ++E+  L +
Sbjct: 116 DAIGRLQDGGIVVSLFIDPDADQ--VKASSKVGADYIEIHTGTFAEA-REWKKEQAELER 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +    +L  K+ L INAGH L   N+   + A+  I E ++GH+  + A+  G+  AV  
Sbjct: 173 IENAIKLGTKLGLGINAGHGLNYTNVRK-VAALGGIEEFNIGHSIISRAVFTGLDRAVRD 231

Query: 242 FRRACG 247
                 
Sbjct: 232 MVDLVK 237


>gi|15676359|ref|NP_273495.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis MC58]
 gi|12644544|sp|Q9K0V9|PDXJ_NEIMB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|7225673|gb|AAF40885.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis MC58]
 gi|316985791|gb|EFV64734.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis H44/76]
 gi|325140962|gb|EGC63469.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis CU385]
 gi|325199635|gb|ADY95090.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis H44/76]
          Length = 242

 Score =  242 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 75/246 (30%), Positives = 123/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  +    
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAGFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA+  GA  +EL+TG Y     +  ++     ++  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAARDVGAPVVELHTGAYADA-RSHAEQIRQFERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|304386732|ref|ZP_07369002.1| pyridoxine 5'-phosphate synthase [Neisseria meningitidis ATCC
           13091]
 gi|304339190|gb|EFM05274.1| pyridoxine 5'-phosphate synthase [Neisseria meningitidis ATCC
           13091]
          Length = 255

 Score =  242 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 78/246 (31%), Positives = 125/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 16  LGVNIDHIATVRNARGTIYPSPVEAALIAETHGADLITMHLREDRRHIKDADVFAVK--- 72

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  +T+  
Sbjct: 73  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQDKITEFT 130

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  IEL+TG Y    ++  ++     ++  
Sbjct: 131 KILTDAGIRVSLFIDADNEQI--QAAHDVGAPVIELHTGAYADA-HSHAEQLKQFERIQN 187

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 188 GAHYASDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 246

Query: 245 ACGQHL 250
           A  +  
Sbjct: 247 AMFRAR 252


>gi|255264601|ref|ZP_05343943.1| pyridoxal phosphate biosynthetic protein PdxJ [Thalassiobium sp.
           R2A62]
 gi|255106936|gb|EET49610.1| pyridoxal phosphate biosynthetic protein PdxJ [Thalassiobium sp.
           R2A62]
          Length = 247

 Score =  242 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 69/249 (27%), Positives = 124/249 (49%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R    P+ V  G +A ++GA G+T H R D+RH+  TD+  +   
Sbjct: 6   RLGVNIDHVATVRNARGGAVPDPVRAGLLAQEAGADGITAHLREDRRHMVDTDIDALMDA 65

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +        LN E    +    +  R+KP  + +VP+   + T++ G +  +++  L   
Sbjct: 66  LS-----IPLNFEMAATDEMQAIALRHKPHAVCVVPEKREERTTEGGLEVARDENKLADF 120

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYN--NPQQERIFLNK 181
           +A L   GSR+S+F   +  +     A   GAD IEL+TG Y   +   +       L +
Sbjct: 121 IAPLREAGSRVSIFIAADQRQIES--AARIGADIIELHTGAYCHAHIDGDIALRDAELAR 178

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A +A ++ L+++AGH LT   +   + AIP + E+++GH     ++  G+ +A+  
Sbjct: 179 MVEMAAVADELGLEVHAGHGLTYDCVLP-VAAIPQLKELNIGHFLIGESIFRGLPDAMAE 237

Query: 242 FRRACGQHL 250
            RR   +  
Sbjct: 238 MRRLMDEAR 246


>gi|269213841|ref|ZP_05982975.2| pyridoxine 5'-phosphate synthase [Neisseria cinerea ATCC 14685]
 gi|269145174|gb|EEZ71592.1| pyridoxine 5'-phosphate synthase [Neisseria cinerea ATCC 14685]
          Length = 255

 Score =  242 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 124/247 (50%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 16  LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVK--- 72

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  P+ + +VP+   ++T++ G D L  Q  + +  
Sbjct: 73  --NAIRTRLNLEMALTEEMLENALKVMPQDVCIVPEKRQEITTEGGLDVLAQQEKIAEFT 130

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA+  GA  IEL+TG Y    ++  ++     +L  
Sbjct: 131 KILTDAGIRVSLFIDADNEQI--QAARDVGAPVIELHTGAYADA-HSHAEQLKQFERLQN 187

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  + AL  G+ EAV   + 
Sbjct: 188 GAHFASDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLISQALFLGLPEAVRQMKE 246

Query: 245 ACGQHLD 251
              +   
Sbjct: 247 TMFRARM 253


>gi|121595566|ref|YP_987462.1| pyridoxine 5'-phosphate synthase [Acidovorax sp. JS42]
 gi|120607646|gb|ABM43386.1| pyridoxine 5'-phosphate synthase [Acidovorax sp. JS42]
          Length = 259

 Score =  242 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 102/248 (41%), Positives = 149/248 (60%), Gaps = 4/248 (1%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA++RN R+L  P+++   ++ L++GA G+TVHPRPD+RHIR  D+ ++  
Sbjct: 8   TALSVNVNKVALVRNTRHLGIPSVLRAAQLCLEAGAQGITVHPRPDERHIRAHDVYQLAE 67

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+ +Q+P+AE NIEG P    +    + +P Q T VPD   Q TSDHGW F Q+   L  
Sbjct: 68  LL-KQWPQAEYNIEGNPTHNLMEFIRQVRPHQATFVPDSQDQFTSDHGWSFPQDAERLAP 126

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A    LG R+SLF D    + +  AA   GAD +ELYT PY A +  PQQ      + 
Sbjct: 127 LIAECRQLGVRVSLFMDPVPEQMA--AAHAVGADRVELYTEPYAAAWGTPQQAVQLE-RY 183

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              AQ A  + L +NAGHDL+  N+ + +  +P + E+S+GHA  A ALE G  + V  +
Sbjct: 184 RAAAQAALDVGLGVNAGHDLSRDNLADFLAHVPGVLEVSIGHALIADALELGYGDTVRAY 243

Query: 243 RRACGQHL 250
           +R   Q +
Sbjct: 244 QRCIAQGM 251


>gi|225075847|ref|ZP_03719046.1| hypothetical protein NEIFLAOT_00863 [Neisseria flavescens
           NRL30031/H210]
 gi|224952793|gb|EEG34002.1| hypothetical protein NEIFLAOT_00863 [Neisseria flavescens
           NRL30031/H210]
          Length = 242

 Score =  242 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 78/246 (31%), Positives = 123/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTIYPSPVEAALIAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L       PE + LVP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALNVMPEDVCLVPEKRQEVTTEGGLDVLAQQDKVAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  IEL+TG Y    ++  ++     ++  
Sbjct: 118 KILTDAGIRVSLFIDADNAQI--QAAYDVGAPVIELHTGAYADA-HSHAEQMKQFERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHYASDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|114320506|ref|YP_742189.1| pyridoxine 5'-phosphate synthase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226900|gb|ABI56699.1| pyridoxine 5'-phosphate synthase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 261

 Score =  242 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 121/247 (48%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A Q+GA  +TVH R D+RHI+  D+  +    
Sbjct: 23  LGVNIDHVATLRQARGTAYPDPVQAAFAAEQAGADLITVHLREDRRHIQDRDVALL---- 78

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  L +    +P    LVP+   +LT++ G D       + +  
Sbjct: 79  -AQTVQTRMNLEMAVTDEMLRIATELRPSDCCLVPERREELTTEGGLDVQAQPDRIAEAC 137

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL   G R+SLF D   +   ++AA   GA  +EL+TG +     NP+  R+ L +L  
Sbjct: 138 ARLGEAGIRVSLFIDP--DPEQVEAAARVGAPVVELHTGAWAEA-GNPRDARVELERLRT 194

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
                 +  LQ+N GH L   N+   + AI  + E+++GHA  A A+  G+ +AV   +R
Sbjct: 195 AVGHGLQCGLQVNGGHGLHYHNVQP-VAAITGVRELNIGHAIIARAVFSGLPDAVREMKR 253

Query: 245 ACGQHLD 251
              +   
Sbjct: 254 LMREARQ 260


>gi|12644683|sp|P72776|PDXJ_SYNY3 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
          Length = 242

 Score =  242 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 75/246 (30%), Positives = 127/246 (51%), Gaps = 10/246 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLP-WPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
             ++ VN++ VA +R  R     P+ +    +A  +GA G+T H R D+RHI+  D+  +
Sbjct: 1   MLTLGVNIDHVATIRQARQTVMEPDPIAAAVLAELAGADGITAHLREDRRHIQERDVEIL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R     +  +  LN+E    +  + +    KP+ +TLVP+   ++T++ G D   N   L
Sbjct: 61  R-----KTVRTHLNLEMAATKEMVEIALNLKPDYVTLVPERREEVTTEGGLDVAGNLNYL 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V +L +    +SLF D +  +  L+A+  TGA  IEL+TG Y        Q    L 
Sbjct: 116 LGVVEQLQSRHIPVSLFIDPDVAQ--LKASAQTGAKFIELHTGKYANAPTADDQA-RELG 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            LAI   +A ++ L+INAGH LT  N+   +  +P + E+++GH+  + A+  G++ AV 
Sbjct: 173 SLAIACDIALELGLRINAGHGLTYWNVRP-VAELPGMEELNIGHSIMSRAILVGMERAVR 231

Query: 241 CFRRAC 246
             + A 
Sbjct: 232 EMKLAM 237


>gi|254456512|ref|ZP_05069941.1| pyridoxal phosphate biosynthesis protein PdxJ [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207083514|gb|EDZ60940.1| pyridoxal phosphate biosynthesis protein PdxJ [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 239

 Score =  242 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 55/246 (22%), Positives = 118/246 (47%), Gaps = 8/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ +A +RN R    P+        ++ GA  +T+H R D+RHI   D  +I 
Sbjct: 1   MKRLGVNIDHIATVRNARGEKHPDPFFAASQVVKMGADSVTIHLREDRRHINDADAKKIC 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +     +N+E   ++  +    R KP  I +VP++  ++T++ G +  +N+  L 
Sbjct: 61  -----KLKNIFVNLEISMDDKIVKNALRIKPNYICIVPENRKEITTEGGLNLTKNKKKLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             + +   +  R SLF +       ++ +K    DC+E++TG         ++     ++
Sbjct: 116 TIIEKFKKVKIRTSLFINP--TIKDIKLSKELNVDCVEIHTGRISNLVKLKKKYNTEFSR 173

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +  ++ LA K++++++AGH L  +    ++N I  I E ++GH     ++  G+ + +  
Sbjct: 174 IKKSSILANKLNIEVHAGHGLDYKT-TKILNKINEIQEFNIGHFIIGESIFYGLSKVIKK 232

Query: 242 FRRACG 247
           F++   
Sbjct: 233 FKKILK 238


>gi|319763842|ref|YP_004127779.1| pyridoxal phosphate biosynthetic protein pdxj [Alicycliphilus
           denitrificans BC]
 gi|330823894|ref|YP_004387197.1| pyridoxal phosphate biosynthetic protein PdxJ [Alicycliphilus
           denitrificans K601]
 gi|317118403|gb|ADV00892.1| pyridoxal phosphate biosynthetic protein PdxJ [Alicycliphilus
           denitrificans BC]
 gi|329309266|gb|AEB83681.1| pyridoxal phosphate biosynthetic protein PdxJ [Alicycliphilus
           denitrificans K601]
          Length = 255

 Score =  242 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 103/248 (41%), Positives = 147/248 (59%), Gaps = 4/248 (1%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA++RN R+L  P++    ++ LQ+GA G+TVHPRPD+RHIR  D+ E+  
Sbjct: 7   TALSVNVNKVALVRNTRHLGIPSVTRAAQLCLQAGAQGITVHPRPDERHIRAQDVHELAA 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+ +Q+P+AE NIEG P    +    +  P Q T VPD   Q TSDHGW F ++   L  
Sbjct: 67  LL-KQWPQAEFNIEGNPTHNLMEFICQVLPAQATFVPDSVGQFTSDHGWRFPEDAERLAP 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VA    LG R+SLF D    + +  AA+  GAD +ELYT PY A +    ++   L + 
Sbjct: 126 LVAECKALGVRVSLFMDPVPEQMA--AARAVGADRVELYTEPYAAAWGT-PRQSAELARY 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              AQ A    L +NAGHDL   N+ + + A+P + E+S+GHA  A ALE G  + V  +
Sbjct: 183 RDAAQAALDAGLGVNAGHDLNRDNLADFLAAVPGVLEVSIGHALIADALELGYGDTVRAY 242

Query: 243 RRACGQHL 250
           +R   Q +
Sbjct: 243 QRCIDQGM 250


>gi|222111787|ref|YP_002554051.1| pyridoxine 5'-phosphate synthase [Acidovorax ebreus TPSY]
 gi|221731231|gb|ACM34051.1| Pyridoxal phosphate biosynthetic protein PdxJ [Acidovorax ebreus
           TPSY]
          Length = 259

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 102/248 (41%), Positives = 150/248 (60%), Gaps = 4/248 (1%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA++RN R+L  P+++   ++ L++GA G+TVHPRPD+RHIR  D+ ++  
Sbjct: 8   TALSVNVNKVALVRNTRHLGIPSVLRAAQLCLEAGAQGITVHPRPDERHIRAHDVYQLAE 67

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+ +Q+P+AE NIEG P    +    + +P Q T VPD   Q TSDHGW F Q+   L  
Sbjct: 68  LL-KQWPQAEYNIEGNPTHNLMEFIRQVRPHQATFVPDSQDQFTSDHGWSFPQDAERLAP 126

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A    LG R+SLF D    + +  AA+  GAD +ELYT PY A +  PQQ      + 
Sbjct: 127 LIAECRQLGVRVSLFMDPLPEQMA--AARAVGADRVELYTEPYAAAWGTPQQAAQLE-RY 183

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              AQ A  + L +NAGHDL+  N+ + +  +P + E+S+GHA  A ALE G  + V  +
Sbjct: 184 RAAAQAALDVGLGVNAGHDLSRDNLADFLAHVPGVLEVSIGHALIADALELGYGDTVRAY 243

Query: 243 RRACGQHL 250
           +R   Q +
Sbjct: 244 QRCIAQGM 251


>gi|225012222|ref|ZP_03702659.1| pyridoxal phosphate biosynthetic protein PdxJ [Flavobacteria
           bacterium MS024-2A]
 gi|225003777|gb|EEG41750.1| pyridoxal phosphate biosynthetic protein PdxJ [Flavobacteria
           bacterium MS024-2A]
          Length = 238

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 123/245 (50%), Gaps = 9/245 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
             S+SVN+N VA LRN R    PNL+ + K   + GA G+T+HPRPDQRHIR+ D   + 
Sbjct: 1   MVSLSVNINKVATLRNARGGNVPNLLEVTKDLQRYGAQGITIHPRPDQRHIRFEDAFAL- 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                     E NIEG P   F+ +    +P Q+TLVPD    LTS+ GWD L N+  LT
Sbjct: 60  ----PNVVTTEFNIEGNPIPEFIEMVLEIRPTQVTLVPDGNDVLTSNAGWDTLTNKDFLT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             + R    G R S+F +       ++ A   G D IELYT  +       Q     +  
Sbjct: 116 PIIKRFKEAGIRTSVFVNPI--VEMVEGAFEIGTDRIELYTEAF--ASRYDQDPNKAITP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+ A  + L INAGHDL++ NI      IP + E+S+GHA    +L  G +  +  
Sbjct: 172 YIDAAKKANLLGLGINAGHDLSLDNIAFFAKNIPGLLEVSIGHALICESLYLGFENVIPM 231

Query: 242 FRRAC 246
           + +  
Sbjct: 232 YLQRL 236


>gi|291333806|gb|ADD93490.1| pyridoxal phosphate biosynthetic protein PdxJ [uncultured marine
           bacterium MedDCM-OCT-S04-C123]
          Length = 245

 Score =  242 bits (618), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 69/250 (27%), Positives = 119/250 (47%), Gaps = 12/250 (4%)

Query: 2   STSVSVNLNAVAVLRNRRN----LPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDL 57
              + VN++  A LR  R        P+ +    I + +G  G+T H R D+RHI+  D+
Sbjct: 1   MLKLGVNIDHTATLREARYRGQEGGEPDPIEAASICIDAGCHGITAHLREDRRHIQDNDI 60

Query: 58  PEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQ 117
             +            LN E       +      KP  + +VP+   ++T++ G D     
Sbjct: 61  DRL-----VSVLTVPLNFEIANTPEMIAKALEIKPTAVCMVPEKREEVTTEGGLDVASQL 115

Query: 118 ALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI 177
             ++K+V  L   G  +SLF D   +E  ++A+  TGA  IEL+TG Y   ++   + + 
Sbjct: 116 EAISKSVTELQGNGIEVSLFIDP--DEEIIRASHSTGAKAIELHTGAYAEAFSQTSERKK 173

Query: 178 FLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKE 237
            L +L+I + LA  + +++NAGH L   N+  L+  +P++ E+++GH+  A AL  G + 
Sbjct: 174 ELERLSIASNLAHSLGMKVNAGHGLNYTNLTGLL-EVPWLEELNIGHSIVARALTVGFER 232

Query: 238 AVFCFRRACG 247
           AV        
Sbjct: 233 AVREMLELMA 242


>gi|241760542|ref|ZP_04758635.1| pyridoxine 5'-phosphate synthase [Neisseria flavescens SK114]
 gi|241319046|gb|EER55548.1| pyridoxine 5'-phosphate synthase [Neisseria flavescens SK114]
          Length = 242

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 77/247 (31%), Positives = 123/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA   GA  +T+H R D+RHI+ TD+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTIYPSPVEAALIAETHGADLITMHLREDRRHIKDTDVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L       PE + LVP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALNVMPEDVCLVPEKRQEVTTEGGLDVLAQQDKVAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  IEL+TG Y    ++  ++     ++  
Sbjct: 118 KILTDAGIRVSLFIDADNAQI--QAAHDVGAPVIELHTGAYADA-HSHAEQMKQFERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  + AL  G+ EAV   + 
Sbjct: 175 GAHYASDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLISQALFLGLPEAVRQMKE 233

Query: 245 ACGQHLD 251
              +   
Sbjct: 234 VMFRARM 240


>gi|223939480|ref|ZP_03631357.1| pyridoxal phosphate biosynthetic protein PdxJ [bacterium Ellin514]
 gi|223891865|gb|EEF58349.1| pyridoxal phosphate biosynthetic protein PdxJ [bacterium Ellin514]
          Length = 246

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 74/254 (29%), Positives = 131/254 (51%), Gaps = 12/254 (4%)

Query: 2   STSVSVNLNAVAVLRNRR----NLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDL 57
              + VN++ VA LR  R        P+ +    I+  +GA G+T H R D+RHI+  D+
Sbjct: 1   MLKLGVNIDHVATLREARYRGTGQGEPDPISAALISESAGAHGITAHLREDRRHIQDRDV 60

Query: 58  PEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQ 117
             +R     +  K  LN+E       + +  + KPE + LVP+   ++T++ G D + N 
Sbjct: 61  WNLR-----KAIKTRLNLEMANAPEIVEIALKLKPEIVCLVPEKRQEVTTEGGLDVVGNL 115

Query: 118 ALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI 177
             LT+T  R+ + G  +SLF      +  +QAA   GA  IEL+TG +   +N   +  +
Sbjct: 116 QSLTETRKRMTDAGIEVSLFIAAEPAQ--VQAASRVGAQFIELHTGAFAEHFNQKVERNL 173

Query: 178 FLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKE 237
            L +L   A+ A  + +Q+NAGH L  +N+  L++ +P++ E+++GH+  + A+  G++ 
Sbjct: 174 ELARLITAAKQAHALGIQVNAGHGLNYENL-PLLHTVPHLVELNIGHSVISRAITVGLET 232

Query: 238 AVFCFRRACGQHLD 251
           AV    +    +  
Sbjct: 233 AVKQMLKLMEGYRP 246


>gi|117925157|ref|YP_865774.1| pyridoxine 5'-phosphate synthase [Magnetococcus sp. MC-1]
 gi|166219096|sp|A0L8S5|PDXJ_MAGSM RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|117608913|gb|ABK44368.1| pyridoxine 5'-phosphate synthase [Magnetococcus sp. MC-1]
          Length = 243

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 83/252 (32%), Positives = 133/252 (52%), Gaps = 9/252 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ +A LR  R   +P+ V     A ++GA  +TVH R D+RHI+  D+  + 
Sbjct: 1   MILLGVNIDHIATLRQARGERYPDPVDAAFAAERAGADSITVHLREDRRHIQDRDVVLL- 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
               +Q  + ++N+E   +E  L L ER+KP+   LVP+  H+LT++ G D + N+  L 
Sbjct: 60  ----QQTCQTKINLEMAASEPMLTLAERWKPQDCCLVPEKRHELTTEGGLDVVGNRHRLA 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             VARLH+ G R+SLF D +  +    AA   GA  +E++TG Y        Q  + L +
Sbjct: 116 DAVARLHDAGIRVSLFVDPDLEQI--SAAGAIGATVVEMHTGRYANA-ATQAQRNLELEQ 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   A  A    L ++AGH LT  N+   I  +P + E+++GHA  A A+  G++ AV  
Sbjct: 173 LYRAAHQASLNGLTVHAGHGLTYHNVQP-IARLPDLKELNIGHAIIARAVMVGMESAVKE 231

Query: 242 FRRACGQHLDNT 253
            +R   + +   
Sbjct: 232 MKRLMREAVKTP 243


>gi|296532094|ref|ZP_06894866.1| pyridoxine 5'-phosphate synthase [Roseomonas cervicalis ATCC 49957]
 gi|296267578|gb|EFH13431.1| pyridoxine 5'-phosphate synthase [Roseomonas cervicalis ATCC 49957]
          Length = 254

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 85/255 (33%), Positives = 127/255 (49%), Gaps = 10/255 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            +SVN++ VA LRN R   +P+ V   +  LQ+GA G+TVH R D+RHIR  D+  +   
Sbjct: 2   RLSVNVDHVATLRNARGGRFPDPVEAARACLQAGADGITVHLREDRRHIRDADVARL--- 58

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
                P   LN E    E  + +    +P    +VP+   +LT++ G D L+    L   
Sbjct: 59  --GAEPGLRLNFEMAATEEMVGIALGLRPAACCIVPEKRQELTTEGGLDLLRAGPELAGA 116

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           +ARL   G  +++F + +  +   QAA   GA  +EL+TG Y     +P      L +LA
Sbjct: 117 IARLAGAGIEVAIFVEPDTAQI--QAAARLGAQAVELHTGTYADA--DPAARPPLLARLA 172

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A+ A    L  +AGH L   ++   I AIP I+E+S+GHA    A+  G+  AV   R
Sbjct: 173 RGAEAAAAAGLACHAGHGLDHVSVRG-IAAIPQIAEVSIGHALIGAAVFEGLPAAVRRMR 231

Query: 244 RACGQHLDNTMRLTH 258
            A  +   NT+ L  
Sbjct: 232 AAMVEARRNTIALPQ 246


>gi|83855030|ref|ZP_00948560.1| pyridoxal phosphate biosynthetic protein [Sulfitobacter sp.
           NAS-14.1]
 gi|83842873|gb|EAP82040.1| pyridoxal phosphate biosynthetic protein [Sulfitobacter sp.
           NAS-14.1]
          Length = 250

