BLAST/BLAST alignment of GI: 254780438 and GI: 254781094
>gi|254781094|ref|YP_003065507.1| glycyl-tRNA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 702
 Score = 32.3 bits (72), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 142 GNEHS-LQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQIN 197
           G E++ LQ   ++  D IE +  P G   N P       NK++IT  LA K+D  IN
Sbjct: 438 GKEYAVLQNENISCCDAIEEHLKPRGPLENVPT------NKISITVSLADKLDTLIN 488