>pfam01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This family contains both shikimate and quinate dehydrogenases. Shikimate 5-dehydrogenase catalyses the conversion of shikimate to 5-dehydroshikimate. This reaction is part of the shikimate pathway which is involved in the biosynthesis of aromatic amino acids. Quinate 5-dehydrogenase catalyses the conversion of quinate to 5-dehydroquinate. This reaction is part of the quinate pathway where quinic acid is exploited as a source of carbon in prokaryotes and microbial eukaryotes. Both the shikimate and quinate pathways share two common pathway metabolites 3-dehydroquinate and dehydroshikimate.

Probab=92.35 E-value=0.17 Score=29.54 Aligned_cols=73 Identities=25% Similarity=0.396 Sum_probs=46.9 Q ss_pred CCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCC-EEEEECCCCCEEECCCCCCCCEE---ECCCCHHHHHHHHHHHC Q ss_conf 569999767754205054666888999999998797-89997487650107845131004---33799999999998628 Q gi|254780439|r 7 LKTLLIIGAGPIVIGQACEFDYSGTQACKALKEEGY-RIILVNSNPATIMTDPDLADATY---TEPITPEVVAKIIEKER 82 (1162) Q Consensus 7 ikkvLviGsGpi~IGqa~EfDys~~qa~~alke~Gi-~vVlVNsNpaTi~TD~~~aD~vY---~ePlt~e~v~~Ii~~E~ 82 (1162) T Consensus 12 ~~~vlVIGaG~~-----------~~~~~~~L~~~g~~~i~v~nRt~~ka~---~la~~~~~~~~~~~~~~~l~~~l--~~ 75 (134) T pfam01488 12 GKKVLLIGAGEM-----------ARLAAKHLLSKGAKKITIANRTLEKAK---ELAEEFGGEEVEALPLDELEELL--AE 75 (134) T ss_pred CCEEEEECCCHH-----------HHHHHHHHHHCCCCEEEEECCCHHHHH---HHHHHCCCCCEEEEECHHHHHHH--HH T ss_conf 898999996099-----------999999999759988999547578999---99998499725898513544136--31 Q ss_pred CCEEEECCCCCHH Q ss_conf 9889975887026 Q gi|254780439|r 83 PDAILPTTGGQTA 95 (1162) Q Consensus 83 pDaIlp~~GGqta 95 (1162) T Consensus 76 ~DivI~aT~s~~~ 88 (134) T pfam01488 76 ADIVISATSAPTP 88 (134) T ss_pred CCEEEEECCCCCC T ss_conf 9999992599973

HHsearch alignment for GI: 254780439 and conserved domain: pfam01488