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 70/252 (27%), Positives = 123/252 (48%), Gaps = 10/252 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R   +P+ +   + A ++GA G+T H R D+RHI   D+  + 
Sbjct: 6   KLRLGVNIDHVATVRNARGGAYPDPLRAARAAQEAGADGITAHLREDRRHITDADIEGL- 64

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
               ++     LN E    E    +  R+KP  + +VP+   + T++ G +  + +  L 
Sbjct: 65  ----QEVLNVPLNFEMAATEEMQAIALRHKPHAVCIVPEKREERTTEGGLEVAREENRLA 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFL 179
             +A L   GSR+S+F   +  +   +AA   GA+ IEL+TG Y   Y     ++ +  L
Sbjct: 121 HFIAPLREAGSRVSIFIAADQRQI--EAANRIGAEVIELHTGAYCDAYAEGHWEEAQKEL 178

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            KL   ++ A  + L+++AGH LT   +   + A P + E+++GH     A+  G+  A+
Sbjct: 179 QKLEEMSKFAHDLGLEVHAGHGLTYDTVSP-VAAFPEVQELNIGHFLIGEAIFLGLGPAI 237

Query: 240 FCFRRACGQHLD 251
              RR       
Sbjct: 238 AEMRRLMDDARK 249


>gi|34222704|sp|Q8KPR0|PDXJ_SYNE7 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|91207571|sp|Q3V812|PDXJ_SYNP6 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
          Length = 240

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 68/247 (27%), Positives = 120/247 (48%), Gaps = 10/247 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M T + VN++ VA +R  R    P+ +    +A  +GA G+T H R D+RHI+  D+  +
Sbjct: 1   MPT-LGVNIDHVATVRQARRTVEPDPIAAAVLAELAGAEGITAHLREDRRHIQDRDVRLL 59

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R     Q  +  LN+E    +  + +    +P+ +TLVP+   ++T++ G + +  +  L
Sbjct: 60  R-----QTVRTRLNLEMAATDEMVAIALDIRPDYVTLVPERREEVTTEGGLNVVGQRDRL 114

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V +L + G  +SLF D   ++ +  A     A  IEL+TG Y        Q +    
Sbjct: 115 ALVVDQLQSAGIPVSLFIDAEPDQIAASA--AIQAQWIELHTGRYAEAETEAAQAQELAA 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
                 + A    L++NAGH LT  N+   +  +P + E+++GH   + A+  G++ AV 
Sbjct: 173 L-RQGCEQAIAAGLRVNAGHGLTYWNV-YPVAQLPGMEELNIGHTIISRAVLVGLERAVR 230

Query: 241 CFRRACG 247
             + A  
Sbjct: 231 EMKLAMQ 237


>gi|94676621|ref|YP_588729.1| pyridoxal phosphate biosynthetic protein PdxJ [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
 gi|94219771|gb|ABF13930.1| pyridoxal phosphate biosynthetic protein PdxJ [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
          Length = 243

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 72/246 (29%), Positives = 124/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           ++VN++ +A LRN R   WP+ V    IA  +GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LNVNIDHIATLRNARGTTWPDPVQAAFIAEDAGADGITVHLREDRRHINDRDVTMLR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  K  +N+E    +  + +    +P+   LVP+   +LT++ G D  Q +  ++  +
Sbjct: 63  --QTIKTRMNLEMAITDDMIAIACSVRPDLCCLVPEKRQELTTEGGLDVAQQKKKISNAI 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L   G  +SLF D +  +   +AA   G+  IE++TG Y     N  +    L ++  
Sbjct: 121 YLLSEAGIMVSLFIDADKQQI--EAAAEIGSPYIEIHTGCYANA-RNNTECIAELERIRQ 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+ + I  + +I E+++GH+  + A+  G+ +A+     
Sbjct: 178 AADYATSLGLKVNAGHGLTYHNVQD-IAMLSFIHELNIGHSIISRAIISGLNQAIINMIN 236

Query: 245 ACGQHL 250
                 
Sbjct: 237 LLHNAR 242


>gi|103486893|ref|YP_616454.1| pyridoxine 5'-phosphate synthase [Sphingopyxis alaskensis RB2256]
 gi|98976970|gb|ABF53121.1| pyridoxal phosphate biosynthetic protein PdxJ [Sphingopyxis
           alaskensis RB2256]
          Length = 248

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 121/247 (48%), Gaps = 10/247 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R    P+ V    I    G  G+T H R D+RHIR  DL  I   
Sbjct: 11  RLGVNIDHVATIRNARGGEHPDPVRAAAIVAAVGGDGITAHLREDRRHIRDDDLARI--- 67

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
             +      LN+E    +  + +  R+KP    +VP+   + T++ G D       L   
Sbjct: 68  --QAATDLPLNLEMAATDEMVEIALRHKPHAACIVPEKREERTTEGGLDAAGQHNHLAPI 125

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           VARL + G R+SLF + +  +   +AA    A  +E +TG Y   +++ +     L ++A
Sbjct: 126 VARLSDAGIRVSLFIEPDARQI--EAAMRLRAPVVEFHTGRY--AHSDGEARAAELRRIA 181

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A LA K  ++ +AGH LT  N+   + AIP ++E+++GH     A+  G+++AV   R
Sbjct: 182 DAAALASKNGIEPHAGHGLTYDNVVP-VAAIPQLAELNIGHYLIGEAIFTGLEDAVRRMR 240

Query: 244 RACGQHL 250
               +  
Sbjct: 241 ALMDEAR 247


>gi|299530662|ref|ZP_07044077.1| pyridoxine 5'-phosphate synthase [Comamonas testosteroni S44]
 gi|298721178|gb|EFI62120.1| pyridoxine 5'-phosphate synthase [Comamonas testosteroni S44]
          Length = 257

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 101/248 (40%), Positives = 143/248 (57%), Gaps = 4/248 (1%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA+LRN R+L  P++    +I L++GA G+T+HPRPD+RHIR  D+ E+  
Sbjct: 9   TALSVNVNKVALLRNTRHLGIPSVTRAAQICLEAGAQGITIHPRPDERHIRAQDVFEL-H 67

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            + + +P AE NIEG P +  ++   + +P Q T VPD   Q TSDHGW F Q+   L  
Sbjct: 68  ELLKNWPGAEFNIEGNPTQNLMDFIRQTRPHQATFVPDSEDQFTSDHGWSFPQDAERLKP 127

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A    LG R+SLF D    + +  AAK  GAD +ELYT P+ A      ++   L   
Sbjct: 128 LIAECKALGVRVSLFMDPIPEQMA--AAKAVGADRVELYTEPF-AANWGKAEQEQQLQTY 184

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  AQ A    L INAGHDL   N+   +  +P ++E+S+GHA  A ALE G  E V  +
Sbjct: 185 ARAAQAALDAGLGINAGHDLNRDNLAAFVARVPGLAEVSIGHALIADALELGYAETVKAY 244

Query: 243 RRACGQHL 250
           +      +
Sbjct: 245 QACIDAGM 252


>gi|189425583|ref|YP_001952760.1| pyridoxine 5'-phosphate synthase [Geobacter lovleyi SZ]
 gi|238692127|sp|B3E693|PDXJ_GEOLS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|189421842|gb|ACD96240.1| pyridoxal phosphate biosynthetic protein PdxJ [Geobacter lovleyi
           SZ]
          Length = 239

 Score =  242 bits (617), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 72/247 (29%), Positives = 124/247 (50%), Gaps = 9/247 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + +N++ +A +R  R    P+ V    I   +GA G+T+H R D+RHI+  DL  +R
Sbjct: 1   MAKLGLNVDHIATVRQARGGSEPDPVTAAAIGELAGAEGITIHLREDRRHIQDRDLEILR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  + +LN+E    +  + +  R +PEQ TLVP+   +LT++ G D L N A +T
Sbjct: 61  -----RTVQTKLNLEMAATDEMVGIACRIRPEQCTLVPEKRQELTTEGGLDVLGNLAGIT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           +  + L   G  +SLF D    +   +A+K +GAD IE++TG Y    +   +    L  
Sbjct: 116 RATSSLREAGIVVSLFVDPTVEQI--RASKESGADAIEIHTGRYAEARSEKSR-HHELAA 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +    +L  ++ L ++AGH L   NI   +  +  I E ++GH+  + A+  G+  AV  
Sbjct: 173 IREAIRLGNELGLTVHAGHGLNYVNILP-LTGLAGIEEFNIGHSIISRAMLVGLDRAVRE 231

Query: 242 FRRACGQ 248
                 +
Sbjct: 232 MVTLIRR 238


>gi|119774020|ref|YP_926760.1| pyridoxine 5'-phosphate synthase [Shewanella amazonensis SB2B]
 gi|119766520|gb|ABL99090.1| pyridoxal phosphate biosynthetic protein PdxJ [Shewanella
           amazonensis SB2B]
          Length = 245

 Score =  242 bits (617), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 76/249 (30%), Positives = 124/249 (49%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LR  R   +P+ VH   +A  +GA G+T+H R D+RHI   D+  +  
Sbjct: 4   ILLGVNIDHIATLRQARGTNYPDPVHAAAVAEHAGADGITIHLREDRRHIIDRDVYLL-- 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  K  +N E    E  LN+    KP  + LVP+   +LT++ G D    +  +  
Sbjct: 62  ---AKTLKTRMNFECAVTEEMLNIACEVKPTYVCLVPEKREELTTEGGLDVAGQKDKIRA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL   G  +SLF D +  +    AA   GA  IE++TG Y   +    +  I L ++
Sbjct: 119 AVERLTAQGILVSLFIDADKTQI--DAAHEVGAPYIEIHTGRYADAHTE-AEAEIELERI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A+ A  + + +NAGH L   N+   I AIP + E+++GHA  A +   G+++AV   
Sbjct: 176 ASMAKYAHGLGITVNAGHGLHYHNVKP-IAAIPELYELNIGHAIVARSAIDGLEKAVRDM 234

Query: 243 RRACGQHLD 251
           ++   +   
Sbjct: 235 KQLMLEGRR 243


>gi|110596843|ref|ZP_01385133.1| pyridoxal phosphate biosynthetic protein PdxJ [Chlorobium
           ferrooxidans DSM 13031]
 gi|110341530|gb|EAT59990.1| pyridoxal phosphate biosynthetic protein PdxJ [Chlorobium
           ferrooxidans DSM 13031]
          Length = 236

 Score =  242 bits (617), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 74/243 (30%), Positives = 123/243 (50%), Gaps = 9/243 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            ++VN++ +A LRN RN   P+ V    +A + GA+G+  H R D+RHIR  DL  +R  
Sbjct: 2   RLAVNIDHIATLRNARNEFEPDPVEAALLAEKCGAAGIVCHLREDRRHIRDLDLQRLR-- 59

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +    +L++E         +  + +PE ITLVP+   +LT++ G+D  ++   L + 
Sbjct: 60  ---EAVTTKLDLEMAMTPEMQQIALKTRPELITLVPEKREELTTEGGFDITRHFDTLVEF 116

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           +  +   G   S+F + + +  +L  A   GA+ +EL+TG Y A   +  +      ++ 
Sbjct: 117 LKPIREAGIESSIFIEPSQSAITL--AAQAGAEMVELHTGTY-ALKTDFAERDKEFERIR 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A  A+ + L++ AGH L   NI      IP I E+S+GHA  A A+  G+  AV    
Sbjct: 174 EAASFAKSLGLKVVAGHGLNYLNIAPF-KTIPEIEEVSIGHAIIARAVLTGLDSAVREMI 232

Query: 244 RAC 246
           R  
Sbjct: 233 RII 235


>gi|83941553|ref|ZP_00954015.1| pyridoxal phosphate biosynthetic protein [Sulfitobacter sp. EE-36]
 gi|83847373|gb|EAP85248.1| pyridoxal phosphate biosynthetic protein [Sulfitobacter sp. EE-36]
          Length = 250

 Score =  242 bits (617), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 70/252 (27%), Positives = 123/252 (48%), Gaps = 10/252 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R   +P+ +   + A ++GA G+T H R D+RHI   D+  + 
Sbjct: 6   KLRLGVNIDHVATVRNARGGAYPDPLRAARAAQEAGADGITAHLREDRRHITDADIEGL- 64

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
               ++     LN E    E    +  R+KP  + +VP+   + T++ G +  + +  L 
Sbjct: 65  ----QEVLNVPLNFEMAATEEMQAIALRHKPHAVCIVPEKREERTTEGGLEVAREENRLA 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFL 179
             +A L   GSR+S+F   +  +   +AA   GA+ IEL+TG Y   Y     ++ +  L
Sbjct: 121 HFIAPLREAGSRVSIFIAADQRQI--EAANRIGAEVIELHTGAYCDAYAEGHWEEAQKEL 178

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            KL   ++ A  + L+++AGH LT   +   + A P + E+++GH     A+  G+  A+
Sbjct: 179 QKLEEMSKFAHNLGLEVHAGHGLTYDTVSP-VAAFPEVQELNIGHFLIGEAIFLGLGPAI 237

Query: 240 FCFRRACGQHLD 251
              RR       
Sbjct: 238 AEMRRLMDDARK 249


>gi|332188241|ref|ZP_08389969.1| pyridoxine 5'-phosphate synthase [Sphingomonas sp. S17]
 gi|332011740|gb|EGI53817.1| pyridoxine 5'-phosphate synthase [Sphingomonas sp. S17]
          Length = 242

 Score =  242 bits (617), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 74/247 (29%), Positives = 124/247 (50%), Gaps = 10/247 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R   +P+ V    +A ++GA G+T H R D+RHI   D+  +   
Sbjct: 6   RLGVNIDHVATVRNARGAGYPDPVKAALVAAEAGADGITAHLREDRRHITDDDIARLSAE 65

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +        LN+E    +  L +  +++P    +VP+   + T++ G D    +  L+  
Sbjct: 66  LT-----VPLNLEMAATQEMLAIALKHRPHAACIVPEKREERTTEGGLDAAGQRQWLSPM 120

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           VA+L   G R+SLF + +  +   +AA   G   +EL+TG Y     + +     L +L+
Sbjct: 121 VAKLGEAGIRVSLFIEPDPRQI--EAALHLGVPVVELHTGRY--AELDGEARTEELRRLS 176

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A LA K  ++++AGH LT  N+   I AIP + E+++GH   A A+  G+ E V   R
Sbjct: 177 DAAALAAKNGIEVHAGHGLTYDNVAP-IAAIPQVRELNIGHFLIADAVFVGLPEVVRRMR 235

Query: 244 RACGQHL 250
            A     
Sbjct: 236 AAMDLAR 242


>gi|187478947|ref|YP_786971.1| pyridoxine 5'-phosphate synthase [Bordetella avium 197N]
 gi|123514322|sp|Q2KXM4|PDXJ_BORA1 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|115423533|emb|CAJ50069.1| pyridoxal phosphate biosynthetic protein [Bordetella avium 197N]
          Length = 241

 Score =  242 bits (617), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 72/251 (28%), Positives = 118/251 (47%), Gaps = 10/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + +N++ VA LR +R+  +P+ +     A  +GA  +T+H R D+RHI+  D+  IR
Sbjct: 1   MIELGINIDHVATLRQQRHTAYPDPLAAAVRAEDAGADLITLHLREDRRHIQDADVYAIR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E       L +    KP  + LVP+   +LT++ G D L     + 
Sbjct: 61  PRL-----RTRMNLECALTPEMLEIACAVKPSDVCLVPEKRAELTTEGGLDVLGQFDAVA 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             VA L   G R+SLF D +  +    A     A  IEL+TG Y        +  +   +
Sbjct: 116 DAVALLTEAGIRVSLFIDPDAAQIEAAA--RAQAPVIELHTGAYAEAEGELAERELERIR 173

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
            A+   L     L++NAGH L   N+   + AI  ISE+++GHA  A A+  G ++A+  
Sbjct: 174 AAVDVGLLH--GLRVNAGHGLHYGNVQA-VAAIDGISELNIGHAIVAQAVFDGWEKAIRD 230

Query: 242 FRRACGQHLDN 252
            +    Q    
Sbjct: 231 MKALMIQARAR 241


>gi|302342383|ref|YP_003806912.1| pyridoxal phosphate biosynthetic protein PdxJ [Desulfarculus
           baarsii DSM 2075]
 gi|301638996|gb|ADK84318.1| pyridoxal phosphate biosynthetic protein PdxJ [Desulfarculus
           baarsii DSM 2075]
          Length = 252

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 80/260 (30%), Positives = 128/260 (49%), Gaps = 10/260 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              +SVN++ VA LR  R +  P+ V    +A ++GA G+ VH R D+RHI+  DL  +R
Sbjct: 1   MARLSVNVDHVATLRQARGIDEPDPVWAAVLAEKAGADGIIVHLREDRRHIQDRDLRVLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  K  LN+E    E  + +     P+  TLVP+   +LT++ G +   N   + 
Sbjct: 61  -----QVVKGALNMEMAATEEMIGIAAEVGPQICTLVPERRQELTTEGGLEVKGNLDYMR 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             +A+L+     +SLF D +     ++AA + GA  +EL+TG   A           L+ 
Sbjct: 116 DVIAQLNQADIEVSLFIDPH--PEQVKAAHMAGAQVVELHTGA-YANAAGEAARLKLLSA 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   A+LA ++ +++ AGH L ++N+  L+  IP I E S+GH+  A AL  G + AV  
Sbjct: 173 LEDAARLAARVGMRVAAGHGLNLRNVAPLL-KIPEIVEYSIGHSIVARALFVGFESAVAE 231

Query: 242 FRRACGQHLDNTMRLTHPVK 261
                 Q      +   P +
Sbjct: 232 MLALVRQS-APPRQPESPAR 250


>gi|297568434|ref|YP_003689778.1| pyridoxal phosphate biosynthetic protein PdxJ [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924349|gb|ADH85159.1| pyridoxal phosphate biosynthetic protein PdxJ [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 398

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 74/248 (29%), Positives = 123/248 (49%), Gaps = 9/248 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T ++VN++ VA LR  R +  P+ V    I   +GA G+ VH R D+RHI+  D+  +R
Sbjct: 155 MTQLAVNVDHVATLRQARGINEPDPVLAAGICELAGAEGIVVHLREDRRHIQDRDVLLLR 214

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  K++LN+E       ++   R KP+ +TLVP+   +LT++ G +    Q  L 
Sbjct: 215 -----QTVKSKLNLEMAAAAEIIDFALRLKPDMVTLVPEKRRELTTEGGLNVKGQQKKLA 269

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           K +  ++     +SLF D +  + +       GA  +E++TG Y    +  ++       
Sbjct: 270 KVIKEMNQAQIPVSLFVDPDPGQIAAA--AAIGASFVEIHTGRYCDAPSE-EEREREFAL 326

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A+ A    L++NAGH L        + A+  I E+S+GHA  A A+  G+++AV  
Sbjct: 327 VAQAAEEALAAGLRVNAGHGLNYLTTAR-VAALGTIEELSIGHAIMARAILVGLEKAVAE 385

Query: 242 FRRACGQH 249
            R    Q 
Sbjct: 386 MRAIIKQA 393


>gi|315122113|ref|YP_004062602.1| pyridoxine 5'-phosphate synthase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495515|gb|ADR52114.1| pyridoxine 5'-phosphate synthase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 251

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 198/248 (79%), Positives = 221/248 (89%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MST+VS+NLNAVA+LRNRRNLPWP+LVHIG+IALQSGASGLTVHPRPDQRHIRYTDLP+I
Sbjct: 1   MSTNVSINLNAVAMLRNRRNLPWPDLVHIGRIALQSGASGLTVHPRPDQRHIRYTDLPKI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R+LIDE+FPKAELNIEGYPNE FL LCE YKPEQ TLVPDDP+QLTSDHGWDF+ NQ LL
Sbjct: 61  RQLIDEEFPKAELNIEGYPNEKFLFLCENYKPEQATLVPDDPNQLTSDHGWDFVNNQKLL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T+TV++LH+LG R+SLFADG+G++  LQ AKLTGADCIELYTGPYGACY+NPQQE I L 
Sbjct: 121 TRTVSKLHDLGCRVSLFADGDGHKDCLQRAKLTGADCIELYTGPYGACYDNPQQESILLE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KLA+TA LAQ M  +INAGHDLTIQNIP L+ +IPYISEISVGHAF   ALE G KEAV 
Sbjct: 181 KLALTAHLAQDMHFKINAGHDLTIQNIPQLVASIPYISEISVGHAFTVAALEYGTKEAVL 240

Query: 241 CFRRACGQ 248
            FR ACGQ
Sbjct: 241 RFRHACGQ 248


>gi|209550095|ref|YP_002282012.1| pyridoxine 5'-phosphate synthase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535851|gb|ACI55786.1| Pyridoxal phosphate biosynthetic protein PdxJ [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 250

 Score =  241 bits (616), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 148/250 (59%), Positives = 185/250 (74%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVA+LRNRR+LPWP++  +G+IAL SGASGLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPAKLSVNLNAVAMLRNRRDLPWPSVEALGRIALASGASGLTVHPRPDQRHIRFSDLPVI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP AE NIEGYP E F  LC    PEQ+TLVPDDP Q TSDHGWDF  ++A L
Sbjct: 61  RNLIDDEFPNAEFNIEGYPTEEFFELCAGAAPEQVTLVPDDPAQATSDHGWDFRTHRAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL  +G R+SLFADG+G+  +++ AK  GAD IELYTGPYG CY+ P++    L 
Sbjct: 121 TDAVARLKTMGCRVSLFADGDGDAEAVEIAKAVGADRIELYTGPYGGCYDAPERAVPILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  +  + L +NAGHDLT+ N+P+L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ALGRTADASLAIGLAVNAGHDLTVANLPDLVKRIPALAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQHL 250
            F RACGQ +
Sbjct: 241 RFCRACGQAV 250


>gi|332970681|gb|EGK09662.1| pyridoxal phosphate biosynthetic protein PdxJ [Kingella kingae ATCC
           23330]
          Length = 242

 Score =  241 bits (616), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 76/246 (30%), Positives = 125/246 (50%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ VA LRN R + +P+ +    IA   GA+ +T+H R D+RHI+  D+  I+   
Sbjct: 3   LGINIDHVATLRNARGVSYPSPLEAALIAETHGANLITLHLREDRRHIKDADVFAIK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  LN+E    E  L      +PE + +VP+   ++T++ G D +  Q  +   V
Sbjct: 60  --QAIRTRLNLEMAMTEEMLANALVVQPEDVCIVPEKREEVTTEGGLDVIAQQDKVRFYV 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L     R+S+F   +  +   QAA   GA  IEL+TG Y      P Q      ++A 
Sbjct: 118 EKLQAASIRVSIFIGADKAQI--QAAYDAGARVIELHTGAYADA-ETPAQREQERQRIAE 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A  + + +NAGH LTI N+   I  IP I E+++GH+  A A+  G+  A+   + 
Sbjct: 175 AAKFAASLGMTVNAGHGLTIHNVAP-IAQIPEIVELNIGHSIIAQAVFLGLPAAITQMKD 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMYRAR 239


>gi|295698533|ref|YP_003603188.1| pyridoxal phosphate biosynthetic protein PdxJ [Candidatus Riesia
           pediculicola USDA]
 gi|291157147|gb|ADD79592.1| pyridoxal phosphate biosynthetic protein PdxJ [Candidatus Riesia
           pediculicola USDA]
          Length = 252

 Score =  241 bits (616), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 71/251 (28%), Positives = 124/251 (49%), Gaps = 9/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RNRR   +P+ V    +A + G   +TVH R DQRHI   D+  + 
Sbjct: 3   KIYLGVNVDHVATIRNRRMERYPDPVRFAILAEEYGVDSITVHLREDQRHITENDVHRLS 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  +  +N+E   ++  +N     KP    LVP+   ++T++ G +    +  + 
Sbjct: 63  -----QVLQTRMNLEMSISKKIVNFARIVKPNSCCLVPERREEITTEGGLNVYHQKDEVR 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V +L + G  +SLF +   ++    A+   GAD +E +TG Y     N  + +  L K
Sbjct: 118 EVVEKLKSSGIVVSLFIEPKRDQI--DASIEAGADAVEFHTGFYSNS-RNLHESQEELRK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +  +A  A+   L +NAGH LT QN+   I  I  I E+++G++  + +L  G+K A+  
Sbjct: 175 IISSATYARSKGLIVNAGHGLTYQNV-FDIAKIYEIHELNIGYSIVSRSLFVGLKNAIKE 233

Query: 242 FRRACGQHLDN 252
            +R   +    
Sbjct: 234 MKRILHEARKR 244


>gi|257453599|ref|ZP_05618889.1| pyridoxine 5'-phosphate synthase [Enhydrobacter aerosaccus SK60]
 gi|257449057|gb|EEV24010.1| pyridoxine 5'-phosphate synthase [Enhydrobacter aerosaccus SK60]
          Length = 249

 Score =  241 bits (616), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 79/245 (32%), Positives = 125/245 (51%), Gaps = 12/245 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R + +P+ V    I  Q+GA G+T+H R D+RHI+  D+  + ++I
Sbjct: 8   LGVNIDHIATLRQARGVAYPDPVAGALICEQAGADGITLHLREDRRHIQDDDVYRLAKVI 67

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   +N+E    +  + +    KP  +  VP+   +LT++ G D + NQ  +   +
Sbjct: 68  T-----TRMNLEMAVTDEMVAIACDVKPAWVCFVPEKRQELTTEGGLDVIGNQDKIANAI 122

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQ----ERIFLN 180
            +LH +G+++SLF D    +     A   GAD IEL+TG Y        Q      I   
Sbjct: 123 QQLHQVGTQVSLFIDPELAQIDKSIA--LGADAIELHTGAYADYCLQHDQVKISHEITRI 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           K A+T     K  L +NAGH LT  N+   I  I  I E+++GHA  A ++  G+ EAV 
Sbjct: 181 KTAVTHAHEAKASLLVNAGHGLTRDNVAP-IADIGGIHELNIGHAIIADSVFMGLSEAVS 239

Query: 241 CFRRA 245
             R+A
Sbjct: 240 AMRKA 244


>gi|254448784|ref|ZP_05062241.1| pyridoxal phosphate biosynthetic protein PdxJ [gamma
           proteobacterium HTCC5015]
 gi|198261625|gb|EDY85913.1| pyridoxal phosphate biosynthetic protein PdxJ [gamma
           proteobacterium HTCC5015]
          Length = 246

 Score =  241 bits (616), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 75/250 (30%), Positives = 132/250 (52%), Gaps = 9/250 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ VA LR  R   +P+ +   ++A ++GA G+T+H R D+RHI+  D+   +  +
Sbjct: 6   LGINIDHVATLRQARLTTYPSPLKAAQLAEKAGADGITLHLREDRRHIQDADVAAFKTEL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   +N+E    E  + + E   P  + LVP+   +LT++ G D ++ ++ + K V
Sbjct: 66  -----GTRMNLELAVTEEMIAIAENTAPFAVCLVPEKREELTTEGGLDVVKYRSAVEKAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G R+SLF D    +   Q AK  GA  +EL+TG Y    ++       L ++  
Sbjct: 121 SRLAKAGCRVSLFIDAEPEQI--QCAKAIGASVVELHTGRYAEA-DSVAARESELARIRE 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A LA  + L ++AGH L + N+ + I AI  +SE+++GHA  A A+  G++ AV   R+
Sbjct: 178 GAALADSLGLLVHAGHGLNLDNVAD-IAAIEVVSELNIGHAIVADAVFVGMEAAVTAMRQ 236

Query: 245 ACGQHLDNTM 254
              +     +
Sbjct: 237 RIDRARSTAV 246


>gi|238021371|ref|ZP_04601797.1| hypothetical protein GCWU000324_01270 [Kingella oralis ATCC 51147]
 gi|237868351|gb|EEP69357.1| hypothetical protein GCWU000324_01270 [Kingella oralis ATCC 51147]
          Length = 243

 Score =  241 bits (615), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 79/246 (32%), Positives = 126/246 (51%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ VA LRN R   +P+ +    +A  +GA  +T+H R D+RHI+  D+  IR   
Sbjct: 3   LGINIDHVATLRNARGASYPSPLEAALVAETNGADAITLHLREDRRHIKDADVFAIR--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  K  +N+E    E  L    +  PE + +VP+   ++T++ G D +     +   V
Sbjct: 60  --QAIKTRMNLEMAMTEEMLANALQVMPEDVCIVPEKRTEVTTEGGLDVVGQPEKVRDYV 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           A+LH +G R+SLF D    +   QAA   GA  IEL+TG Y      P      L K+  
Sbjct: 118 AKLHAVGIRVSLFIDAERAQI--QAAYDCGARVIELHTGAYADA-PTPAARAAELAKIRE 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + + +NAGH LT+QN+   I  I  I E+++GH+  A A+  G+ +A+   + 
Sbjct: 175 AAAFADGLGITVNAGHGLTVQNVGA-IAQIEQIVELNIGHSIIAQAIFLGLPDAIRQMKE 233

Query: 245 ACGQHL 250
           A  +  
Sbjct: 234 AMFRAR 239


>gi|261380743|ref|ZP_05985316.1| pyridoxine 5'-phosphate synthase [Neisseria subflava NJ9703]
 gi|284796461|gb|EFC51808.1| pyridoxine 5'-phosphate synthase [Neisseria subflava NJ9703]
          Length = 242

 Score =  241 bits (615), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 76/247 (30%), Positives = 121/247 (48%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTIYPSPVEAALIAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L       PE + LVP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALNVMPEDVCLVPEKRQEVTTEGGLDVLAQQDKVAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  IEL+TG Y   +    ++     ++  
Sbjct: 118 KILTDAGIRVSLFIDADNAQI--QAAYDVGAPVIELHTGAYADAHG-HAEQMKQFERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  + AL  G+ EAV   + 
Sbjct: 175 GAHYASDLGLIVNAGHGLTIHNVTP-IAQILAIRELNIGHSLISQALFLGLPEAVRQMKE 233

Query: 245 ACGQHLD 251
              +   
Sbjct: 234 VMFRARM 240


>gi|282901604|ref|ZP_06309522.1| Pyridoxal phosphate biosynthetic protein PdxJ [Cylindrospermopsis
           raciborskii CS-505]
 gi|281193480|gb|EFA68459.1| Pyridoxal phosphate biosynthetic protein PdxJ [Cylindrospermopsis
           raciborskii CS-505]
          Length = 238

 Score =  241 bits (615), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 122/247 (49%), Gaps = 10/247 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M T + VN++ +A +R  R    P+ +    +A   GA G+T H R D+RHI+  D+  +
Sbjct: 1   MPT-LGVNIDHIATIRQARRTIEPDPIVAAMLAELGGADGITAHLREDRRHIQDRDVRLL 59

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R     +  +  LN+E    +  L +    KP+ +TLVP+   ++T++ G D L   A +
Sbjct: 60  R-----ETVRTHLNLEMAATDEMLAIALDIKPDYVTLVPEKREEITTEGGLDILGQIARI 114

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V +L +    +SLF D    + +  A     A  IEL+TG Y    +   +    L 
Sbjct: 115 GMIVDKLQSANIPVSLFIDAEPAQIA--ATVKVQAKFIELHTGKYAEAKDETTR-HQELA 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            LA   + A    L++NAGH LT  N+   + A+P + E+++GH   + A   G++ AV 
Sbjct: 172 LLAKGCEQAIAAGLRVNAGHGLTYWNV-FPVAALPGMEELNIGHTIISRAALVGMERAVR 230

Query: 241 CFRRACG 247
             ++A G
Sbjct: 231 EMKQAMG 237


>gi|289209105|ref|YP_003461171.1| pyridoxal phosphate biosynthetic protein PdxJ [Thioalkalivibrio sp.
           K90mix]
 gi|288944736|gb|ADC72435.1| pyridoxal phosphate biosynthetic protein PdxJ [Thioalkalivibrio sp.
           K90mix]
          Length = 255

 Score =  241 bits (615), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 77/259 (29%), Positives = 121/259 (46%), Gaps = 9/259 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VNL+ +A +R  R+ P+P+L+   ++A  SGA  +T+H R D+RHI+  D+  I+
Sbjct: 6   PLKLGVNLDHIATIRQARHTPYPDLMQAVRLAEASGADSITLHLREDRRHIQDDDVFGIK 65

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +        +N+E    E    +  +  PE   +VP+   +LT++ G D       L 
Sbjct: 66  PKLT-----VPMNLEMAATEGMQAIALKLLPEACCIVPEKREELTTEGGLDAAGQLERLR 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             VA L   G  +SLF + +  +  L+AA   GA  +EL+TG Y     +  +    L  
Sbjct: 121 DFVAPLTTAGIEVSLFVEPDVRQ--LEAAVKIGAPVVELHTGAYANA-RDAAERERLLAG 177

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A   Q M L INAGH L   N+  +    P   E+++GH+  A AL  G+ EAV  
Sbjct: 178 INEAAAAGQAMGLVINAGHGLDYDNVRPIAAN-PVFHELNIGHSIVARALFTGLPEAVSH 236

Query: 242 FRRACGQHLDNTMRLTHPV 260
            R              +PV
Sbjct: 237 MRGLMDAARAGLPVGQYPV 255


>gi|206890735|ref|YP_002249462.1| pyridoxal phosphate biosynthetic protein PdxJ [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|226700974|sp|B5YGR4|PDXJ_THEYD RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|206742673|gb|ACI21730.1| pyridoxal phosphate biosynthetic protein PdxJ [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 242

 Score =  241 bits (615), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 68/252 (26%), Positives = 128/252 (50%), Gaps = 10/252 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ +A +R  R    P+ V    +A+  GA G+T+H R D+RHI+  DL  +R
Sbjct: 1   MVILGVNVDHIATVRQARKTFEPDPVMAATLAILGGADGITIHLREDRRHIQDRDLKILR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +    ELN+E    E  +N+    KP+ +T+VP+   +LT++ G + ++ +  L 
Sbjct: 61  -----EVVPCELNLEMAATEEMINIALNIKPDMVTIVPEKRQELTTEGGLNVIELKDSLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + + ++ + G  +SLF +   N   ++ +K  GAD +E++TG Y     +   +   L +
Sbjct: 116 EAIKKIKDAGIPVSLFINPERN--DIECSKDIGADMVEIHTGYYSESRGDV--QLKELER 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +      +  + L+ NAGH L   N+ + I AI  +  + +GH+  A A+  G+++AV  
Sbjct: 172 IKDAVAYSISLGLKTNAGHGLNYYNVKS-IAAIKGLRGLYIGHSIIARAVLVGIEKAVRE 230

Query: 242 FRRACGQHLDNT 253
            +    +   N 
Sbjct: 231 MKNLIKEACINA 242


>gi|85373370|ref|YP_457432.1| pyridoxine 5'-phosphate synthase [Erythrobacter litoralis HTCC2594]
 gi|84786453|gb|ABC62635.1| pyridoxal phosphate biosynthesis protein [Erythrobacter litoralis
           HTCC2594]
          Length = 238

 Score =  241 bits (615), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 73/245 (29%), Positives = 118/245 (48%), Gaps = 10/245 (4%)

Query: 8   NLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQ 67
           N++ VA +RN R    P+ V   +I    G  G+T H R D+RHIR  DL  I     + 
Sbjct: 2   NIDHVATIRNARGGDHPDPVRAAEIVAAVGGDGITAHLREDRRHIRDEDLARI-----QA 56

Query: 68  FPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARL 127
                LN+E    E  L +  R++P    +VP+   + T++ G D       L   V +L
Sbjct: 57  ATDLPLNLEMAATEEMLAIALRHQPHAACIVPEKREERTTEGGLDAAGLHNTLVPIVDKL 116

Query: 128 HNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI--FLNKLAIT 185
                R+SLF + +  +  L AA   GA  +E +TG Y   + +  +++    L ++A  
Sbjct: 117 READIRVSLFIEADERQ--LDAALRLGAPVVEFHTGEYAHAHLDGDRDKTASELKRIADM 174

Query: 186 AQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRA 245
           + LA K  ++ +AGH LT +N+   I AIP ++E+++GH     A+  G++ AV   R  
Sbjct: 175 SALAAKNGIEPHAGHGLTYENVQP-IAAIPQLAELNIGHYLIGEAVFVGLENAVRRMREL 233

Query: 246 CGQHL 250
                
Sbjct: 234 MDDAR 238


>gi|23014394|ref|ZP_00054213.1| COG0854: Pyridoxal phosphate biosynthesis protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 244

 Score =  241 bits (615), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 69/249 (27%), Positives = 115/249 (46%), Gaps = 10/249 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R    P+ V    +A  +GA G+T H R D+RHI   D+  +   
Sbjct: 6   RLGVNIDHVATIRNARGGHHPDPVRAAHMAASAGADGITAHLREDRRHISDRDMERLANE 65

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I        LN E    E  + +  R++P    +VP+   + T++ G D +     L   
Sbjct: 66  IT-----LPLNFEMAATEEMVAIALRHRPHAACIVPERREERTTEGGLDVVGQFDSLKPL 120

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V RL   G R+S+F +   N   L A+K  GA  IEL+TG Y       +       ++ 
Sbjct: 121 VGRLVEAGIRVSMFIEA--NLKQLDASKALGAPVIELHTGAYCDA--EGEARDREFARIR 176

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A  A  + L+ +AGH L+   +   + A+P I E+++GH     A+  G++ ++   R
Sbjct: 177 EAAAHAHSIGLECHAGHGLSYDTVKP-VAALPSIMELNIGHFLVGEAIFVGLEASIRHMR 235

Query: 244 RACGQHLDN 252
           +   +    
Sbjct: 236 QLMDEARRR 244


>gi|37519672|ref|NP_923049.1| pyridoxine 5'-phosphate synthase [Gloeobacter violaceus PCC 7421]
 gi|81711536|sp|Q7NPF2|PDXJ_GLOVI RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|35210663|dbj|BAC88044.1| pyridoxal phosphate biosynthetic protein [Gloeobacter violaceus PCC
           7421]
          Length = 239

 Score =  241 bits (615), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 75/246 (30%), Positives = 125/246 (50%), Gaps = 10/246 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M T + VN++ VA +R  R    P+      +   +GA G+TVH R D+RHI+  D+  +
Sbjct: 1   MPT-LGVNIDHVATIRQARRTVEPDPAAAAVLVELAGADGITVHLREDRRHIQDRDVEIL 59

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R     +  +  LN+E       ++     +P+ +TLVP+   ++T++ G D     A +
Sbjct: 60  R-----RTVRTHLNLEMAATRAMVDFALDVRPDYVTLVPERREEVTTEGGLDVGGQIASV 114

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V +L   G  +SLF D +  +  LQA+  TGA  +EL+TG Y        Q    L 
Sbjct: 115 GLAVEQLQCAGIPVSLFVDPDAAQ--LQASARTGAKFVELHTGRYAEARGEQAQR-SELA 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +LA     AQ + L++NAGH LT  N+   +  +  + E+++GH+  A A+  G++ AV 
Sbjct: 172 QLAAACDEAQALGLRVNAGHGLTYWNVAP-VARLSGMEELNIGHSIIARAVLVGLERAVR 230

Query: 241 CFRRAC 246
             ++A 
Sbjct: 231 EMKQAM 236


>gi|313667835|ref|YP_004048119.1| pyridoxal phophate biosynthetic protein [Neisseria lactamica
           ST-640]
 gi|309378287|emb|CBX23075.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313005297|emb|CBN86730.1| pyridoxal phophate biosynthetic protein [Neisseria lactamica
           020-06]
          Length = 242

 Score =  241 bits (615), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 121/247 (48%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVSAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  +    
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQDKIAGFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  +EL+TG Y     +  ++     ++  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAAYDVGAPVVELHTGAYADA-RSHAEQIRQFERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  + AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLISQALFLGLPEAVRQMKE 233

Query: 245 ACGQHLD 251
              +   
Sbjct: 234 TMFRARM 240


>gi|118594604|ref|ZP_01551951.1| pyridoxal phosphate biosynthetic protein [Methylophilales bacterium
           HTCC2181]
 gi|118440382|gb|EAV47009.1| pyridoxal phosphate biosynthetic protein [Methylophilales bacterium
           HTCC2181]
          Length = 241

 Score =  241 bits (615), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 65/245 (26%), Positives = 116/245 (47%), Gaps = 9/245 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ +A +R  R   +P++V     A  SGA  +T+H R D+RH++  DL  ++  
Sbjct: 2   KLGVNIDHIATIRQARGTSYPSIVKAALAAETSGADSITLHLREDRRHMQDADLWALKP- 60

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
                 + ++N+E  P    + +     PE +  VP+   + T++ G D +   A + + 
Sbjct: 61  ----LLQTKMNLELAPTTEMIGIALDLTPEDVCFVPERREERTTEGGLDVIGQYATIHEA 116

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
             RL + G R+SLF     ++     A       IE++TG Y    ++  + +  L K+ 
Sbjct: 117 AHRLMDAGVRVSLFIAPCLDQIQK--AIDMKVPVIEIHTGHYAEMEDDIFR-KKELEKIK 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
                A    L +NAGH L  +N+   I A+  I E+++GHA  A AL  G + A+   +
Sbjct: 174 EAIDFATSHGLIVNAGHGLHYENVQE-IAAVKTIDELNIGHAIVAEALFVGWETAIKRMK 232

Query: 244 RACGQ 248
               +
Sbjct: 233 AIITE 237


>gi|73541936|ref|YP_296456.1| pyridoxal phosphate biosynthetic protein PdxJ [Ralstonia eutropha
           JMP134]
 gi|91207562|sp|Q46Z21|PDXJ_RALEJ RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|72119349|gb|AAZ61612.1| Pyridoxal phosphate biosynthetic protein PdxJ [Ralstonia eutropha
           JMP134]
          Length = 260

 Score =  241 bits (615), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 70/252 (27%), Positives = 121/252 (48%), Gaps = 9/252 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + +N++ VA LRN R   +P+ +     A ++GA  +T+H R D+RHIR  D+  +R 
Sbjct: 10  IDLGINIDHVATLRNARGTVYPDPIEAALQAEEAGADLITLHLREDRRHIRDADVRALRP 69

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +        +N+E    +  L++    +P+ + LVP+   ++T++ G D       ++ 
Sbjct: 70  QLA-----TRMNLECAITQEMLDIACEIRPQDVCLVPERREEVTTEGGLDVAGRFGQVSS 124

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L   G R+SLF D + ++ +  A    GA  IEL+TG Y    + P +  I   ++
Sbjct: 125 ACKQLAAAGIRVSLFIDADADQIAAAA--ACGAPVIELHTGRYADA-HTPDELAIEFRRV 181

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A       +  L +NAGH L   N+   I A+  I E+++GHA  A A+  G + AV   
Sbjct: 182 ADGVDAGIRHGLVVNAGHGLHYTNVQP-IAALAGIKELNIGHAVVAHAVFVGWQNAVREM 240

Query: 243 RRACGQHLDNTM 254
           +         T 
Sbjct: 241 KAIMVAARLGTR 252


>gi|120555157|ref|YP_959508.1| pyridoxine 5'-phosphate synthase [Marinobacter aquaeolei VT8]
 gi|120325006|gb|ABM19321.1| pyridoxine 5'-phosphate synthase [Marinobacter aquaeolei VT8]
          Length = 244

 Score =  241 bits (615), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 81/252 (32%), Positives = 131/252 (51%), Gaps = 11/252 (4%)

Query: 1   MSTS--VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLP 58
           M+T   + VN++ VA LR  R   +P+ V    +A ++GA G+T+HPR D+RHI+  D+ 
Sbjct: 1   MNTRVLLGVNIDHVATLRQARGTRYPDPVQAALLAEEAGADGITIHPREDRRHIQDRDVL 60

Query: 59  EIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQA 118
            +R     +  + ++N+E    +  L   E+ +PE + LVP+   +LT++ G D    + 
Sbjct: 61  LLR-----EVLQTKMNLEMAVTDAMLAFAEQVRPECVCLVPEKREELTTEGGLDVDGQEE 115

Query: 119 LLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF 178
            + K   RL  +G+ +SLF D +  +    AA   GA  +EL+TG Y      P+     
Sbjct: 116 RVAKACDRLAKIGAEVSLFIDPDPVQI--DAAVRCGAPVVELHTGEYAEA-GEPEAVEAS 172

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
              LA     A+K  L +NAGH L   N    + AIP I+E+++GHA  A A+  G+K+A
Sbjct: 173 FKVLADAVAYARKKGLIVNAGHGLHYHN-TERVAAIPGINELNIGHAIIARAVFTGLKDA 231

Query: 239 VFCFRRACGQHL 250
           V   +    +  
Sbjct: 232 VRDMKAILDRAR 243


>gi|146281618|ref|YP_001171771.1| pyridoxine 5'-phosphate synthase [Pseudomonas stutzeri A1501]
 gi|166219111|sp|A4VIX8|PDXJ_PSEU5 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|145569823|gb|ABP78929.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas stutzeri
           A1501]
 gi|327479797|gb|AEA83107.1| pyridoxine 5'-phosphate synthase [Pseudomonas stutzeri DSM 4166]
          Length = 248

 Score =  241 bits (615), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 77/244 (31%), Positives = 124/244 (50%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNVDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLMMKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +     +  +N E    E  L   E+ +PE + LVP+   +LT++ G D    +A + +
Sbjct: 67  AL-----QTRMNFEMGVTEAMLAFAEQLRPEHVCLVPETRQELTTEGGLDVAGQEARIRE 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL   G+ +SLF D +  +   +AA   GA  IEL+TG Y    ++  +    L ++
Sbjct: 122 AVERLRGCGAEVSLFIDADPRQI--EAAARVGAPAIELHTGRYADA-HSVAERACELARI 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               ++     L +NAGH L   N    I AI  ++E+++GHA  A AL  G K+AV   
Sbjct: 179 RDGVEVGLSHGLIVNAGHGLHYHN-AEAIAAIRGVNELNIGHAIVAHALFVGFKQAVKEM 237

Query: 243 RRAC 246
           +   
Sbjct: 238 KHLI 241


>gi|56459915|ref|YP_155196.1| pyridoxine 5'-phosphate synthase [Idiomarina loihiensis L2TR]
 gi|81600300|sp|Q5R109|PDXJ_IDILO RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|56178925|gb|AAV81647.1| Pyridoxal phosphate biosynthesis protein [Idiomarina loihiensis
           L2TR]
          Length = 242

 Score =  241 bits (614), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 76/247 (30%), Positives = 125/247 (50%), Gaps = 9/247 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA LRN R + +P+ V    IA Q+GA G+T+H R D+RHI   D+  ++  
Sbjct: 5   RLGVNIDHVATLRNARGVRYPDPVAAAAIAEQAGADGITIHLREDRRHITDRDVAMLK-- 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              Q     +N+E    E  L++  + +P    LVP+   +LT++ G +       +T  
Sbjct: 63  ---QTLNVPMNLEMAVTEEMLDIAIKTQPTYSCLVPEKRQELTTEGGLNVAGQLETITDA 119

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
             RL + G ++SLF D +  +    AAK  GA  +EL+TG Y       +Q  + L +L 
Sbjct: 120 TRRLSDAGIQVSLFIDADHEQI--DAAKKAGAPIVELHTGQYAEAETE-EQRTVELARLM 176

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             ++ A  + LQ+N GH L   N    +  IP + E+++GH+  A A+  G+ +AV   R
Sbjct: 177 EASEYAHSIGLQVNVGHGLHYHNTLE-VAEIPQVCELNIGHSIIARAVLVGLDQAVRDMR 235

Query: 244 RACGQHL 250
               +  
Sbjct: 236 NILDKAR 242


>gi|329850749|ref|ZP_08265594.1| pyridoxine 5'-phosphate synthase [Asticcacaulis biprosthecum C19]
 gi|328841064|gb|EGF90635.1| pyridoxine 5'-phosphate synthase [Asticcacaulis biprosthecum C19]
          Length = 253

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 63/250 (25%), Positives = 117/250 (46%), Gaps = 7/250 (2%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + +N++ VA +RN R    P+ +   ++ALQ+G  G+T H R D+RHI   D+  I+ 
Sbjct: 5   IRLGLNVDHVATVRNARGGHAPDPIRAARLALQAGVDGITAHLREDRRHIVDKDVWVIKE 64

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           + D       LN E    +  +++  + KP    LVP+   + T++ G D       + +
Sbjct: 65  VCDTFGK--PLNFEMAVTDEMVSMALKLKPHAACLVPERRQERTTEGGLDVAGQIDNIGE 122

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQ--ERIFLN 180
            V   +  G R SLF   +  + +  A     A  IE +TG     + + ++      L 
Sbjct: 123 AVRLFNKAGIRASLFIAADPAQVAAAA--KVQAPVIEFHTGALCDAFRDQERVSFDSELK 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +L I    A ++ ++++AGH +  + +   I  IP++ E+++GH     A+  G++ AV 
Sbjct: 181 RLQIAVAQAHELGVEVHAGHGIDYETV-PFIANIPHVRELNIGHFLIGEAIFIGLEAAVA 239

Query: 241 CFRRACGQHL 250
             R      +
Sbjct: 240 KMRDLMDGAV 249


>gi|56478593|ref|YP_160182.1| pyridoxine 5'-phosphate synthase [Aromatoleum aromaticum EbN1]
 gi|81598582|sp|Q5P083|PDXJ_AZOSE RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|56314636|emb|CAI09281.1| Pyridoxine-5-phosphate synthase [Aromatoleum aromaticum EbN1]
          Length = 251

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 70/254 (27%), Positives = 125/254 (49%), Gaps = 14/254 (5%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR  R    P+       A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MIELGVNIDHVATLRQARRTWEPDPAWAAMEAHLGGADGITVHLREDRRHIQDEDVRRLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  + +LN+E    +  + +    +PE   LVP+  H++T++ G D L  +  L 
Sbjct: 61  -----ELTQVKLNLEMAATDEMVGIACALRPEMAMLVPEGRHEVTTEGGLDVLAQEGRLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI---- 177
             VARL + G   S+F D    +  ++AA   GA   E++TGPY   ++   ++      
Sbjct: 116 DVVARLADAGIVTSVFIDAELGQ--VEAAARIGARVCEIHTGPYAHAFHAAGRDPQSAAV 173

Query: 178 --FLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
              ++K+    +  + + ++ NAGH L   N+   I  +P + E+ +GHA  + ++  G+
Sbjct: 174 VDEIDKVRRAGEAIRALGMRFNAGHALNYYNVQP-IARLPEVRELHIGHAIVSRSVFTGL 232

Query: 236 KEAVFCFRRACGQH 249
           ++AV   +R   + 
Sbjct: 233 RDAVREMKRLMREA 246


>gi|261401394|ref|ZP_05987519.1| pyridoxine 5'-phosphate synthase [Neisseria lactamica ATCC 23970]
 gi|269208615|gb|EEZ75070.1| pyridoxine 5'-phosphate synthase [Neisseria lactamica ATCC 23970]
          Length = 242

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 73/247 (29%), Positives = 121/247 (48%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVSAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  P+ + +VP+   ++T++ G D L  Q  +    
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALKVMPQDVCIVPEKRQEITTEGGLDVLAQQDKIAGFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  +EL+TG Y     +  ++     ++  
Sbjct: 118 KILTDAGIRVSLFIDADDRQI--QAAYDVGAPVVELHTGAYADA-RSHAEQIRQFERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 ACGQHLD 251
              +   
Sbjct: 234 TMFRARM 240


>gi|319899125|ref|YP_004159218.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella
           clarridgeiae 73]
 gi|319403089|emb|CBI76644.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella
           clarridgeiae 73]
          Length = 244

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 139/246 (56%), Positives = 177/246 (71%), Gaps = 3/246 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  +SVNLNAVAVLRNRRNLPWP++ +IG IAL +GA+GLTVHPRPD+RHIR+ DLP I
Sbjct: 1   MAIKLSVNLNAVAVLRNRRNLPWPSIENIGYIALSAGAAGLTVHPRPDERHIRFVDLPNI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L++  FP AE NIEGYP++TFLNL E+Y  +QITLVPD P Q TSDHGWDF  N   L
Sbjct: 61  RFLMNNSFPNAEFNIEGYPSDTFLNLAEKY-ADQITLVPDAPDQPTSDHGWDFASNAEFL 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              + RL     R+SLFA+   +   +  AK  GADCIE YTGPYG  +N+ +++   L+
Sbjct: 120 APIIQRLKEKNIRVSLFANTVLDSLDI--AKAIGADCIEFYTGPYGGAFNDEKKQTQELD 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL + AQ A+++ L INAGHDLTI N+P L+N IP+I+E+S+GH   A ALE G+ E V 
Sbjct: 178 KLVLAAQNARELKLDINAGHDLTIANLPALVNRIPWINEVSIGHGLIADALEYGMHETVQ 237

Query: 241 CFRRAC 246
            F +  
Sbjct: 238 RFIQLL 243


>gi|88812352|ref|ZP_01127602.1| Pyridoxal phosphate biosynthetic protein PdxJ [Nitrococcus mobilis
           Nb-231]
 gi|88790359|gb|EAR21476.1| Pyridoxal phosphate biosynthetic protein PdxJ [Nitrococcus mobilis
           Nb-231]
          Length = 254

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 74/246 (30%), Positives = 121/246 (49%), Gaps = 9/246 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V    +A Q+GA+ +T+H R D+RHI+  DL  +R ++
Sbjct: 12  LGVNIDHVATLRQARGTRYPDPVQAAIVAEQAGANAVTLHLREDRRHIQERDLRLLRDIV 71

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +A LN+E       L + ERY+P    +VP+   +LT++ G D     A   +  
Sbjct: 72  -----QARLNLEMAMTAEMLEIAERYRPHDSCIVPERREELTTEGGLDVRAQLARTREAC 126

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G +++LF D    +    AA   GA C+E++TG Y             L ++  
Sbjct: 127 TRLRAAGVQVALFIDPEIEQI--DAAVEAGAPCVEIHTGHYAEA-AETASRAHELERIRA 183

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             +   +  LQ+NAGH L  +N+   + A+  +  +++GHA  A A+  G   AV   RR
Sbjct: 184 AVRHGLQRGLQVNAGHGLNYRNVKP-VAALAGLGTLNIGHAIVAQAVFVGFATAVGDMRR 242

Query: 245 ACGQHL 250
              +  
Sbjct: 243 LILEAR 248


>gi|229588604|ref|YP_002870723.1| pyridoxine 5'-phosphate synthase [Pseudomonas fluorescens SBW25]
 gi|259530390|sp|C3K6Z0|PDXJ_PSEFS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|229360470|emb|CAY47327.1| pyridoxal phosphate biosynthetic protein [Pseudomonas fluorescens
           SBW25]
          Length = 247

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 78/240 (32%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  +   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMMAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +GS +SLF D +  +   +A++  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLSKIGSEVSLFIDADERQI--EASRRVGAPAIELHTGRYADA-TTPTEVADELQRI 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
                      L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 IDGVNCGLNEGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKGAVAEM 237


>gi|289548888|ref|YP_003473876.1| pyridoxal phosphate biosynthetic protein PdxJ [Thermocrinis albus
           DSM 14484]
 gi|289182505|gb|ADC89749.1| pyridoxal phosphate biosynthetic protein PdxJ [Thermocrinis albus
           DSM 14484]
          Length = 241

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 130/247 (52%), Gaps = 10/247 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA LR  R    P+ V    IA Q+GA  +T+H R D+RHI+  DL  I+  
Sbjct: 2   RLGVNIDHVATLRQARRTFEPSPVLAALIAQQAGAHQITLHLREDRRHIQDEDLELIK-- 59

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +     +N+E  P E    +  R +P++ TLVP+   ++T++ G D ++ ++ L   
Sbjct: 60  ---KLVILPVNLEMAPTEEMKMIALRVRPDRCTLVPERRQEITTEGGLDVVKLESFLRDY 116

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ--QERIFLNK 181
           +  L   G  ISLF +    +   +A+   GAD +EL+TG Y   +N  +  + +  L +
Sbjct: 117 LKELKEAGIEISLFVEPQEEQI--RASHRVGADAVELHTGRYAELWNQHRFAEAQEELKR 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPY-ISEISVGHAFAATALECGVKEAVF 240
           L     LA+ + L++ AGH LT QN+  L+  +   + E++VGH+  + A+  G+++A+ 
Sbjct: 175 LREAGMLAKSLGLRVYAGHGLTYQNVTQLVAYLKDVVEELNVGHSIVSNAVLFGLEKAIK 234

Query: 241 CFRRACG 247
            F     
Sbjct: 235 EFMEKMR 241


>gi|319638210|ref|ZP_07992973.1| pyridoxine 5'-phosphate synthase [Neisseria mucosa C102]
 gi|317400483|gb|EFV81141.1| pyridoxine 5'-phosphate synthase [Neisseria mucosa C102]
          Length = 242

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 121/247 (48%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA   GA  +T+H R D+RHI+  D+  ++   
Sbjct: 3   LGVNIDHIATVRNARGTIYPSPVEAALIAETHGADLITMHLREDRRHIKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L       PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALNVMPEDVCIVPEKRQEVTTEGGLDVLAQQDKVAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +   QAA   GA  IEL+TG Y   +    ++     ++  
Sbjct: 118 KILTDAGIRVSLFIDADNAQI--QAAYDVGAPVIELHTGAYADAHG-HAEQMKQFERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  + AL  G+ EAV   + 
Sbjct: 175 GAHYASDLGLIVNAGHGLTIHNVTP-IAQILAIRELNIGHSLISQALFLGLPEAVRQMKE 233

Query: 245 ACGQHLD 251
              +   
Sbjct: 234 VMFRARM 240


>gi|197105339|ref|YP_002130716.1| pyridoxal phosphate biosynthetic protein PdxJ [Phenylobacterium
           zucineum HLK1]
 gi|196478759|gb|ACG78287.1| pyridoxal phosphate biosynthetic protein PdxJ [Phenylobacterium
           zucineum HLK1]
          Length = 253

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 68/252 (26%), Positives = 118/252 (46%), Gaps = 7/252 (2%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R   +P+ V   ++AL +GA G+T H R D+RHI   D+  + 
Sbjct: 3   KLRLGVNIDHVATVRNARGESYPDPVRAAELALAAGADGITAHLREDRRHISDADIDALA 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +     LN E         +   ++P    LVP+   ++T++ G D  +   ++ 
Sbjct: 63  ATCRRRGR--PLNFECAVTPEMEAIALAHRPHAACLVPERREEVTTEGGLDVARGHNVIA 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYN--NPQQERIFL 179
             V RL   G R+S F D +  +  + AAK  GA  +EL+TG Y          +    L
Sbjct: 121 PVVQRLVEAGIRVSCFIDADPAQ--VAAAKSVGAQVVELHTGAYCEAVRAGRRDEAARLL 178

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           + L   A  A ++ L+++AGH +  + +   + AIP + E+++GH     A+  G+  A+
Sbjct: 179 DGLKAAAAEAVRLGLEVHAGHGIDYETVGP-VAAIPQVMELNIGHFLIGEAIFIGLGPAI 237

Query: 240 FCFRRACGQHLD 251
              R    +   
Sbjct: 238 QRMRALMDEARR 249


>gi|329119896|ref|ZP_08248570.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327464052|gb|EGF10363.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 241

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 75/247 (30%), Positives = 122/247 (49%), Gaps = 10/247 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +     A   GA  +T+H R D+RHIR  D+  I    
Sbjct: 3   LGVNIDHVATLRNARGTTYPSPLEAALTAETHGADYITLHLREDRRHIRDDDVAAI---- 58

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  +N+E    E  L    R +P+ + +VP+   ++T++ G D +  Q  +    
Sbjct: 59  -ARTVRTHINLEMALTEEMLEHALRVRPQDVCIVPEKRQEITTEGGLDVIALQQKIADYT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G R+SLF D +  +   QAA  TGA  IEL+TG Y     +  +    L K+  
Sbjct: 118 HQLTAAGIRVSLFIDPDETQI--QAALDTGAPAIELHTGAYADAPAH--ERPRQLAKIEE 173

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A +  L +NAGH L I N+   +  I  I+E+++GHA  A +L  G+  A+   + 
Sbjct: 174 AAYFASERGLTVNAGHGLNIHNVAP-VAKILPIAELNIGHALIAQSLFLGLPAAIRQMKE 232

Query: 245 ACGQHLD 251
              +  +
Sbjct: 233 TIHRARN 239


>gi|160900690|ref|YP_001566272.1| pyridoxine 5'-phosphate synthase [Delftia acidovorans SPH-1]
 gi|160366274|gb|ABX37887.1| Pyridoxal phosphate biosynthetic protein PdxJ [Delftia acidovorans
           SPH-1]
          Length = 257

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 102/248 (41%), Positives = 145/248 (58%), Gaps = 4/248 (1%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA+LRN R+L  P++    +I L++GA G+T+HPRPDQRHIR  D+ E++ 
Sbjct: 10  TALSVNVNKVALLRNTRHLGIPSVTRAARICLEAGAQGITIHPRPDQRHIRSEDVYELQA 69

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+ +Q+P+AE NIEG P +  ++     +P Q T VPD   Q TSDHGW+F Q+   L  
Sbjct: 70  LM-KQWPQAEFNIEGNPTQNLMDFIRDTRPHQATFVPDSEDQFTSDHGWNFPQDAERLKP 128

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A    LG R+SLF D    + +  AA+  GAD +ELYT PY A +    QE       
Sbjct: 129 LIAECRQLGVRVSLFMDPVPAQMA--AARAVGADRVELYTEPYAAAWGTADQEAQLQAYA 186

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A            INAGHDL+  N+   +  +P + E+S+GHA  A ALE G  E V  +
Sbjct: 187 AAAQAALDAGL-GINAGHDLSRDNLAAFVARVPGLLEVSIGHALIADALELGYAETVRAY 245

Query: 243 RRACGQHL 250
           ++   Q +
Sbjct: 246 QQCIDQGM 253


>gi|312959176|ref|ZP_07773695.1| Pyridoxine 5'-phosphate synthase [Pseudomonas fluorescens WH6]
 gi|311286946|gb|EFQ65508.1| Pyridoxine 5'-phosphate synthase [Pseudomonas fluorescens WH6]
          Length = 247

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 78/240 (32%), Positives = 121/240 (50%), Gaps = 9/240 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ 
Sbjct: 7   ILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVLLLKD 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +  +N E    E  +   ER +P  I LVP+   +LT++ G D    +A +  
Sbjct: 67  VL-----QTRMNFEMGVTEEMMAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKA 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL  +GS +SLF D +  +   +A++  GA  IEL+TG Y      P +    L ++
Sbjct: 122 AVERLSRIGSEVSLFIDADERQI--EASRRVGAPAIELHTGRYADA-TTPTEVADELQRI 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
                      L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV   
Sbjct: 179 IDGVNCGLGEGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKGAVAEM 237


>gi|319407471|emb|CBI81121.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella sp. 1-1C]
          Length = 244

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 135/246 (54%), Positives = 179/246 (72%), Gaps = 3/246 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  +SVNLNAVAVLRNRR+LPWP++ +IG IAL +GA+GLTVHPRPD+RHIR+ DLP+I
Sbjct: 1   MAIKLSVNLNAVAVLRNRRDLPWPSIENIGYIALSAGAAGLTVHPRPDERHIRFVDLPKI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+++ FP AE NIEGYP++TFL+L E+Y  +QITLVPD P Q TSDHGWDF+ +   L
Sbjct: 61  RFLMNDAFPNAEFNIEGYPSDTFLDLAEKY-ADQITLVPDSPDQSTSDHGWDFVSSAEFL 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              + RL     R+SLFA+   +   L  AK  GAD +E YTGPYG  +++ +++   L+
Sbjct: 120 APVIQRLKEKNIRVSLFANTVLD--DLDIAKAIGADYVEFYTGPYGGAFDDEEKQTQELD 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL + AQ A+++ L INAGHDLTI N+P L+N IP+I+E+S+GH   A ALE G+ E V 
Sbjct: 178 KLVLAAQKARELQLHINAGHDLTIANLPALVNRIPWINEVSIGHGLIADALEYGMHETVQ 237

Query: 241 CFRRAC 246
            F R  
Sbjct: 238 RFIRLL 243


>gi|315499949|ref|YP_004088752.1| pyridoxal phosphate biosynthetic protein pdxj [Asticcacaulis
           excentricus CB 48]
 gi|315417961|gb|ADU14601.1| pyridoxal phosphate biosynthetic protein PdxJ [Asticcacaulis
           excentricus CB 48]
          Length = 249

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 63/250 (25%), Positives = 116/250 (46%), Gaps = 7/250 (2%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + +N++ +A +RN R    P+     +  L++G  G+T H R D+RH+   D+  ++ 
Sbjct: 4   IRLGINIDHIATVRNARGGHAPDPARGARQVLEAGVDGITAHLREDRRHVIDKDIWALKA 63

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           + DE      LN E    +  + +    KP    LVP+   + T++ G D   N  ++  
Sbjct: 64  VCDEFGK--PLNFEMAVTDEMIGIALDLKPHACCLVPERRQERTTEGGLDVAGNIDVVGP 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE--RIFLN 180
            VARL+  G R SLF     +   + AA   GA  +E +TG     +   ++      + 
Sbjct: 122 AVARLNAAGIRSSLFI--ATDPLQVSAASNIGAPVVEFHTGALCDAWREGERSIVETEMK 179

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL   A +A ++ ++++AGH +    +   I+ +P I E+++GH     A+  G++ +V 
Sbjct: 180 KLEWAAHMAAEVGIEVHAGHGIDYDTVT-FISRVPQIKELNIGHFLIGEAIFVGLEASVS 238

Query: 241 CFRRACGQHL 250
             R       
Sbjct: 239 RMRHLMDAAR 248


>gi|190892497|ref|YP_001979039.1| pyridoxine 5'-phosphate synthase (pyridoxal phosphate biosynthesis
           protein) [Rhizobium etli CIAT 652]
 gi|190697776|gb|ACE91861.1| pyridoxine 5'-phosphate synthase protein (pyridoxal phosphate
           biosynthesis protein) [Rhizobium etli CIAT 652]
          Length = 250

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 147/248 (59%), Positives = 183/248 (73%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+IAL +GASGLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVEALGRIALAAGASGLTVHPRPDQRHIRFSDLPVI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP AE NIEGYP   FL+LC    PEQ+TLVPDDP Q TSDHGWDF ++QA L
Sbjct: 61  RNLIDDEFPNAEFNIEGYPTAEFLDLCAGAAPEQVTLVPDDPSQATSDHGWDFRKHQAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  V RL  +G R+SLFADG+G+  ++  AK  GAD IELYTGPYG CY+ P++    L 
Sbjct: 121 TDVVGRLKTMGCRVSLFADGDGDAQAVTIAKAVGADRIELYTGPYGGCYDAPERAAPILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ALGKTADAALAIGLAVNAGHDLTVANLPALVKRIPDLAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQ 248
            F RACGQ
Sbjct: 241 RFCRACGQ 248


>gi|225698152|pdb|3GK0|A Chain A, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein From Burkholderia Pseudomallei
 gi|225698153|pdb|3GK0|B Chain B, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein From Burkholderia Pseudomallei
 gi|225698154|pdb|3GK0|C Chain C, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein From Burkholderia Pseudomallei
 gi|225698155|pdb|3GK0|D Chain D, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein From Burkholderia Pseudomallei
 gi|225698156|pdb|3GK0|E Chain E, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein From Burkholderia Pseudomallei
 gi|225698157|pdb|3GK0|F Chain F, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein From Burkholderia Pseudomallei
 gi|225698158|pdb|3GK0|G Chain G, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein From Burkholderia Pseudomallei
 gi|225698159|pdb|3GK0|H Chain H, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein From Burkholderia Pseudomallei
          Length = 278

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 123/255 (48%), Gaps = 9/255 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R 
Sbjct: 32  IDLGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLRP 91

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +     K  +N+E       L++    +P    LVP+   +LT++ G D + +   +  
Sbjct: 92  RV-----KTRMNLECAVTPEMLDIACEIRPHDACLVPEKRSELTTEGGLDVVGHFDAVRA 146

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L + G R+SLF D +  +   +AA  TGA  IEL+TG Y    ++  +++    ++
Sbjct: 147 ACKQLADAGVRVSLFIDPDEAQI--RAAHETGAPVIELHTGRYADA-HDAAEQQREFERI 203

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A        + L++NAGH L   N+   I A+P I+E+++GHA  A A+  G   AV   
Sbjct: 204 ATGVDAGIALGLKVNAGHGLHYTNVQA-IAALPGIAELNIGHAIVAHAVFVGWDNAVREM 262

Query: 243 RRACGQHLDNTMRLT 257
           +          +   
Sbjct: 263 KAIMVAARVAALHGG 277


>gi|313575254|emb|CBI71194.1| hypothetical protein [uncultured bacterium]
          Length = 247

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 127/245 (51%), Positives = 165/245 (67%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
            T +SVNLNAVA LRNRR+LPWP++V + ++ L +GASG+TVHPRPD+RHIR +D+ ++ 
Sbjct: 1   MTLLSVNLNAVAQLRNRRDLPWPSVVGMARVVLDAGASGVTVHPRPDERHIRRSDVFDLS 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L+ +++P+AE NIEGYP+E F+ L E   P+Q+TLVPDDP Q TSDHGWDF  N   LT
Sbjct: 61  ALLRDEYPEAEFNIEGYPSEDFIALIETVNPQQVTLVPDDPAQATSDHGWDFHANNNFLT 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V +L   G RISLF D +     + AAK TGAD +ELYTGPYG CY++P +    L  
Sbjct: 121 SVVQKLKQPGRRISLFCDPDAGAKGISAAKATGADRVELYTGPYGGCYDDPARAEAELAA 180

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           LA TA  A    L +NAGHDLT++N+P    A+  + E S+GH   A AL  G  EAV  
Sbjct: 181 LADTAAAAHAAGLGLNAGHDLTLENLPAFQAAVKGVDEASIGHGLTADALLMGFPEAVRR 240

Query: 242 FRRAC 246
           +R   
Sbjct: 241 YREVL 245


>gi|225850005|ref|YP_002730239.1| pyridoxine 5'-phosphate synthase [Persephonella marina EX-H1]
 gi|254781564|sp|C0QU74|PDXJ_PERMH RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|225646190|gb|ACO04376.1| pyridoxine 5'-phosphate synthase [Persephonella marina EX-H1]
          Length = 246

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 68/253 (26%), Positives = 130/253 (51%), Gaps = 8/253 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ +A +R  R    P+ V    IA  +GA  +T H R D+RHI+ +D+ ++R +
Sbjct: 2   RLGVNIDHIATVREARKTYEPDPVKGAIIARDAGADQITFHLREDRRHIQDSDVEKLRAV 61

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I E      LN+E    E    +  R KP+++T+VP+   ++T++ G D +     L + 
Sbjct: 62  ITE----IPLNMEMAATEEMKQIAIRIKPDRVTIVPEKREEITTEGGLDVVSMTDYLREF 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           +  L + G  ++ F D    +   +A+   GAD +E++TG Y    ++ ++    + ++ 
Sbjct: 118 IKELKDNGINVATFVDPVEEQI--KASMEVGADAVEIHTGEYANARSD-KERDNEIFRIK 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A   + + L++ AGH LT  N+   +  I  I E+++GH+  A A+  G+ EAV   +
Sbjct: 175 KAAVYGRSLGLKVFAGHGLTYTNVQP-VAEIEEIEELNIGHSIIANAIFLGLDEAVRKMK 233

Query: 244 RACGQHLDNTMRL 256
           +   +     +R+
Sbjct: 234 KLINEVRRKDIRV 246


>gi|167563523|ref|ZP_02356439.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           oklahomensis EO147]
 gi|167570684|ref|ZP_02363558.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           oklahomensis C6786]
          Length = 257

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 74/255 (29%), Positives = 120/255 (47%), Gaps = 9/255 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R 
Sbjct: 11  IELGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
                  K  +N+E       L++    +P    LVP+   +LT++ G D   +   +  
Sbjct: 71  -----LLKTRMNLECAVTPEMLDIACEIRPHDACLVPEKRSELTTEGGLDVAGHFDAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L N+G R+SLF D +  +   +AA  TGA  IEL+TG Y    ++  ++     ++
Sbjct: 126 ACKQLANVGVRVSLFIDPDDAQI--RAAHETGAPVIELHTGRYADA-HDEAEQEREFERI 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A        + L++NAGH L   N+   I A+P I E+++GHA  A A+  G   AV   
Sbjct: 183 AAGVDAGIALGLKVNAGHGLHYTNVQA-IAALPGIDELNIGHAIVAHAVFVGWDNAVREM 241

Query: 243 RRACGQHLDNTMRLT 257
           +          +   
Sbjct: 242 KAIMVAARVAALHGG 256


>gi|24214214|ref|NP_711695.1| pyridoxal phosphate biosynthetic protein PdxJ [Leptospira
           interrogans serovar Lai str. 56601]
 gi|24195119|gb|AAN48713.1| pyridoxal phosphate biosynthetic protein PdxJ [Leptospira
           interrogans serovar Lai str. 56601]
          Length = 250

 Score =  239 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 89/252 (35%), Positives = 144/252 (57%), Gaps = 9/252 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVN+N +A LRN R    P+L +   + L++GA G+TVHPR D+RHIR  D+  +
Sbjct: 1   MKVKLSVNINKIATLRNSRGGNIPDLSYFANLVLKAGAHGITVHPREDERHIRKEDVFVL 60

Query: 61  RR----LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQN 116
           +        +     E N+EG P+  FL+L  + KP+Q TLVP  P ++TSDHG+DF ++
Sbjct: 61  KEFIDSYNRKNNTNIEYNLEGEPSPRFLDLVLKTKPDQATLVPVTPGEITSDHGFDFEKD 120

Query: 117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQ-- 174
             +L++    L     R+SLF +      +L+ A L+GAD +E YTGP+   +++  Q  
Sbjct: 121 MEILSEYSKILKKDKIRVSLFVE--TGLKNLKLASLSGADRVEFYTGPFAEAFDHSPQIG 178

Query: 175 ERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECG 234
           ++ F  +    A       + INAGHDL  +N+  + + +P + E+S+GH   + ALE G
Sbjct: 179 KKRFETEYVPAATEILNQKMGINAGHDLDHENL-KIFSKLPGLQEVSIGHRLISRALETG 237

Query: 235 VKEAVFCFRRAC 246
           + ++V  + +A 
Sbjct: 238 IDQSVKDYLQAL 249


>gi|237807626|ref|YP_002892066.1| pyridoxine 5'-phosphate synthase [Tolumonas auensis DSM 9187]
 gi|237499887|gb|ACQ92480.1| pyridoxal phosphate biosynthetic protein PdxJ [Tolumonas auensis
           DSM 9187]
          Length = 243

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 84/250 (33%), Positives = 133/250 (53%), Gaps = 9/250 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R
Sbjct: 3   KILLGVNIDHVATLRNARGTAYPDPVFAAALAEQAGAEGITVHLREDRRHITDRDVEILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  K  +N+E    E  L++  R KP+ + LVP+   ++T++ G D       + 
Sbjct: 63  -----QTIKTRMNLEMAVTEEMLSIACRIKPQFVCLVPEKRQEVTTEGGLDVASQVERIR 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V RL  +G+++SLF D +  +    AA  +GA  IE++TG Y       +Q++  + +
Sbjct: 118 DAVTRLAAVGTQVSLFIDADHAQI--DAAVASGAPYIEIHTGRYADAETEEEQQQELV-R 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A K  L++NAGH L  QN+   I AIP + E+++GHA    A+  G+ EAV  
Sbjct: 175 IAEAAAYASKKGLKVNAGHGLHYQNVQA-IAAIPEMIELNIGHAIIGRAVFSGLPEAVAE 233

Query: 242 FRRACGQHLD 251
            +R   +   
Sbjct: 234 MKRLMLEARQ 243


>gi|293606421|ref|ZP_06688780.1| pyridoxal phosphate biosynthetic protein PdxJ [Achromobacter
           piechaudii ATCC 43553]
 gi|292815179|gb|EFF74301.1| pyridoxal phosphate biosynthetic protein PdxJ [Achromobacter
           piechaudii ATCC 43553]
          Length = 246

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 76/255 (29%), Positives = 124/255 (48%), Gaps = 10/255 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR +R+  +P+ V     A  +GA  +T+H R D+RHI+  D+  IR
Sbjct: 1   MIELGVNIDHVATLRQQRHTVYPDPVAAALRAEDAGADLITLHLREDRRHIQDADVYAIR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  L +    KP  + LVP+   +LT++ G +       +T
Sbjct: 61  PQL-----RTRMNLECAITDEMLEIACAVKPNDVCLVPEKRTELTTEGGLEVAGAMKAVT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V  L   G R+SLF D +  + +  A    GA  IEL+TG Y        Q  +   +
Sbjct: 116 DAVGLLTEAGIRVSLFIDADPVQIAAAA--KAGATVIELHTGAYAEAEGEAAQAELQRIR 173

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           LA+   L     L++NAGH L + N+   + AI  ISE+++GHA  A A+  G ++AV  
Sbjct: 174 LAVAEGLRH--GLRVNAGHGLHLGNVAP-VAAIDGISELNIGHAIVAQAVFDGWEKAVRD 230

Query: 242 FRRACGQHLDNTMRL 256
            +    +     +R 
Sbjct: 231 MKAVMVRARLQALRG 245


>gi|294678831|ref|YP_003579446.1| pyridoxine 5'-phosphate synthase [Rhodobacter capsulatus SB 1003]
 gi|294477651|gb|ADE87039.1| pyridoxine 5'-phosphate synthase [Rhodobacter capsulatus SB 1003]
          Length = 247

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 74/250 (29%), Positives = 126/250 (50%), Gaps = 10/250 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +RN R   +P+ +    +A  +GA G+T H R D+RHIR +D+ E++  
Sbjct: 6   RLGVNIDHVATVRNARGSAYPSPLRAALMAEAAGADGITAHLREDRRHIRDSDMAELKAN 65

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     K  LN E         +    +P  + LVP+   + T++ G D   +QA LT  
Sbjct: 66  L-----KIPLNFEMATTMEMQRIALATRPHAVCLVPEKRQERTTEGGLDVAGDQARLTAY 120

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFLNK 181
           +A L   G+R+S+F   +  +   +A+   GA  +EL+TG Y   +      +    L  
Sbjct: 121 IAPLRQAGARVSMFVGPDPRQI--EASAAIGAAVVELHTGHYCDLHYEGRFAERDAELKA 178

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   A LA  + L+++AGH LT + +   + AIP + E+++GH   A AL  G++ ++  
Sbjct: 179 LEKAAALAASLGLEVHAGHGLTYETVAP-VAAIPEVKELNIGHFLMAEALFIGLEASIAE 237

Query: 242 FRRACGQHLD 251
            RR   +   
Sbjct: 238 MRRLMDEARR 247


>gi|284929734|ref|YP_003422256.1| pyridoxine 5'-phosphate synthase [cyanobacterium UCYN-A]
 gi|284810178|gb|ADB95875.1| pyridoxine 5'-phosphate synthase [cyanobacterium UCYN-A]
          Length = 249

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 78/243 (32%), Positives = 125/243 (51%), Gaps = 9/243 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +R  R    PN V    +A   GA+G+T+H R D+RHI+  D+  I+   
Sbjct: 13  LGVNIDHIATIRQARCSTEPNPVIAAVLAELGGANGITMHLREDRRHIQDRDVFLIK--- 69

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  +  LN+E    E  L +    KP  ITLVP+   ++T++ G D   N   L K V
Sbjct: 70  --ETIQTRLNLEIAATEEMLQIAFDIKPHCITLVPEKREEITTEGGLDVKTNLEHLKKIV 127

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            R+   G   SLF D N ++   QA+  T A  IEL+TG Y    ++ +Q +  L  L +
Sbjct: 128 GRIQENGIIASLFIDSNQDQI--QASADTRAKHIELHTGQYVNSTSD-KQCQEELKLLKL 184

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             + A  + ++INAGH L   N+   +  +P I E+++GH   + A+  G++ AV   + 
Sbjct: 185 GCKQALDLGIKINAGHGLNYSNV-YSVACLPGIEELNIGHTIVSRAVLVGMERAVKEMKL 243

Query: 245 ACG 247
           A  
Sbjct: 244 AIK 246


>gi|241762151|ref|ZP_04760234.1| pyridoxal phosphate biosynthetic protein PdxJ [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|260753741|ref|YP_003226634.1| pyridoxine 5'-phosphate synthase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|241373401|gb|EER63001.1| pyridoxal phosphate biosynthetic protein PdxJ [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|258553104|gb|ACV76050.1| pyridoxal phosphate biosynthetic protein PdxJ [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 256

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 73/248 (29%), Positives = 125/248 (50%), Gaps = 10/248 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA +RN R    P+ V   ++A  +GA G+T H R D+RHI   DL  +  
Sbjct: 5   IRLGVNIDHVATIRNARGGTHPDPVRAAQLAAHAGADGITTHLREDRRHISDDDLVNL-- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
              E+     LN+E    E  L +  +++P  + LVP+   + T++ G D       L  
Sbjct: 63  ---EKGITLPLNLEMAATEEMLEIALQHRPHAVCLVPEKREEQTTEGGLDAAGQIDSLKP 119

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VA+L   G R+SLF + +  +   +AAK      IEL+TG Y    N   +    L ++
Sbjct: 120 IVAKLLAAGIRVSLFIEPDETQI--RAAKALNVPVIELHTGHYANSVNE--ELAAELIRI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A+LA+ ++++++AGH LT +N+   I A+  I+E+++GH     A+  G++ ++   
Sbjct: 176 EQAAKLAKSLNIEVHAGHGLTYENVIP-IAALEEIAELNIGHFLIGEAIFIGLEASIKRM 234

Query: 243 RRACGQHL 250
           R       
Sbjct: 235 RYLMDAAR 242


>gi|319789370|ref|YP_004151003.1| pyridoxal phosphate biosynthetic protein PdxJ [Thermovibrio
           ammonificans HB-1]
 gi|317113872|gb|ADU96362.1| pyridoxal phosphate biosynthetic protein PdxJ [Thermovibrio
           ammonificans HB-1]
          Length = 244

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 80/247 (32%), Positives = 130/247 (52%), Gaps = 10/247 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA +RN R    P+ VH   IA  +GA  +T+H R D+RH+   DL  I+ 
Sbjct: 5   IRLGVNIDHVATVRNARRTFEPDPVHAAVIADLAGADQITLHVREDRRHVNERDLKLIK- 63

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +   + +N+E    E  L +    +P Q+TLVP+   ++T++ G D       +  
Sbjct: 64  ----ELIHSRVNLEMAVTEEMLQIATSVRPHQVTLVPERREEVTTEGGLDVKGQLERVRA 119

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQQERIFLN 180
            V RL   G  ++LF D    E  ++AA   GA+ +EL+TG Y   +   N  + +  L 
Sbjct: 120 AVERLKGAGIVVNLFIDP--EEEQVRAAAEVGANAVELHTGRYAEAFAAGNEGEVQEELE 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +L   A+LA+++ L++ AGH LT +N+   I  IP I E+++GH+  A A+  G+KEAV 
Sbjct: 178 RLKRAAKLAKELGLRVYAGHGLTYKNVKP-IAEIPEIEELNIGHSIVANAVLLGLKEAVE 236

Query: 241 CFRRACG 247
              +   
Sbjct: 237 KMIKLIN 243


>gi|320353408|ref|YP_004194747.1| pyridoxine 5'-phosphate synthase [Desulfobulbus propionicus DSM
           2032]
 gi|320121910|gb|ADW17456.1| pyridoxine 5'-phosphate synthase [Desulfobulbus propionicus DSM
           2032]
          Length = 392

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 76/246 (30%), Positives = 125/246 (50%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              +++N++ VA +R  R    P+ V    +   +GA G+ VH R D+RHI+  D+  +R
Sbjct: 154 MPFLAINVDHVATIRQARGGQEPDPVLAASLCELAGADGIVVHLREDRRHIQDRDVRLLR 213

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  K +LN+E       +++     P+ +TLVP+   +LT++ G D L N   LT
Sbjct: 214 -----QTVKTKLNLEMANVPEIVDIAVEVVPDMVTLVPEKRKELTTEGGLDVLANAKKLT 268

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           KT+ ++   G  +SLF D +  +         GA  +EL+TG Y       +++      
Sbjct: 269 KTIDKMRKAGIPVSLFVDADAAQVQAAL--DVGATFVELHTGRYCEA-RTMEEQEQQFRL 325

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +  TA+LA +  L++NAGH L  +N    I A+PYI E+S+GHA  + A+  G++ AV  
Sbjct: 326 IEQTAELAYESGLRVNAGHGLDYRNTHP-IAALPYIEELSIGHAVISRAVLVGLENAVRE 384

Query: 242 FRRACG 247
                 
Sbjct: 385 MLTIVR 390


>gi|53720032|ref|YP_109018.1| pyridoxine 5'-phosphate synthase [Burkholderia pseudomallei K96243]
 gi|167816749|ref|ZP_02448429.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei 91]
 gi|91207226|sp|Q3V7S9|PDXJ_BURPS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|52210446|emb|CAH36429.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei K96243]
          Length = 257

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 123/255 (48%), Gaps = 9/255 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R 
Sbjct: 11  IDLGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRALRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +     K  +N+E       L++    +P    LVP+   +LT++ G D + +   +  
Sbjct: 71  RV-----KTRMNLECAVTPEMLDIACEIRPHDACLVPEKRSELTTEGGLDVVGHFDAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L + G R+SLF D +  +   +AA  TGA  IEL+TG Y    ++  +++    ++
Sbjct: 126 ACKQLADAGVRVSLFIDPDEAQI--RAAHETGAPVIELHTGRYADA-HDAAEQQREFERI 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A        + L++NAGH L   N+   I A+P I+E+++GHA  A A+  G   AV   
Sbjct: 183 ATGVDAGIALGLKVNAGHGLHYTNVQA-IAALPGIAELNIGHAIVAHAVFVGWDNAVREM 241

Query: 243 RRACGQHLDNTMRLT 257
           +          +   
Sbjct: 242 KAIMVAARVAALHGG 256


>gi|311107561|ref|YP_003980414.1| pyridoxal phosphate biosynthetic protein PdxJ [Achromobacter
           xylosoxidans A8]
 gi|310762250|gb|ADP17699.1| pyridoxal phosphate biosynthetic protein PdxJ [Achromobacter
           xylosoxidans A8]
          Length = 246

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 72/255 (28%), Positives = 122/255 (47%), Gaps = 10/255 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR +R+  +P+ V     A  +GA  +T+H R D+RHI+  D+  +R
Sbjct: 1   MIELGVNIDHVATLRQQRHTTYPDPVLAALRAEDAGADLITLHLREDRRHIQDKDVYAMR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E       L +    KP  + LVP+   +LT++ G +       ++
Sbjct: 61  PQL-----RTRMNLECAVTAEMLEIACAVKPSDVCLVPEKRTELTTEGGLEVAGAMGPVS 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V  L   G R+SLF D +  + +  A    GA  IEL+TG Y        +  +   +
Sbjct: 116 DAVGLLAEAGIRVSLFIDPDPVQIAAAA--QAGAPVIELHTGAYAEAEGEAAEAELQRLR 173

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           LA+   L     L++NAGH L   N+   + A+  I+E+++GHA  A A+  G ++AV  
Sbjct: 174 LAVAEGLRH--GLRVNAGHGLHYGNVKP-VAALDGIAELNIGHAIVAQAVFDGWEKAVRD 230

Query: 242 FRRACGQHLDNTMRL 256
            +    Q     +R 
Sbjct: 231 MKALMVQARLQALRG 245


>gi|218248739|ref|YP_002374110.1| pyridoxine 5'-phosphate synthase [Cyanothece sp. PCC 8801]
 gi|257061797|ref|YP_003139685.1| pyridoxine 5'-phosphate synthase [Cyanothece sp. PCC 8802]
 gi|218169217|gb|ACK67954.1| pyridoxal phosphate biosynthetic protein PdxJ [Cyanothece sp. PCC
           8801]
 gi|256591963|gb|ACV02850.1| pyridoxal phosphate biosynthetic protein PdxJ [Cyanothece sp. PCC
           8802]
          Length = 235

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 73/240 (30%), Positives = 122/240 (50%), Gaps = 9/240 (3%)

Query: 8   NLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQ 67
           N++ VA +R  R    P+ V    +A   GA+G+T H R D+RHI+  D+  +R     +
Sbjct: 2   NIDHVATIRQARRTVEPDPVAAAVLAELGGANGITCHLREDRRHIQDRDVKLLR-----E 56

Query: 68  FPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARL 127
             +  LN+E    E  + +    KP+ +TLVP+   ++T++ G D + N   L + V RL
Sbjct: 57  TVRTHLNLEMAATEEMVAIALNIKPDYVTLVPEKREEVTTEGGLDIVGNLERLQEIVDRL 116

Query: 128 HNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQ 187
            +    +SLF D    +   +A+  T A  IEL+TG Y    N+  +    L  L    +
Sbjct: 117 QSAEIPVSLFIDAEKRQI--EASASTQAQFIELHTGKYADAPNSVVR-HQELEALRQGCE 173

Query: 188 LAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACG 247
            A  + L++NAGH LT QN+   +  +P + E+++GH   + A+  G++ AV   + A  
Sbjct: 174 QAHSLGLRVNAGHGLTYQNV-YPVACLPRMEELNIGHTIVSRAVLVGMERAVREMKLAMK 232


>gi|68171139|ref|ZP_00544548.1| Pyridoxal phosphate biosynthetic protein PdxJ [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88657971|ref|YP_507603.1| pyridoxal phosphate biosynthetic protein PdxJ [Ehrlichia
           chaffeensis str. Arkansas]
 gi|123493052|sp|Q2GG30|PDXJ_EHRCR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|67999464|gb|EAM86104.1| Pyridoxal phosphate biosynthetic protein PdxJ [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88599428|gb|ABD44897.1| pyridoxal phosphate biosynthesis protein PdxJ [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 239

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 131/247 (53%), Gaps = 13/247 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
            ++ VN++ VA LRN RN+ +P++V +  IA+ +GA  +TVH R D+RHI+  D+  ++ 
Sbjct: 4   VALGVNIDHVATLRNARNVDYPDIVEVANIAVSNGADFITVHLREDRRHIKDDDVFRLK- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
                  K  LN+E  P +  L++  + +P+ + LVP+   +LT++ G D  +  + L  
Sbjct: 63  ----NSLKVPLNLEIAPTDEMLSIAIKVRPKCVCLVPEKRQELTTEGGLDVKRAFSYLIS 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            + +LH     ++LF + + ++     AK   AD +EL+TG Y          +  L+++
Sbjct: 119 FIEKLHTYNIDVTLFIEPDVDQIDQ--AKKLSADNVELHTGKYCNNTT-----QSELSQV 171

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A+   + ++  +AGH L  Q+   +I  +PYIS +++GH     ++  G+  +V   
Sbjct: 172 IKAAEYCYQRNIGCHAGHGLNYQSAA-IIAKVPYISALNIGHFLICESVLHGIGTSVHKM 230

Query: 243 RRACGQH 249
           ++A    
Sbjct: 231 KKAIASA 237


>gi|45658097|ref|YP_002183.1| pyridoxine 5'-phosphate synthase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|45601338|gb|AAS70820.1| pyridoxal phosphate biosynthetic protein [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
          Length = 250

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 89/252 (35%), Positives = 144/252 (57%), Gaps = 9/252 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVN+N +A LRN R    P+L++   + L++GA G+TVHPR D+RHIR  D+  +
Sbjct: 1   MKVKLSVNINKIATLRNSRGGNIPDLLYFANLVLKAGAHGITVHPREDERHIRKEDVFIL 60

Query: 61  RR----LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQN 116
           +        +     E N+EG P+  FL+L  + KP+Q TLVP  P ++TSDHG+DF ++
Sbjct: 61  KEFIDSYNRKNNTNIEYNLEGEPSPRFLDLVLKTKPDQATLVPVTPGEITSDHGFDFEKD 120

Query: 117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQ-- 174
             +L++    L     R+SLF +      +L+ A L+GAD +E YTGP+   +++  Q  
Sbjct: 121 MEILSEYSKILKKDKIRVSLFVE--TGLKNLKLASLSGADRVEFYTGPFAEAFDHSPQIG 178

Query: 175 ERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECG 234
           ++ F  +    A       + INAGHDL   N+  + + +P + E+S+GH   + ALE G
Sbjct: 179 KKRFETEYVPAATEILNQKMGINAGHDLDHNNL-KIFSQLPGLQEVSIGHRLISRALETG 237

Query: 235 VKEAVFCFRRAC 246
           + ++V  + +A 
Sbjct: 238 IDQSVKDYLQAL 249


>gi|209526719|ref|ZP_03275242.1| pyridoxal phosphate biosynthetic protein PdxJ [Arthrospira maxima
           CS-328]
 gi|209492851|gb|EDZ93183.1| pyridoxal phosphate biosynthetic protein PdxJ [Arthrospira maxima
           CS-328]
          Length = 237

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 77/246 (31%), Positives = 129/246 (52%), Gaps = 11/246 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M T + VN++ +A +R  R    P+ V    IA  +GA G+TVH R D+RHI+  D+  +
Sbjct: 1   MPT-LGVNIDHIATIRQARRTVEPDPVAAAAIAELAGADGITVHLREDRRHIQDRDVRLL 59

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R     +  +  LN+E    +  + +    KP+ ITLVP+   ++T++ G D L     +
Sbjct: 60  R-----ETVRTHLNLEMAATDEMVAIALDIKPDYITLVPERREEVTTEGGLDILGQLQRM 114

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           ++ V+ L N G  +SLF D N  +   +A+    A  IEL+TG Y        Q++  L 
Sbjct: 115 SEVVSTLQNAGIPVSLFIDPNPAQI--EASATVKAQFIELHTGCYCEA--KGVQQQKELE 170

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            LA   +LA +  L++NAGH LT  N+   +  +  + E+++GH   + A+  G+ +AV 
Sbjct: 171 ILAQGCKLALEAGLRVNAGHGLTYWNVQP-VARLEGMEELNIGHTIISRAVLVGLDKAVR 229

Query: 241 CFRRAC 246
             ++A 
Sbjct: 230 EMKQAI 235


>gi|74318101|ref|YP_315841.1| pyridoxine 5'-phosphate synthase [Thiobacillus denitrificans ATCC
           25259]
 gi|91207573|sp|Q3SH53|PDXJ_THIDA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|74057596|gb|AAZ98036.1| Pyridoxal phosphate biosynthetic protein PdxJ [Thiobacillus
           denitrificans ATCC 25259]
          Length = 246

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 81/246 (32%), Positives = 125/246 (50%), Gaps = 9/246 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MS  + VN++ +A LR  R   +P+ V     A  +GA  +T+H R D+RHI+  D+  +
Sbjct: 5   MSIYLGVNIDHIATLRQARKTRYPSPVEAALAAETAGADSITLHLREDRRHIQDADVTIL 64

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R     Q  K ++N+E    E  L +    +P  + LVP+   +LT++ G D    QA +
Sbjct: 65  R-----QTLKTKMNLEMAVTEEMLGIALETRPSDVCLVPEKREELTTEGGLDVAGQQAKM 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
               ARL + G R+SLF D +  +  L AA   GA  +E++TG Y    ++         
Sbjct: 120 RDACARLGDAGIRVSLFIDADFAQ--LDAAHAAGAPVVEIHTGHYADAASDAA-RAAEFE 176

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++       + + L +NAGH LT  N+   I A+P I E+++GHA  A AL  G KEAV 
Sbjct: 177 RIRRAVAYGRSLGLTVNAGHGLTYHNVQP-IAALPGIHELNIGHAIVAQALFVGWKEAVA 235

Query: 241 CFRRAC 246
             +R  
Sbjct: 236 EMKRLM 241


>gi|49474429|ref|YP_032471.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella quintana
           str. Toulouse]
 gi|49239933|emb|CAF26334.1| pyridoxal phosphate biosynthetic protein pdxj [Bartonella quintana
           str. Toulouse]
          Length = 244

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 129/246 (52%), Positives = 168/246 (68%), Gaps = 3/246 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  +SVNLNAVAVLRNRRNLPWPN+ +IG IAL +GA+GLTVHPRPD+RHIR+ DL +I
Sbjct: 1   MAVKLSVNLNAVAVLRNRRNLPWPNIKNIGHIALTAGAAGLTVHPRPDERHIRFADLRDI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LI+  FP AE NIEGYP++ FL+L E+Y  +QITLVPD P Q TSDHGWDF  +   L
Sbjct: 61  RCLINSTFPAAEFNIEGYPSDRFLDLAEKY-ADQITLVPDHPTQSTSDHGWDFAHDAEFL 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              + RL +   R+SLFA+   +   +  AK  GAD +E YTG YG       ++   L+
Sbjct: 120 APIIQRLKDKKIRVSLFANPLVDGLDI--AKTIGADRVEFYTGLYGNACQEKTKQGQELD 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL + A+ A+++ L +NAGHDLTI N+P LI  I ++ E+S+GH   A ALE G+ + V 
Sbjct: 178 KLTLAAKRAKELQLGVNAGHDLTISNLPALIKRISWLDEVSIGHGLIADALEYGMHKTVQ 237

Query: 241 CFRRAC 246
            F R  
Sbjct: 238 RFIRLL 243


>gi|319404478|emb|CBI78085.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 244

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 137/247 (55%), Positives = 177/247 (71%), Gaps = 3/247 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVAVLRNRRNLPWP++ +IG IAL +GA+GLTVHPRPD+RHIR+ DLP+I
Sbjct: 1   MVIKLSVNLNAVAVLRNRRNLPWPSIENIGYIALSAGAAGLTVHPRPDERHIRFVDLPKI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L++  FP AE NIEGYP++TFL+L E+Y  +QITLVPD P Q TSDHGWDF  +   L
Sbjct: 61  RFLMNNAFPNAEFNIEGYPSDTFLDLAEKY-ADQITLVPDTPDQSTSDHGWDFASSAEFL 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              + RL     R+SLFA+   +   L  AK  GAD +E YTGPYG  +++ +++   L+
Sbjct: 120 APVIQRLKAKNIRVSLFANTVLD--DLDIAKAIGADYVEFYTGPYGGAFDDEEKQTQELD 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KLA+ AQ A+++ L INAGHDLTI N+P L+N IP+I+E+S+GH   A ALE G+ E V 
Sbjct: 178 KLALAAQKARELQLHINAGHDLTIANLPALVNRIPWINEVSIGHGLIADALEYGMHETVQ 237

Query: 241 CFRRACG 247
            F R   
Sbjct: 238 RFIRLLA 244


>gi|327191455|gb|EGE58477.1| pyridoxine 5'-phosphate synthase [Rhizobium etli CNPAF512]
          Length = 250

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 148/250 (59%), Positives = 185/250 (74%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVA+LRNRR+LPWP++  +G+IAL +GASGLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPAKLSVNLNAVAMLRNRRDLPWPSVESLGRIALATGASGLTVHPRPDQRHIRFSDLPVI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP AE NIEGYP   FL+LC    PEQ+TLVPDDP Q TSDHGWDF ++QA L
Sbjct: 61  RNLIDDEFPNAEFNIEGYPTAEFLDLCAGAAPEQVTLVPDDPSQATSDHGWDFRKHQAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL  +G R+SLFADG+G+  +++  K  GAD IELYTGPYG CY+ P++    L 
Sbjct: 121 TDVVARLKTMGCRVSLFADGDGDAQAVEIVKAVGADRIELYTGPYGGCYDAPERAAPILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ALGKTADAALAIGLAVNAGHDLTVANLPALVKRIPALAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQHL 250
            F RACGQ +
Sbjct: 241 RFCRACGQKV 250


>gi|6136296|gb|AAD02936.2| PdxJ [Bradyrhizobium japonicum]
          Length = 249

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 68/254 (26%), Positives = 119/254 (46%), Gaps = 11/254 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LRN R    P+ V    +A+++GA G+T H R D+RHIR  D+  ++
Sbjct: 5   PLRLGVNVDHVATLRNARGGRNPDPVRAALLAIEAGADGITAHLREDRRHIRDEDMARLK 64

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I +      LN E    +  + +    +P  + LVP+   ++T++ G D +     L 
Sbjct: 65  AEISK-----PLNFEMAATDDMMRISLATRPHAVCLVPERRQEVTTEGGLDVVGQHNALA 119

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ--QERIFL 179
             +ARL++ G R+SLF   +  +   + A    A  IE++TG +     +    +     
Sbjct: 120 PYIARLNDAGIRVSLFIAADPAQI--EMAARLRAPVIEIHTGAWCDAVVDGHTEKADAEW 177

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++   A +A+   L+++AGH L        I A+P I E+++G+     AL  G+ E V
Sbjct: 178 KRIVAGANVAKDAGLEVHAGHGLDYAT-AETIAALPDIMELNIGYYMIGEALFVGLAETV 236

Query: 240 FCFRRACGQHLDNT 253
                A  +     
Sbjct: 237 RN-AAAMDRGRSRA 249


>gi|113971180|ref|YP_734973.1| pyridoxine 5'-phosphate synthase [Shewanella sp. MR-4]
 gi|113885864|gb|ABI39916.1| pyridoxal phosphate biosynthetic protein PdxJ [Shewanella sp. MR-4]
          Length = 245

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 77/249 (30%), Positives = 123/249 (49%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LR  R   +P+ VH   +A  +GA G+T+H R D+RHI   D+  +  
Sbjct: 4   ILLGVNIDHIATLRQARGTSYPDPVHAAAVAEHAGADGITIHLREDRRHIIDRDVYLL-- 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  K  +N E    E  LN+    KP  + LVP+   ++T++ G D       +T 
Sbjct: 62  ---AKTLKTRMNFECAVTEEMLNIACEVKPTYVCLVPEKRQEVTTEGGLDVAGQLDKITA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V+RL   G ++SLF D +  +    AA  +GA  IE++TG Y       ++E   L ++
Sbjct: 119 AVSRLAANGIQVSLFIDADKTQI--DAAVESGAPLIEIHTGCYADA-KTAEEEAKELARI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           +  A+ A    L +NAGH L   N+   I AIP + E+++GHA  A A   G+  AV   
Sbjct: 176 SEMAKYAHGKGLVVNAGHGLHYHNVKP-IAAIPELYELNIGHAIVARAAIDGLATAVKDM 234

Query: 243 RRACGQHLD 251
           +    +   
Sbjct: 235 KALMLEGRR 243


>gi|298369908|ref|ZP_06981224.1| pyridoxine 5'-phosphate synthase [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298281368|gb|EFI22857.1| pyridoxine 5'-phosphate synthase [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 242

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 79/247 (31%), Positives = 123/247 (49%), Gaps = 9/247 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ V    +A   GA  +T+H R D+RH++  D+  ++   
Sbjct: 3   LGVNIDHVATLRNARGTTYPSPVEAALVAETHGADLITLHLREDRRHMKDADVFAVK--- 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L       PE + +VP+   ++T++ G D L  Q  + + V
Sbjct: 60  --NAIRTRLNLEMALTEEMLENALNVMPEDVCIVPEKRQEITTEGGLDVLAQQDKVAQYV 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +G +   QAA   GA  IEL+TG Y     N  +    L ++  
Sbjct: 118 KTLTDAGIRVSLFIDADGGQI--QAAHEVGAPVIELHTGAYADA-PNHAERARQLARIEN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A A+  G+ EAV   + 
Sbjct: 175 GAHFAADLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQAVFLGLPEAVRQMKE 233

Query: 245 ACGQHLD 251
              +   
Sbjct: 234 TMFRARM 240


>gi|332666481|ref|YP_004449269.1| Pyridoxine 5'-phosphate synthase [Haliscomenobacter hydrossis DSM
           1100]
 gi|332335295|gb|AEE52396.1| Pyridoxine 5'-phosphate synthase [Haliscomenobacter hydrossis DSM
           1100]
          Length = 239

 Score =  238 bits (608), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 95/246 (38%), Positives = 137/246 (55%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  +SVN+N +A++RN R    P+L  I +     GA G+TVHPRPD+RH+R+ DLP + 
Sbjct: 3   SVRLSVNINKIALIRNSRGANLPDLTQIARDCEAFGAQGITVHPRPDERHVRFDDLPLL- 61

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
               +   + E NIEG P+  FL    + KP Q TLVPD P  LTSD GWD  ++   L 
Sbjct: 62  ----QATVRTEFNIEGNPDPRFLREVMQVKPHQATLVPDGPQALTSDQGWDTAKHHDFLV 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             VA+L ++G+R+S+F D       ++ AK  GAD IE YTG Y      P      + K
Sbjct: 118 DVVAQLQSVGTRVSIFVDAEERF--VEGAKRVGADRIEFYTGHY--AKVFPSNPIEAVKK 173

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+LA ++ L INAGHDL ++N+    + +  + E+S+GHA    AL  G++  +  
Sbjct: 174 HVHCAKLAVELGLGINAGHDLNLKNLSFYKDQVQGLMEVSIGHALVCDALYYGLQNTIQM 233

Query: 242 FRRACG 247
           + R   
Sbjct: 234 YLRQLN 239


>gi|167581154|ref|ZP_02374028.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           thailandensis TXDOH]
          Length = 257

 Score =  238 bits (608), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 122/255 (47%), Gaps = 9/255 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R 
Sbjct: 11  IELGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
                  K  +N+E       L++    +P    LVP+   +LT++ G D + +   +  
Sbjct: 71  -----LVKTRMNLECAVTPEMLDIACEVRPHDACLVPEKRSELTTEGGLDVVGHFDAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L + G R+SLF D +  +   +AA  TGA  IEL+TG Y    ++  +++    ++
Sbjct: 126 ACKQLADAGVRVSLFIDPDDAQI--RAAHETGAPVIELHTGRYADA-HDTAEQQREFERI 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A        + L++NAGH L   N+   I A+P I+E+++GHA  A A+  G   AV   
Sbjct: 183 ATGVDAGIALGLKVNAGHGLHYSNVQA-IAALPGIAELNIGHAIVAHAVFAGWDNAVREM 241

Query: 243 RRACGQHLDNTMRLT 257
           +          +   
Sbjct: 242 KAIMVAARVAALHGG 256


>gi|71907660|ref|YP_285247.1| pyridoxal phosphate biosynthetic protein PdxJ [Dechloromonas
           aromatica RCB]
 gi|91207230|sp|Q47EF4|PDXJ_DECAR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|71847281|gb|AAZ46777.1| pyridoxine 5'-phosphate synthase [Dechloromonas aromatica RCB]
          Length = 251

 Score =  238 bits (608), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 70/257 (27%), Positives = 126/257 (49%), Gaps = 14/257 (5%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ +A +R  R    P+ V     A   GA G+TVH R D+RHI+ +D+  +R
Sbjct: 1   MIELGVNIDHIATIRQARRTYEPDPVWGAVEAHLGGADGITVHLREDRRHIQDSDVRRLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  + +LN+E    +  + +    KPE   LVP+  H++T++ G D L  +A L 
Sbjct: 61  -----ETTQIKLNLEMAATDEMVGIACGLKPEMAMLVPEGRHEVTTEGGLDILAQEARLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI---- 177
             ++RL + G   S+F D +  +   +AA   GA   E++TGPY   + +  ++      
Sbjct: 116 GVISRLADAGIVTSVFIDADPEQI--EAAARIGASVCEIHTGPYAHAFYDKGRDAEAPAV 173

Query: 178 --FLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
              + K+    Q  + + ++ NAGH L   N+   +  +  I E+ +GHA  + A+  G+
Sbjct: 174 LAEIAKIRKAGQTIRHLGMRFNAGHALNYYNVQP-LARLAGIRELHIGHAIVSRAVFVGL 232

Query: 236 KEAVFCFRRACGQHLDN 252
           +EAV   +    +  + 
Sbjct: 233 REAVREMKVLMREAAER 249


>gi|241763853|ref|ZP_04761898.1| Pyridoxal phosphate biosynthetic protein PdxJ [Acidovorax
           delafieldii 2AN]
 gi|241366897|gb|EER61311.1| Pyridoxal phosphate biosynthetic protein PdxJ [Acidovorax
           delafieldii 2AN]
          Length = 260

 Score =  238 bits (608), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 99/244 (40%), Positives = 142/244 (58%), Gaps = 4/244 (1%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA++RN R+L  P++    ++ LQ+GA G+TVHPRPD+RHIR  D+ E+  
Sbjct: 11  TALSVNVNKVALVRNTRHLGIPSVTRAAELCLQAGAQGITVHPRPDERHIRSQDVFELAA 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+ + +P  E N+EG P++  +    + +P Q T VPD   Q TSDHGW F Q+   L  
Sbjct: 71  LM-KAWPDREYNVEGNPSQNLMEFIRQVRPHQATFVPDSEDQFTSDHGWSFPQDAERLAP 129

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VA   +LG R+SLF D    + +  AA+  GAD +ELYT P+ A +    Q+   L + 
Sbjct: 130 LVAECRSLGVRVSLFMDPVPGQMA--AARAVGADRVELYTEPFAAAWGT-PQQAAELRRY 186

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  AQ A    L +NAGHDL   N+   +  +P + E+S+GHA  A ALE G    V  +
Sbjct: 187 ADAAQAALDAGLGVNAGHDLNRDNLAAFVREVPGVLEVSIGHALIADALELGYAATVRAY 246

Query: 243 RRAC 246
               
Sbjct: 247 LACI 250


>gi|116328567|ref|YP_798287.1| pyridoxal phosphate biosynthetic protein PdxJ [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
 gi|116331296|ref|YP_801014.1| pyridoxal phosphate biosynthetic protein PdxJ [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
 gi|116121311|gb|ABJ79354.1| Pyridoxal phosphate biosynthesis protein [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116124985|gb|ABJ76256.1| Pyridoxal phosphate biosynthesis protein [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
          Length = 250

 Score =  238 bits (608), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 91/252 (36%), Positives = 141/252 (55%), Gaps = 9/252 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVN+N +A LRN R    P+L++   + L++GA G+TVHPR D+RHIR  D+  +
Sbjct: 1   MKIKLSVNINKIATLRNSRGGNIPDLLYFADLVLRAGAEGITVHPREDERHIRKDDVFSL 60

Query: 61  RRLID----EQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQN 116
           +  ID    +   K E N+EG P+  FL+L    +P+Q TLVP  P ++TSDHG+DF ++
Sbjct: 61  KEFIDSYNYKNNTKIEYNMEGEPSPRFLDLLLNIRPDQATLVPVTPGEITSDHGFDFKKD 120

Query: 117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER 176
              L +    L     R SLF +   +  +L+ A LTGAD +E YTGP+   ++   Q  
Sbjct: 121 LTTLQEYSKILKKEKIRTSLFVE--TDPENLKLASLTGADRVEFYTGPFAEKFDRSPQIG 178

Query: 177 IFLNK--LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECG 234
               +      A+      + INAGHDL   N+  + + +P + E+S+GH   + ALE G
Sbjct: 179 QECFESLYIPAAKAVLSQKMGINAGHDLDHDNL-KIFSRLPGLQEVSIGHRLISRALETG 237

Query: 235 VKEAVFCFRRAC 246
           + ++V  + +A 
Sbjct: 238 IDQSVKDYLQAL 249


>gi|83721359|ref|YP_442268.1| pyridoxine 5'-phosphate synthase [Burkholderia thailandensis E264]
 gi|167619239|ref|ZP_02387870.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           thailandensis Bt4]
 gi|257138461|ref|ZP_05586723.1| pyridoxine 5'-phosphate synthase [Burkholderia thailandensis E264]
 gi|83655184|gb|ABC39247.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           thailandensis E264]
          Length = 257

 Score =  238 bits (607), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 122/255 (47%), Gaps = 9/255 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R 
Sbjct: 11  IELGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
                  K  +N+E       L++    +P    LVP+   +LT++ G D + +   +  
Sbjct: 71  -----LVKTRMNLECAVTPEMLDIACEVRPHDACLVPEKRSELTTEGGLDVVGHFDAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L + G R+SLF D +  +   +AA  TGA  IEL+TG Y    ++  +++    ++
Sbjct: 126 ACKQLADAGVRVSLFIDPDDAQI--RAAHETGAPVIELHTGRYADA-HDTAEQQREFERI 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A        + L++NAGH L   N+   I A+P I+E+++GHA  A A+  G   AV   
Sbjct: 183 ATGVDAGIALGLKVNAGHGLHYTNVQA-IAALPGIAELNIGHAIVAHAVFAGWDNAVREM 241

Query: 243 RRACGQHLDNTMRLT 257
           +          +   
Sbjct: 242 KAIMVAARVAALHGG 256


>gi|53725348|ref|YP_102342.1| pyridoxine 5'-phosphate synthase [Burkholderia mallei ATCC 23344]
 gi|67641139|ref|ZP_00439924.1| pyridoxine 5'-phosphate synthase [Burkholderia mallei GB8 horse 4]
 gi|121599770|ref|YP_993767.1| pyridoxine 5'-phosphate synthase [Burkholderia mallei SAVP1]
 gi|124383564|ref|YP_001028767.1| pyridoxine 5'-phosphate synthase [Burkholderia mallei NCTC 10229]
 gi|126451108|ref|YP_001081325.1| pyridoxine 5'-phosphate synthase [Burkholderia mallei NCTC 10247]
 gi|134277578|ref|ZP_01764293.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei 305]
 gi|167911873|ref|ZP_02498964.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei 112]
 gi|254178205|ref|ZP_04884860.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           ATCC 10399]
 gi|254195694|ref|ZP_04902120.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei S13]
 gi|254199235|ref|ZP_04905601.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           FMH]
 gi|254205542|ref|ZP_04911894.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           JHU]
 gi|254357709|ref|ZP_04973982.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           2002721280]
 gi|91207224|sp|Q3V7M2|PDXJ_BURMA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|52428771|gb|AAU49364.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           ATCC 23344]
 gi|121228580|gb|ABM51098.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           SAVP1]
 gi|124291584|gb|ABN00853.1| pyridoxine 5'-phosphate synthase [Burkholderia mallei NCTC 10229]
 gi|126243978|gb|ABO07071.1| pyridoxine 5'-phosphate synthase [Burkholderia mallei NCTC 10247]
 gi|134251228|gb|EBA51307.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei 305]
 gi|147748831|gb|EDK55905.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           FMH]
 gi|147752985|gb|EDK60050.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           JHU]
 gi|148026836|gb|EDK84857.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           2002721280]
 gi|160699244|gb|EDP89214.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           ATCC 10399]
 gi|169652439|gb|EDS85132.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei S13]
 gi|238522004|gb|EEP85451.1| pyridoxine 5'-phosphate synthase [Burkholderia mallei GB8 horse 4]
          Length = 257

 Score =  238 bits (607), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 123/255 (48%), Gaps = 9/255 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R 
Sbjct: 11  IDLGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +     K  +N+E       L++    +P    LVP+   +LT++ G D + +   +  
Sbjct: 71  RV-----KTRMNLECAVTPEMLDIACEIRPHDACLVPEKRSELTTEGGLDVVGHFDAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L + G R+SLF D +  +   +AA  TGA  IEL+TG Y    ++  +++    ++
Sbjct: 126 ACKQLADAGVRVSLFIDPDEAQI--RAAHETGAPVIELHTGRYADA-HDAAEQQREFERI 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A        + L++NAGH L   N+   I A+P I+E+++GHA  A A+  G   AV   
Sbjct: 183 ATGVDAGIALGLKVNAGHGLHYTNVQA-IAALPGIAELNIGHAIVAHAVFVGWDNAVREM 241

Query: 243 RRACGQHLDNTMRLT 257
           +          +   
Sbjct: 242 KAIMVAARVAALHGG 256


>gi|187735701|ref|YP_001877813.1| pyridoxal phosphate biosynthetic protein PdxJ [Akkermansia
           muciniphila ATCC BAA-835]
 gi|254781557|sp|B2URE7|PDXJ_AKKM8 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|187425753|gb|ACD05032.1| pyridoxal phosphate biosynthetic protein PdxJ [Akkermansia
           muciniphila ATCC BAA-835]
          Length = 246

 Score =  238 bits (607), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 73/251 (29%), Positives = 134/251 (53%), Gaps = 16/251 (6%)

Query: 5   VSVNLNAVAVLRNRRNLP-------WPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDL 57
           + VN++ +A LR  R           P+++     A + GA  +T+H R D+RH++  D 
Sbjct: 3   LGVNIDHIATLRQARYATMLDSFNVEPSVLDAAYAAQRGGADSITLHVRGDRRHMQDADA 62

Query: 58  PEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQ 117
             +R     +     LN+E       ++   R KP+ I +VP+   ++T++ G D + ++
Sbjct: 63  LSVR-----ESVALPLNLEMGNTPEMVDFALRLKPDYICMVPEKREEITTEGGLDAVFHE 117

Query: 118 ALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI 177
             L  T+AR+ + G ++SLF D    +  ++AA   GA  IEL+TG +    ++ ++   
Sbjct: 118 KDLAPTMARMADNGIQVSLFIDPEVPQ--VEAAARLGAPMIELHTGCF--ANHSGRERTE 173

Query: 178 FLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKE 237
            L +L   A+LA  + +Q+NAGH +  QN+  L+  +PY+ E+++GH   + AL  G+++
Sbjct: 174 ELARLKRAAELAHSLGIQVNAGHGINYQNLEQLLAGVPYLHELNIGHTIVSRALFVGMEQ 233

Query: 238 AVFCFRRACGQ 248
           AV   R+A  +
Sbjct: 234 AVREMRQAIDR 244


>gi|56552604|ref|YP_163443.1| pyridoxine 5'-phosphate synthase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|81598160|sp|Q5NLS8|PDXJ_ZYMMO RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|56544178|gb|AAV90332.1| pyridoxal phosphate biosynthetic protein PdxJ [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 256

 Score =  238 bits (607), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 74/248 (29%), Positives = 126/248 (50%), Gaps = 10/248 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA +RN R    P+ V   ++A  +GA G+T H R D+RHI   DL  +  
Sbjct: 5   IRLGVNIDHVATIRNARGGIHPDPVRAAQLAAHAGADGITTHLREDRRHISDDDLINL-- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
              E+     LN+E    E  L +  +++P  + LVP+   + T++ G D       L  
Sbjct: 63  ---EKGITLPLNLEMAATEEMLEIALQHRPHAVCLVPEKREEQTTEGGLDAAGQIDSLKP 119

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VA+L   G R+SLF + +  +   +AAK   A  IEL+TG Y    N   +    L ++
Sbjct: 120 IVAKLLAAGIRVSLFIEPDETQI--RAAKALNAPVIELHTGHYANSVNE--ELAAELIRI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A+LA+ ++++++AGH LT +N+   I A+  I+E+++GH     A+  G++ ++   
Sbjct: 176 EQAAKLAKSLNIEVHAGHGLTYENVIP-IAALEEIAELNIGHFLIGEAIFIGLEASIKRM 234

Query: 243 RRACGQHL 250
           R       
Sbjct: 235 RYLMDAAR 242


>gi|78223092|ref|YP_384839.1| pyridoxine 5'-phosphate synthase [Geobacter metallireducens GS-15]
 gi|91207235|sp|Q39UG0|PDXJ_GEOMG RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|78194347|gb|ABB32114.1| pyridoxine 5'-phosphate synthase [Geobacter metallireducens GS-15]
          Length = 239

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 75/246 (30%), Positives = 124/246 (50%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +R  R    P+ V    +A  +GA G+T+H R D+RHI+  DL  +R
Sbjct: 1   MAKLGVNIDHVATIRQARGGVEPDPVAAAALAELAGADGITIHLREDRRHIQDRDLKLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  K +LN+E       + +    KP+  TLVP+   +LT++ G D       + 
Sbjct: 61  -----QTVKTKLNLEMAATAEMVAIALSVKPDMCTLVPEKRQELTTEGGLDVRIAMQGIA 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V RL N G  +SLF D + ++  ++A+   G+D IE++TG +     + + E+  L +
Sbjct: 116 EAVERLQNGGIAVSLFVDPDPDQ--VKASSKVGSDYIEIHTGAFADA-KDWKSEQDELER 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +    +L  K+ L INAGH L   NI   + A+  I E ++GH+  + A+  G+  AV  
Sbjct: 173 IGNAIKLGAKLGLGINAGHGLNYTNIRK-VAALGGIEEYNIGHSIISRAVLVGLDRAVRD 231

Query: 242 FRRACG 247
                 
Sbjct: 232 MVDLIK 237


>gi|325295099|ref|YP_004281613.1| Pyridoxine 5'-phosphate synthase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065547|gb|ADY73554.1| Pyridoxine 5'-phosphate synthase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 244

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 81/247 (32%), Positives = 136/247 (55%), Gaps = 10/247 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA +RN R    P+ VH   IA  +GA  +T+H R D+RH+   DL  I+ 
Sbjct: 5   IRLGVNIDHVATVRNARRTFEPDPVHAAVIADLAGADQITLHVREDRRHVNERDLKLIK- 63

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +   + +N+E    E  ++L  + KP Q+TLVP+   ++T++ G D    +  + +
Sbjct: 64  ----EVIHSRVNLEMAATEEMVSLAIQVKPHQVTLVPEKREEITTEGGLDVAGQKEKIEE 119

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYN--NPQQERIFLN 180
           TV RL + G  ++LF D +  +   +AAK   AD +EL+TG Y   +N    ++ +  + 
Sbjct: 120 TVKRLKSAGIVVNLFIDPDEEQI--RAAKEVNADAVELHTGRYAEAFNEKKEKEIKEEIE 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +L   A+L +++ L++ AGH LT +N+   I  IP I E+++GH+  A A+  G+KEAV 
Sbjct: 178 RLKRAAKLGKELGLKVYAGHGLTYKNVKP-IADIPEIEELNIGHSIVANAVLKGLKEAVQ 236

Query: 241 CFRRACG 247
              R   
Sbjct: 237 EMIRIIN 243


>gi|76809280|ref|YP_334273.1| pyridoxine 5'-phosphate synthase [Burkholderia pseudomallei 1710b]
 gi|126455453|ref|YP_001067084.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei 1106a]
 gi|167720555|ref|ZP_02403791.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei DM98]
 gi|167739548|ref|ZP_02412322.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei 14]
 gi|167825156|ref|ZP_02456627.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei 9]
 gi|167846653|ref|ZP_02472161.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei B7210]
 gi|167903624|ref|ZP_02490829.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei NCTC 13177]
 gi|167919870|ref|ZP_02506961.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei BCC215]
 gi|217420613|ref|ZP_03452118.1| pyridoxine 5'-phosphate synthase [Burkholderia pseudomallei 576]
 gi|226199897|ref|ZP_03795447.1| pyridoxine 5'-phosphate synthase [Burkholderia pseudomallei
           Pakistan 9]
 gi|237813192|ref|YP_002897643.1| pyridoxine 5'-phosphate synthase [Burkholderia pseudomallei
           MSHR346]
 gi|242315043|ref|ZP_04814059.1| pyridoxine 5'-phosphate synthase [Burkholderia pseudomallei 1106b]
 gi|254184213|ref|ZP_04890803.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei 1655]
 gi|254191248|ref|ZP_04897752.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254259566|ref|ZP_04950620.1| pyridoxine 5'-phosphate synthase [Burkholderia pseudomallei 1710a]
 gi|254296874|ref|ZP_04964327.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei 406e]
 gi|91207225|sp|Q3JQ80|PDXJ_BURP1 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|76578733|gb|ABA48208.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei 1710b]
 gi|126229095|gb|ABN92635.1| pyridoxine 5'-phosphate synthase [Burkholderia pseudomallei 1106a]
 gi|157807615|gb|EDO84785.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei 406e]
 gi|157938920|gb|EDO94590.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei Pasteur 52237]
 gi|184214744|gb|EDU11787.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei 1655]
 gi|217396025|gb|EEC36042.1| pyridoxine 5'-phosphate synthase [Burkholderia pseudomallei 576]
 gi|225927953|gb|EEH23990.1| pyridoxine 5'-phosphate synthase [Burkholderia pseudomallei
           Pakistan 9]
 gi|237504347|gb|ACQ96665.1| pyridoxine 5'-phosphate synthase [Burkholderia pseudomallei
           MSHR346]
 gi|242138282|gb|EES24684.1| pyridoxine 5'-phosphate synthase [Burkholderia pseudomallei 1106b]
 gi|254218255|gb|EET07639.1| pyridoxine 5'-phosphate synthase [Burkholderia pseudomallei 1710a]
          Length = 257

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 123/255 (48%), Gaps = 9/255 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R 
Sbjct: 11  IDLGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +     K  +N+E       L++    +P    LVP+   +LT++ G D + +   +  
Sbjct: 71  RV-----KTRMNLECAVTPEMLDIACEIRPHDACLVPEKRSELTTEGGLDVVGHFDAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L + G R+SLF D +  +   +AA  TGA  IEL+TG Y    ++  +++    ++
Sbjct: 126 ACKQLADAGVRVSLFIDPDEAQI--RAAHETGAPVIELHTGRYADA-HDAAEQQREFERI 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A        + L++NAGH L   N+   I A+P I+E+++GHA  A A+  G   AV   
Sbjct: 183 ATGVDAGIALGLKVNAGHGLHYTNVQA-IAALPGIAELNIGHAIVAHAVFVGWDNAVREM 241

Query: 243 RRACGQHLDNTMRLT 257
           +          +   
Sbjct: 242 KAIMVAARVAALHGG 256


>gi|221068685|ref|ZP_03544790.1| Pyridoxal phosphate biosynthetic protein PdxJ [Comamonas
           testosteroni KF-1]
 gi|220713708|gb|EED69076.1| Pyridoxal phosphate biosynthetic protein PdxJ [Comamonas
           testosteroni KF-1]
          Length = 257

 Score =  238 bits (607), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 100/248 (40%), Positives = 144/248 (58%), Gaps = 4/248 (1%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA+LRN R+L  P++    +I L++GA G+T+HPRPD+RHIR  D+ E+  
Sbjct: 9   TALSVNVNKVALLRNTRHLGIPSVTRAAQICLEAGAQGITIHPRPDERHIRAQDVFEL-H 67

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +   +P+AE NIEG P +  ++   + +P Q T VPD   Q TSDHGW F Q+   L  
Sbjct: 68  DLLRNWPEAEFNIEGNPTQNLMDFIRQTRPHQATFVPDSEDQFTSDHGWSFPQDAERLQP 127

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A    LG R+SLF D    + +  AA+  GAD +ELYT P+ A      ++   L   
Sbjct: 128 LIAECKALGVRVSLFMDPIPEQMA--AARAVGADRVELYTEPF-AANWGKAEQEQQLQTY 184

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  AQ A +  L INAGHDL   N+   +  +P ++E+S+GHA  A ALE G  E V  +
Sbjct: 185 ARAAQAALEAGLGINAGHDLNRDNLAAFVARVPGLAEVSIGHALIADALELGYAETVKAY 244

Query: 243 RRACGQHL 250
           +      +
Sbjct: 245 QACIDAGM 252


>gi|284006742|emb|CBA71999.1| pyridoxal phosphate biosynthetic protein [Arsenophonus nasoniae]
          Length = 228

 Score =  237 bits (606), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 74/235 (31%), Positives = 117/235 (49%), Gaps = 9/235 (3%)

Query: 16  RNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNI 75
           RN R   +P+ VH   +A Q+GA G+TVH R D+RHI   D+  +R     Q  +  +N+
Sbjct: 2   RNARGTQYPDPVHAAFLAEQAGADGITVHLREDRRHITDRDVQLLR-----QTLQTRMNL 56

Query: 76  EGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRIS 135
           E    +  +N     KP+   LVP+   ++T++ G D    QAL+   V +L   G  +S
Sbjct: 57  EMAITDEMVNFACLIKPQFCCLVPERREEVTTEGGLDVFGQQALVATAVKQLAKAGITVS 116

Query: 136 LFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQ 195
           LF D   N+  + AA   GA  IE++TG Y     +  ++     ++      A   +L+
Sbjct: 117 LFIDP--NDKQIDAAVEIGAPFIEIHTGAYANA-KSQLKQEEEFKRIKQAVSHATAKNLK 173

Query: 196 INAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQHL 250
           +NAGH LT  N+   I  +P I E+++GHA    AL  G+  AV   ++   +  
Sbjct: 174 VNAGHGLTYHNVQP-IAQLPDIYELNIGHAIIGRALFSGMAAAVSDMKKILREAR 227


>gi|319405977|emb|CBI79609.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella sp. AR
           15-3]
          Length = 244

 Score =  237 bits (606), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 134/246 (54%), Positives = 172/246 (69%), Gaps = 3/246 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVAVLRNRRNLPWP+L  IG IAL +GA+GLTVHPRPD+RHIR+ DLP+I
Sbjct: 1   MPIKLSVNLNAVAVLRNRRNLPWPSLEKIGYIALSAGAAGLTVHPRPDERHIRFVDLPKI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L++  FP AE NIEGYP++TFL+L E+Y  +QITLVPD P Q TSDHGWDF  +   L
Sbjct: 61  RFLMNNAFPSAEFNIEGYPSDTFLDLAEKY-ADQITLVPDSPDQSTSDHGWDFASSAEFL 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              + RL     R+SLFA+   +   L   K  GAD +E YTG YG  +++ +++   LN
Sbjct: 120 APIIQRLKAKNIRVSLFANTVLD--DLDIVKAIGADRVEFYTGAYGGAFDDEEKQTQELN 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL + AQ A+++ L +NAGHDLTI N+P L+N IP+I E+S+GH   A ALE G+  AV 
Sbjct: 178 KLILAAQKARQLQLNVNAGHDLTIANLPTLVNRIPWIHEVSIGHGLIADALEYGMHGAVQ 237

Query: 241 CFRRAC 246
            F +  
Sbjct: 238 RFIQLL 243


>gi|85712957|ref|ZP_01043996.1| pyridoxal phosphate biosynthetic protein [Idiomarina baltica OS145]
 gi|85693195|gb|EAQ31154.1| pyridoxal phosphate biosynthetic protein [Idiomarina baltica OS145]
          Length = 242

 Score =  237 bits (606), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 77/248 (31%), Positives = 118/248 (47%), Gaps = 9/248 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA +RN R + +P+ V    IA Q+GA G+T+H R D+RHI   D+  +R 
Sbjct: 4   IRLGVNIDHVATVRNARGVSYPDPVTAAAIAEQAGADGITIHLREDRRHITDRDVAMLR- 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               Q     +N+E    +  + +    +P    LVP+   +LT++ G D +  Q  +  
Sbjct: 63  ----QTLNVPMNLEMACTDEMIGIAIDTQPTYSCLVPEKREELTTEGGLDVVGQQQRIAA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V +L + G  +SLF D N  +    AAK  GA  +EL+TG Y        Q       L
Sbjct: 119 AVKQLADAGILVSLFIDPNHAQI--DAAKACGAPIVELHTGAYAEA-ETHAQREHEFQLL 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A  A K  LQ+N GH L   N    I  IP + E+++GH+  A A+  G+  AV   
Sbjct: 176 KEAATYADKQGLQVNVGHGLHYHNTLE-IAQIPQVVELNIGHSIIARAVLVGLDRAVRDM 234

Query: 243 RRACGQHL 250
           +    +  
Sbjct: 235 KAILERAR 242


>gi|304392149|ref|ZP_07374091.1| pyridoxine 5'-phosphate synthase [Ahrensia sp. R2A130]
 gi|303296378|gb|EFL90736.1| pyridoxine 5'-phosphate synthase [Ahrensia sp. R2A130]
          Length = 246

 Score =  237 bits (606), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 139/248 (56%), Positives = 180/248 (72%), Gaps = 2/248 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+ ++SVNLNAVA LRNRR+LPWP++V IG+IAL++GA GLTVHPRPD+RHIR++DLP++
Sbjct: 1   MAVALSVNLNAVAQLRNRRDLPWPSVVGIGRIALENGAHGLTVHPRPDERHIRFSDLPDL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FPKAE NIEGYP + FL+LC+   PEQ+TLVPDDP Q TSDHGWDF  N  +L
Sbjct: 61  RALIDDEFPKAEFNIEGYPTDDFLDLCDTNAPEQVTLVPDDPSQATSDHGWDFKANHNML 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              VARL + G R++LFAD   +   ++ A  TGAD IELYTGPY A Y++P      L+
Sbjct: 121 APIVARLKSSGFRVALFADA--DPEGVKWAADTGADRIELYTGPYAATYDSPSAAERELD 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A+++ L  +AGHDLT+ N+P L+  IP + E+S+GH   A ALE G+   V 
Sbjct: 179 ALQATADAAREVGLGTHAGHDLTVANLPPLVARIPDLFEVSIGHGLTADALEFGMSATVK 238

Query: 241 CFRRACGQ 248
            F  ACG 
Sbjct: 239 RFLSACGH 246


>gi|217970710|ref|YP_002355944.1| pyridoxine 5'-phosphate synthase [Thauera sp. MZ1T]
 gi|217508037|gb|ACK55048.1| pyridoxal phosphate biosynthetic protein PdxJ [Thauera sp. MZ1T]
          Length = 250

 Score =  237 bits (606), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 70/258 (27%), Positives = 123/258 (47%), Gaps = 14/258 (5%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR  R    P+ V     A   GA G+T+H R D+RHI   D+  + 
Sbjct: 1   MIELGVNIDHVATLRQARRTWEPDPVWAAVEAHLGGADGITIHLREDRRHIGDEDVRRL- 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  + +LN+E    +  + +  R KP+   LVP+  H++T++ G D L  +  L 
Sbjct: 60  ----AELTQVKLNLEMAATDEMVAIACRTKPQMAMLVPEGRHEITTEGGLDVLAQETRLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI---- 177
             +ARL + G   S+F D    +   +AA   GA   E++TGPY   ++   ++      
Sbjct: 116 DVIARLADAGIVTSVFIDAEPEQI--EAAARIGARVCEIHTGPYAHAFHAAGRDAEAPAV 173

Query: 178 --FLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
              L+K+    ++ + + ++ NAGH L   N+   I  +  I E+ +GH+  + A+  G+
Sbjct: 174 LAELDKIRTAGEVVRSLGMRFNAGHALNYYNVEP-IARLHGIRELHIGHSIVSRAVFVGL 232

Query: 236 KEAVFCFRRACGQHLDNT 253
           + AV   +R   +     
Sbjct: 233 RAAVAEMKRLMREAAQGA 250


>gi|182412009|ref|YP_001817075.1| pyridoxine 5'-phosphate synthase [Opitutus terrae PB90-1]
 gi|238692905|sp|B1ZNA6|PDXJ_OPITP RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|177839223|gb|ACB73475.1| pyridoxal phosphate biosynthetic protein PdxJ [Opitutus terrae
           PB90-1]
          Length = 248

 Score =  237 bits (606), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 71/255 (27%), Positives = 120/255 (47%), Gaps = 17/255 (6%)

Query: 2   STSVSVNLNAVAVLRNRR---------NLPWPNLVHIGKIALQSGASGLTVHPRPDQRHI 52
              + VN++  A LR  R             P+ V +   A ++GA G+TVH R D+RHI
Sbjct: 1   MILLGVNIDHCATLRQARYRQAEATAGGPIEPDPVTLALAAERAGADGITVHLREDRRHI 60

Query: 53  RYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWD 112
           +  D+  +R     +     LN E         L  + KPE + LVP++  ++T++ G D
Sbjct: 61  QERDVWRLR-----ESIATRLNFEMACTPAMTQLALKLKPESVCLVPENRQEITTEGGLD 115

Query: 113 FLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNP 172
               +  +   V  ++  G + SLF D +  +   + A    A C+EL+TG Y + Y  P
Sbjct: 116 VTAQRDRVRACVEAMNAAGIQASLFIDPDEQQI--ELAAQLHAPCVELHTGAYASSYPQP 173

Query: 173 QQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALE 232
                   +L + A  A ++ L +NAGH +   NI   +  +P++ E+++GH+  + AL 
Sbjct: 174 TSRTKEFQRLRMGAARAHELGLIVNAGHGINYVNIAE-VRTLPHLHELNIGHSIISRALF 232

Query: 233 CGVKEAVFCFRRACG 247
            G+ EAV   +    
Sbjct: 233 TGIDEAVREMKVRMN 247


>gi|167043778|gb|ABZ08469.1| putative Pyridoxal phosphate biosynthesis protein PdxJ [uncultured
           marine microorganism HF4000_APKG3D20]
          Length = 250

 Score =  237 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 63/255 (24%), Positives = 114/255 (44%), Gaps = 17/255 (6%)

Query: 2   STSVSVNLNAVAVLRNRR---------NLPWPNLVHIGKIALQSGASGLTVHPRPDQRHI 52
              + VN++  A +R  R             P+   I   A  +GA G+T+H R D+RH+
Sbjct: 1   MILLGVNVDHAATVRQARYRDEPNTFGGFVEPDPAEIAWRAEDAGADGITMHVREDRRHM 60

Query: 53  RYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWD 112
           +  D+         +  +  LN+E    E  +    R KP+ + LVP+   ++T++ G D
Sbjct: 61  QTDDVER-----YLESKRTRLNLEMSWAEEMVEYALRIKPDSVCLVPEHREEVTTEGGLD 115

Query: 113 FLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNP 172
              N     +    L   G  +S+F D   ++  L+A+   GA  +EL+TG +   + + 
Sbjct: 116 VAGNLEKAKEVTTVLVEAGIPVSMFIDPENSQ--LEASAEVGAPWVELHTGNFARAWFDE 173

Query: 173 QQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALE 232
                 +  L    +L   + L++NAGH +   N+ +    +  + E ++GH+  + AL 
Sbjct: 174 AARAREMAALREGMELGIHLGLRVNAGHGINYLNVADA-CTLEQVYEFNIGHSIISRALF 232

Query: 233 CGVKEAVFCFRRACG 247
            G++EAV   R    
Sbjct: 233 SGIEEAVSTMRSLLN 247


>gi|84684012|ref|ZP_01011914.1| pyridoxal phosphate biosynthetic protein PdxJ [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667765|gb|EAQ14233.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodobacterales
           bacterium HTCC2654]
          Length = 247

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 67/251 (26%), Positives = 122/251 (48%), Gaps = 10/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +RN R   +P+ V   K+A  +GA G+T H R D+RHI   D+  + 
Sbjct: 4   KLRLGVNIDHVATVRNARGSAYPDPVRAAKLAEAAGADGITAHLREDRRHIGDGDIERLA 63

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +        LN E    +    +  R+KP  + +VP+   + T++ G +  +++  L 
Sbjct: 64  AELT-----VPLNFEMAATDEMQAIALRHKPHAVCIVPEKREERTTEGGLEVAKDENRLA 118

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFL 179
             +A L + G R+S+F   +  +   +AA   GA  +EL+TG Y   +      +    L
Sbjct: 119 HFIAPLADAGCRVSIFIAADRAQI--EAAHRIGAAVVELHTGAYCDFHYEGKFSERDAEL 176

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            +L   A  A  + L+++AGH LT + +   + A P + E+++GH     A+  G++ ++
Sbjct: 177 ERLRDMAAFAHSLGLEVHAGHGLTYETVGP-VAAFPEVRELNIGHFLIGEAIFLGLEASI 235

Query: 240 FCFRRACGQHL 250
              RR   +  
Sbjct: 236 AEMRRLMDEAR 246


>gi|258592309|emb|CBE68618.1| pyridoxal phosphate biosynthetic protein PdxJ (PNP synthase) [NC10
           bacterium 'Dutch sediment']
          Length = 242

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 82/251 (32%), Positives = 129/251 (51%), Gaps = 9/251 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ +A +R  R    P+ V     A  +GASG+TVH R D+RHI+  D+  +R
Sbjct: 1   MVGLCVNVDHIATIRQSRRGVEPDPVQAALFAESAGASGITVHLREDRRHIQDRDVELLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  K +LN+E    E  + +    KPE  TLVP+   +LT++ G D   +   + 
Sbjct: 61  -----RLVKTKLNLEMAVTEEMIEIALALKPEMATLVPERREELTTEGGLDVHGHIDDVG 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V RL   G  +SLF D   ++ +  A    GAD +EL+TG Y        QE   L +
Sbjct: 116 RAVRRLREGGIAVSLFIDPEHHQVAAAA--RAGADFVELHTGSYAEAKGRKAQE-SELTR 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L  +    +++DL+INAGH L  +N+ + I AIP + E+S+GH+  A A+  G++ A+  
Sbjct: 173 LIQSVTAGRELDLRINAGHGLDYRNVGS-IAAIPEVEELSIGHSIIARAVLVGMERAIRE 231

Query: 242 FRRACGQHLDN 252
              A G     
Sbjct: 232 MLAAMGADRAR 242


>gi|167586636|ref|ZP_02379024.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           ubonensis Bu]
          Length = 257

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 120/255 (47%), Gaps = 9/255 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ V     A ++GA  +T+H R D+RHI   D+ ++R 
Sbjct: 11  IDLGVNIDHVATLRNARGTSYPDPVRAALAAEEAGADAITLHLREDRRHIVDADVRKLRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
                  K  +N+E       L++    KP    LVP+   +LT++ G D       +  
Sbjct: 71  -----LLKTRMNLECAVTAEMLDIACEVKPHDACLVPEKREELTTEGGLDVAGRFEAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L + G R+SLF D +  +   +AA   GA  IEL+TG Y    ++  +++    ++
Sbjct: 126 ACRQLADAGVRVSLFIDPDETQI--RAAHEAGAPVIELHTGRYADA-HDAAEQQREYERI 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               Q   ++ L++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV   
Sbjct: 183 VAGVQAGAQLGLKVNAGHGLHYTNVQQ-IAAIDGIVELNIGHAIVAHAIFAGWDNAVREM 241

Query: 243 RRACGQHLDNTMRLT 257
           +          +   
Sbjct: 242 KAIMVAARVAALHGA 256


>gi|119897936|ref|YP_933149.1| pyridoxine 5'-phosphate synthase [Azoarcus sp. BH72]
 gi|166219082|sp|A1K607|PDXJ_AZOSB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|119670349|emb|CAL94262.1| pyridoxine biosynthesis [Azoarcus sp. BH72]
          Length = 249

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 73/254 (28%), Positives = 122/254 (48%), Gaps = 14/254 (5%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA LR  R    P+       A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MIELGVNIDHVATLRQARRTWEPDPTWAAVEAHLGGADGITVHLREDRRHIQDDDVRRLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                +  + +LN+E    +  + +    KPE   LVP+  H++T++ G D +  +A L 
Sbjct: 61  -----ELTQIKLNLEMAATDEMVGIARSIKPEMAMLVPEGRHEVTTEGGLDIVSQEARLK 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI---- 177
             +ARL + G   S+F D    +    AA   GA   E++TGPY   ++   ++      
Sbjct: 116 DVIARLADAGIVTSVFIDAEIAQI--DAAARIGARVCEIHTGPYAHAFHAQGRDAESPAV 173

Query: 178 --FLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
              ++K+    +      ++ NAGH L   N+   I  +P I E+ +GHA  + A+  G+
Sbjct: 174 LAEIDKIRRAGEAICSHGMRFNAGHALNYYNVQP-IARLPGIRELHIGHAIVSRAVFSGI 232

Query: 236 KEAVFCFRRACGQH 249
           +EAV   +R   + 
Sbjct: 233 REAVAEMKRLMREA 246


>gi|222056500|ref|YP_002538862.1| pyridoxal phosphate biosynthetic protein PdxJ [Geobacter sp.
           FRC-32]
 gi|254781562|sp|B9M5K2|PDXJ_GEOSF RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|221565789|gb|ACM21761.1| pyridoxal phosphate biosynthetic protein PdxJ [Geobacter sp.
           FRC-32]
          Length = 239

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 77/246 (31%), Positives = 127/246 (51%), Gaps = 9/246 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +R  R    P+ V    IA  +GA G+T+H R D+RHI+  DL  +R
Sbjct: 1   MARLGVNIDHVATIRQARGGAEPDPVAAAAIAELAGADGITIHLREDRRHIQDRDLRLLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                Q  K  LN+E    +  +++    KP+  TLVP+   +LT++ G D   +   + 
Sbjct: 61  -----QTIKTRLNLEMAATDEMVSIALSVKPDMCTLVPEKRQELTTEGGLDVRLHLDAIR 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V +L + G  +SLF D + ++   +AA  +GAD IE++TG +    ++ + E+  L K
Sbjct: 116 GAVQKLQDGGLIVSLFIDPDTDQI--KAADKSGADYIEIHTGAFAEA-SDWKAEQEELKK 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +    +LA K+ L +NAGH L   NI   + A+  I E ++GH+  + A+  G+  AV  
Sbjct: 173 IENAIKLAGKLGLGVNAGHGLNYSNIRK-VAALGGIEEYNIGHSIISKAVLVGLDRAVRD 231

Query: 242 FRRACG 247
                 
Sbjct: 232 MVDLVK 237


>gi|114048418|ref|YP_738968.1| pyridoxine 5'-phosphate synthase [Shewanella sp. MR-7]
 gi|113889860|gb|ABI43911.1| pyridoxal phosphate biosynthetic protein PdxJ [Shewanella sp. MR-7]
          Length = 245

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 77/249 (30%), Positives = 123/249 (49%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LR  R   +P+ VH   +A  +GA G+T+H R D+RHI   D+  +  
Sbjct: 4   ILLGVNIDHIATLRQARGTSYPDPVHAAAVAEHAGADGITIHLREDRRHIIDRDVYLL-- 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  K  +N E    E  LN+    KP  + LVP+   ++T++ G D       +T 
Sbjct: 62  ---AKTLKTRMNFECAVTEEMLNIACEVKPTYVCLVPEKRQEVTTEGGLDVAGQLDKITV 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V+RL   G ++SLF D +  +    AA  +GA  IE++TG Y       ++E   L ++
Sbjct: 119 AVSRLAANGIQVSLFIDADKTQI--DAAVASGAPLIEIHTGCYADA-KTAEEEAKELARI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           +  A+ A    L +NAGH L   N+   I AIP + E+++GHA  A A   G+  AV   
Sbjct: 176 SEMAKYAHGKGLVVNAGHGLHYHNVKP-IAAIPELYELNIGHAIVARAAIDGLATAVKDM 234

Query: 243 RRACGQHLD 251
           +    +   
Sbjct: 235 KALMLEGRR 243


>gi|167837344|ref|ZP_02464227.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           thailandensis MSMB43]
          Length = 257

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 122/255 (47%), Gaps = 9/255 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R 
Sbjct: 11  IELGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
                  K  +N+E       L++    +P    LVP+   +LT++ G D + +   +  
Sbjct: 71  -----LVKTRMNLECAVTPEMLDIACEIRPHDACLVPEKRSELTTEGGLDVVGHFDAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L + G R+SLF D +  +   +AA  TGA  IEL+TG Y    ++  +++    ++
Sbjct: 126 ACKQLADAGVRVSLFIDPDDAQI--RAAHETGAPVIELHTGRYADA-HDAAEQQREFERI 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A        + L++NAGH L   N+   I A+P I+E+++GHA  A A+  G   AV   
Sbjct: 183 ATGVDAGIALGLKVNAGHGLHYTNVQA-IAALPGIAELNIGHAIVAHAVFAGWDNAVREM 241

Query: 243 RRACGQHLDNTMRLT 257
           +          +   
Sbjct: 242 KAIMVAARVAALHGG 256


>gi|217977178|ref|YP_002361325.1| pyridoxine 5'-phosphate synthase [Methylocella silvestris BL2]
 gi|217502554|gb|ACK49963.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylocella
           silvestris BL2]
          Length = 259

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 74/257 (28%), Positives = 125/257 (48%), Gaps = 10/257 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA LRN R   +P+ V    +A+ +GA G+T H R D+RHIR  D+  ++R 
Sbjct: 7   RLGVNVDHVATLRNARGAVFPDPVRAALVAIAAGADGITAHLREDRRHIRDEDMARLKRE 66

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I        LN E       + +    +P    LVP+   + T++ G + L     L   
Sbjct: 67  IS-----VPLNFEMAATNEMVAIAIATRPHACCLVPERRSERTTEGGLNVLDGHDHLKLV 121

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGA--CYNNPQQERIFLNK 181
            A L   G R+SLF +   +  +++AA+  GA  +EL+TG +     +   ++      +
Sbjct: 122 TAELGKAGVRVSLFIEPGKS--AVEAAESIGAPVVELHTGSWCDALAHGEKERAAQEFIR 179

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A LA+K+ L+ +AGH L        I+A+P I+E+++GH   + A+  G+ EA+  
Sbjct: 180 IQAAATLAEKLGLECHAGHGLDFATAAT-ISALPQIAELNIGHFLVSEAIFIGLPEAIRT 238

Query: 242 FRRACGQHLDNTMRLTH 258
            R A         +  H
Sbjct: 239 MREAIAAGRAKARQGAH 255


>gi|268315827|ref|YP_003289546.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodothermus marinus
           DSM 4252]
 gi|262333361|gb|ACY47158.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodothermus marinus
           DSM 4252]
          Length = 245

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 76/246 (30%), Positives = 130/246 (52%), Gaps = 9/246 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T + VN++ VA LRN R   +P+ V    +   +GA G+  H R D+RHI   D+  ++ 
Sbjct: 6   TRLLVNIDHVATLRNARRETFPDPVQAAVLCELAGADGIVFHLREDRRHITDRDVFRLK- 64

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  + +L+ E   NE  +++C + +P   TLVP+   ++T++ G D L N+A L +
Sbjct: 65  ----EVVQGKLDFELSTNEEIVSICCQVRPHLATLVPERREEITTEGGLDVLANRARLQQ 120

Query: 123 TVARLHNLGS-RISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
            + RL + G   ++LF D +  +   +AA+  GA+ IEL+TG +        +       
Sbjct: 121 VIPRLFDAGIEEVALFVDPDPRQI--EAAREVGANAIELHTGDFANAPTEAARRAEAEKL 178

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
            A  A++A ++ LQ++AGH L   N P     +P++ E+S+G A  A A+  G++ AV  
Sbjct: 179 -AAAARVAHELGLQVHAGHGLDYHNYPLFRETVPHVHEVSIGFAIIARAVLVGLETAVRE 237

Query: 242 FRRACG 247
            RR   
Sbjct: 238 MRRLVK 243


>gi|160874400|ref|YP_001553716.1| pyridoxine 5'-phosphate synthase [Shewanella baltica OS195]
 gi|160859922|gb|ABX48456.1| pyridoxal phosphate biosynthetic protein PdxJ [Shewanella baltica
           OS195]
 gi|315266635|gb|ADT93488.1| pyridoxal phosphate biosynthetic protein PdxJ [Shewanella baltica
           OS678]
          Length = 245

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 77/249 (30%), Positives = 121/249 (48%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LR  R   +P+ VH   +A  +GA G+T+H R D+RHI   D+  +  
Sbjct: 4   ILLGVNIDHIATLRQARGTSYPDPVHAAAVAEHAGADGITIHLREDRRHIIDRDVYLL-- 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  K  +N E    E  LN+    KP  + LVP+   ++T++ G D       +T 
Sbjct: 62  ---AKTLKTRMNFECAVTEEMLNIACEIKPTYVCLVPEKRQEVTTEGGLDVAGQLDKITS 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL   G ++SLF D +  +    AA  +GA  IE++TG Y        +E   L ++
Sbjct: 119 AVTRLAAEGIQVSLFIDADKTQI--DAAVASGAPLIEIHTGCYADAKTE-AEEATELARI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           +  A+ A    L +NAGH L   N+   I AIP + E+++GHA  A A   G+  AV   
Sbjct: 176 SEMAKYAHGKGLVVNAGHGLHYHNVKP-IAAIPELYELNIGHAIVARAAIDGLATAVKDM 234

Query: 243 RRACGQHLD 251
           +    +   
Sbjct: 235 KVLMLEGRR 243


>gi|170699584|ref|ZP_02890624.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           ambifaria IOP40-10]
 gi|170135535|gb|EDT03823.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           ambifaria IOP40-10]
          Length = 258

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 70/255 (27%), Positives = 120/255 (47%), Gaps = 9/255 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ +     A ++GA  +T+H R D+RHI   D+ ++R 
Sbjct: 11  IDLGVNIDHVATLRNARGTAYPDPIRAALAAEEAGADVITLHLREDRRHIVDADVRKLRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
                  K  +N+E       L++    +P    LVP+   +LT++ G D       +  
Sbjct: 71  -----LLKTRMNLECAVTAEMLDIACEVRPHDACLVPEKREELTTEGGLDVAGRFEAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L + G R+SLF D +  +   +AA   GA  +EL+TG Y    ++  +++    ++
Sbjct: 126 ACKQLADAGVRVSLFIDPDETQI--RAAHEAGAPVVELHTGRYADA-HDEAEQQREYERI 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               Q   ++ L++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV   
Sbjct: 183 VAGVQAGARLGLKVNAGHGLHYTNVQQ-IAAIDGIVELNIGHAIVAHAIFAGWDNAVREM 241

Query: 243 RRACGQHLDNTMRLT 257
           +          +   
Sbjct: 242 KAIMVAARVAALHGG 256


>gi|126173442|ref|YP_001049591.1| pyridoxine 5'-phosphate synthase [Shewanella baltica OS155]
 gi|125996647|gb|ABN60722.1| pyridoxal phosphate biosynthetic protein PdxJ [Shewanella baltica
           OS155]
          Length = 245

 Score =  237 bits (604), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 78/249 (31%), Positives = 121/249 (48%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LR  R   +P+ VH   +A  +GA G+T+H R D+RHI   D+  +  
Sbjct: 4   ILLGVNIDHIATLRQARGTSYPDPVHAAAVAEHAGADGITIHLREDRRHIIDRDVYLL-- 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  K  +N E    E  LN+    KP  + LVP+   ++T++ G D       +T 
Sbjct: 62  ---AKTLKTRMNFECAVTEEMLNIACEIKPTYVCLVPEKRQEVTTEGGLDVAGQLDKITA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL   G ++SLF D +  +    AA  +GA  IE++TG Y        QE   L ++
Sbjct: 119 AVTRLAAEGIQVSLFIDADKTQI--DAAVASGAPLIEIHTGCYADAKTE-AQEATELARI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           +  A+ A    L +NAGH L   N+   I AIP + E+++GHA  A A   G+  AV   
Sbjct: 176 SEMAKYAHGKGLVVNAGHGLHYHNVKP-IAAIPELYELNIGHAIVARAAIDGLATAVKDM 234

Query: 243 RRACGQHLD 251
           +    +   
Sbjct: 235 KVLMLEGRR 243


>gi|126439796|ref|YP_001059797.1| pyridoxine 5'-phosphate synthase [Burkholderia pseudomallei 668]
 gi|126219289|gb|ABN82795.1| pyridoxine 5'-phosphate synthase [Burkholderia pseudomallei 668]
          Length = 257

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 123/255 (48%), Gaps = 9/255 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R 
Sbjct: 11  IDLGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLRP 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +     K  +N+E       L++    +P    LVP+   +LT++ G D + +   +  
Sbjct: 71  RV-----KTRMNLECAVTPEMLDIACEIRPHDACLVPEKRSELTTEGGLDVVGHFDAVRA 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L + G R+SLF D +  +   +AA  TGA  IEL+TG Y    ++  +++    ++
Sbjct: 126 ACKQLADAGVRVSLFIDPDEAQI--RAAHGTGAPVIELHTGRYADA-HDAAEQQREFERI 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A        + L++NAGH L   N+   I A+P I+E+++GHA  A A+  G   AV   
Sbjct: 183 ATGVDAGIALGLKVNAGHGLHYTNVQA-IAALPGIAELNIGHAIVAHAVFVGWDNAVREM 241

Query: 243 RRACGQHLDNTMRLT 257
           +          +   
Sbjct: 242 KAIMVAARVAALHGG 256


>gi|146292265|ref|YP_001182689.1| pyridoxine 5'-phosphate synthase [Shewanella putrefaciens CN-32]
 gi|145563955|gb|ABP74890.1| pyridoxal phosphate biosynthetic protein PdxJ [Shewanella
           putrefaciens CN-32]
          Length = 245

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 78/249 (31%), Positives = 122/249 (48%), Gaps = 9/249 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A LR  R   +P+ VH   +A  +GA G+T+H R D+RHI   D+  +  
Sbjct: 4   ILLGVNIDHIATLRQARGTSYPDPVHAAAVAEHAGADGITIHLREDRRHIIDRDVYLL-- 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               +  K  +N E    E  LN+    KP  + LVP+   ++T++ G D       +T 
Sbjct: 62  ---AKTLKTRMNFECAVTEEMLNIACEIKPTYVCLVPEKRQEVTTEGGLDVAGQLDKITA 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL   G ++SLF D +  +    AA  +GA  IE++TG Y        +E I L ++
Sbjct: 119 AVTRLAAEGIQVSLFIDADKTQI--DAAVASGAPLIEIHTGCYADAKTE-AEEAIELARI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           +  A+ A    L +NAGH L   N+   I AIP + E+++GHA  A A   G+  AV   
Sbjct: 176 SEMAKYAHGKGLVVNAGHGLHYHNVKP-IAAIPELYELNIGHAIVARAAIDGLATAVKDM 234

Query: 243 RRACGQHLD 251
           +    +   
Sbjct: 235 KALMLEGRR 243


>gi|194477271|ref|YP_002049450.1| pyridoxal phosphate biosynthetic protein [Paulinella chromatophora]
 gi|171192278|gb|ACB43240.1| pyridoxal phosphate biosynthetic protein [Paulinella chromatophora]
          Length = 247

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 74/256 (28%), Positives = 135/256 (52%), Gaps = 10/256 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ +A +R  R+   P+ V I  +A   GA  +TVH R D+RHI+  D+  +R
Sbjct: 1   MVGLGVNIDHIANVRQARSTLEPDPVPISLLAEIGGADTITVHLREDRRHIQDRDVALLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            +I     ++ LN+E       +++  + KP+ +T VP+   ++T++ G D +  +  L 
Sbjct: 61  AVI-----RSRLNLEMAATNEMIDIALQIKPDMVTFVPERREEITTEGGLDVVSQKLALC 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           K V  LH+ G  +S F D    +      K+ GA  +EL+TG Y    +   Q+ + L +
Sbjct: 116 KAVEILHSKGIPVSFFVDPVIQQLET--CKMIGAHWVELHTGTYAEAGSK--QQALELAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L+ +  +A+++ L++NAGH L  QN+   +  I  + E+++GH+  A AL  G++EAV  
Sbjct: 172 LSKSTAIARQLGLRVNAGHGLNYQNVEP-VAIIKGMEELNIGHSIVARALVVGIEEAVRQ 230

Query: 242 FRRACGQHLDNTMRLT 257
            +        N++  +
Sbjct: 231 MKALLHNPHCNSLFGS 246


>gi|254446510|ref|ZP_05059986.1| pyridoxal phosphate biosynthetic protein PdxJ [Verrucomicrobiae
           bacterium DG1235]
 gi|198260818|gb|EDY85126.1| pyridoxal phosphate biosynthetic protein PdxJ [Verrucomicrobiae
           bacterium DG1235]
          Length = 252

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 76/255 (29%), Positives = 128/255 (50%), Gaps = 18/255 (7%)

Query: 2   STSVSVNLNAVAVLRNRRNL---------PWPNLVHIGKIALQSGASGLTVHPRPDQRHI 52
           S  + VN++ VA +R  R             P+ V I  +  ++GA G+TVHPR D RHI
Sbjct: 5   SILLGVNIDHVATVREARYKESPRACGQFVEPDPVTIALLCEKAGAHGITVHPREDARHI 64

Query: 53  RYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWD 112
           +  D+  +R  I     +  LN+E    +  L       PE I +VP+   ++T++ G D
Sbjct: 65  QKADVRRLRECI-----QTRLNMEMAATDEMLAFALEILPETICVVPESREEVTTEGGLD 119

Query: 113 FLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNP 172
                  + + V    + G   SLF D + N+   +A+  TGA  +EL+TG Y   Y + 
Sbjct: 120 VAGQFDRIERIVKAAADAGIETSLFIDPDQNQI--EASAKTGAKYVELHTGAYANAYYS- 176

Query: 173 QQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALE 232
           ++     ++L   A+LA ++ L +NAGH +   N+  +I  IP+++E+++GH+  + AL 
Sbjct: 177 KERGPEYDRLVAGAELAAELGLVVNAGHGINYVNVSEVIT-IPFLNELNIGHSIISRALF 235

Query: 233 CGVKEAVFCFRRACG 247
            G+ EAV   +    
Sbjct: 236 FGIDEAVREMKALIA 250


>gi|319943508|ref|ZP_08017790.1| pyridoxine 5'-phosphate synthase [Lautropia mirabilis ATCC 51599]
 gi|319743323|gb|EFV95728.1| pyridoxine 5'-phosphate synthase [Lautropia mirabilis ATCC 51599]
          Length = 258

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 76/253 (30%), Positives = 127/253 (50%), Gaps = 14/253 (5%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
              + VN++ VA +R  R    P+ V     A   GA G+TVH R D+RHI+  D+  +R
Sbjct: 1   MIELGVNIDHVATIRQARRTYEPDPVWAAVEAHLGGADGITVHLREDRRHIQDADVRRLR 60

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                   + +LN+E       +++    KPE   LVP+  H++T++ G D L  +A +T
Sbjct: 61  DQ-----TQIKLNLEMAATPEMVDIAIALKPEMAMLVPEGRHEITTEGGLDILSKEAAIT 115

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE------ 175
             + RL + G   S+F D    +  ++AA   GA   EL+TGPY   ++   ++      
Sbjct: 116 DAIRRLADHGIITSVFIDAEPAQ--VEAAARAGASVCELHTGPYAETFHREGRDVASPAI 173

Query: 176 RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
           R  L ++A    L Q+  ++ NAGH L   N+   + A+P + E+ +GHA  + A+  G+
Sbjct: 174 RRELERVATAGALIQQAGMRFNAGHGLNYFNVQP-VAALPGVRELHIGHAIVSRAVFVGM 232

Query: 236 KEAVFCFRRACGQ 248
           +EAV   +    +
Sbjct: 233 REAVSTMKALIRE 245


>gi|49475824|ref|YP_033865.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella henselae
           str. Houston-1]
 gi|49238632|emb|CAF27876.1| Pyridoxal phosphate biosynthetic protein pdxj [Bartonella henselae
           str. Houston-1]
          Length = 244

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 134/246 (54%), Positives = 171/246 (69%), Gaps = 3/246 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  +SVNLNAVAVLRNRRNLPWPN+  IG IAL +GA+GLTVHPRPD+RHIR+ DLP+I
Sbjct: 1   MAVKLSVNLNAVAVLRNRRNLPWPNIKSIGHIALTAGAAGLTVHPRPDERHIRFADLPDI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LI+  FP AE NIEGYP++ FL+L E+Y  +QITLVPDDP Q TSDHGWDF  N   L
Sbjct: 61  RCLINSAFPTAEFNIEGYPSDRFLDLAEKY-ADQITLVPDDPAQSTSDHGWDFAHNAEFL 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              + RL     R+SLFA+   +   +  AK  GAD +E YTGPYG  + +  ++   L 
Sbjct: 120 APIIQRLKEKKIRVSLFANPLVDGLDI--AKTIGADRVEFYTGPYGGAFKDKTKQDQELK 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL + A+ A+++ L +NAGHDLTI N+P L+N I ++ E+S+GH   A ALE G+ E V 
Sbjct: 178 KLILAARKAKELQLGVNAGHDLTITNLPALVNHISWLDEVSIGHGLIADALEYGMYETVQ 237

Query: 241 CFRRAC 246
            F R  
Sbjct: 238 RFIRLL 243


>gi|32490946|ref|NP_871200.1| pyridoxine 5'-phosphate synthase [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|30316008|sp|Q8D304|PDXJ_WIGBR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|25166152|dbj|BAC24343.1| pdxJ [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 245

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 71/242 (29%), Positives = 130/242 (53%), Gaps = 10/242 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ V +  +A  +GA  +T H R D RHI   D+  I+   
Sbjct: 6   LGVNVDHVASLRNVRGGKFPDPVQLAILAEIAGADSITTHLREDNRHINEKDVICIK--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQIT