BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780440|ref|YP_003064853.1| transcription elongation factor GreA [Candidatus Liberibacter asiaticus str. psy62] (158 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780440|ref|YP_003064853.1| transcription elongation factor GreA [Candidatus Liberibacter asiaticus str. psy62] Length = 158 Score = 316 bits (810), Expect = 1e-88, Method: Compositional matrix adjust. Identities = 158/158 (100%), Positives = 158/158 (100%) Query: 1 MVDKIPVTSKGFDKIQQELRWRQQEERPRIIKAISEARAYGDLSENAEYQAAKELQNLNE 60 MVDKIPVTSKGFDKIQQELRWRQQEERPRIIKAISEARAYGDLSENAEYQAAKELQNLNE Sbjct: 1 MVDKIPVTSKGFDKIQQELRWRQQEERPRIIKAISEARAYGDLSENAEYQAAKELQNLNE 60 Query: 61 GRMAELENIITRAEVIDISTMSGDRIAFGATVSLVEKNSGDKKNYQIVGDQEADVQSGLV 120 GRMAELENIITRAEVIDISTMSGDRIAFGATVSLVEKNSGDKKNYQIVGDQEADVQSGLV Sbjct: 61 GRMAELENIITRAEVIDISTMSGDRIAFGATVSLVEKNSGDKKNYQIVGDQEADVQSGLV 120 Query: 121 SISSPIARALIGKELGDIISVNAPGGEKTYEILQVLWI 158 SISSPIARALIGKELGDIISVNAPGGEKTYEILQVLWI Sbjct: 121 SISSPIARALIGKELGDIISVNAPGGEKTYEILQVLWI 158 >gi|254780945|ref|YP_003065358.1| ATP-dependent DNA helicase RecG [Candidatus Liberibacter asiaticus str. psy62] Length = 700 Score = 25.4 bits (54), Expect = 0.55, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Query: 111 QEADVQSGLVSISSPIARALIGKELGDI-IS--VNAPGGEK 148 Q+A L+ ++PI R L+ LGDI IS P G K Sbjct: 416 QKATAPHVLLMTATPIPRTLVLTSLGDIDISKITEKPAGRK 456 >gi|254780787|ref|YP_003065200.1| translation initiation factor IF-2 [Candidatus Liberibacter asiaticus str. psy62] Length = 884 Score = 24.6 bits (52), Expect = 0.92, Method: Compositional matrix adjust. Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 16/68 (23%) Query: 57 NLNEGRMAELENIITRAEVIDISTMSGDRIAFGATVS-------------LVEKNSGDKK 103 NLN ++ L+ I+ +AE++D+ T S +R A G V LV+K + K Sbjct: 530 NLNLDKL--LDAILLQAEMLDLKT-SINRKAEGIVVEGKLDRGRGPVVTVLVQKGTLSKG 586 Query: 104 NYQIVGDQ 111 N +VGDQ Sbjct: 587 NILVVGDQ 594 >gi|254781068|ref|YP_003065481.1| hypothetical protein CLIBASIA_04850 [Candidatus Liberibacter asiaticus str. psy62] Length = 43 Score = 23.5 bits (49), Expect = 1.7, Method: Compositional matrix adjust. Identities = 9/29 (31%), Positives = 19/29 (65%) Query: 123 SSPIARALIGKELGDIISVNAPGGEKTYE 151 SSPIA A+ +++G ++ + +K+Y+ Sbjct: 4 SSPIALAIQNRQIGGVVRFDYDFKKKSYQ 32 >gi|254780793|ref|YP_003065206.1| integral membrane protein MviN [Candidatus Liberibacter asiaticus str. psy62] Length = 518 Score = 23.1 bits (48), Expect = 2.2, Method: Composition-based stats. Identities = 11/38 (28%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Query: 115 VQSGLVSISSPIARALIGKELGDIISVNAPGGEKTYEI 152 V G++ IS+ + RA+ +E G I ++ E+ Y + Sbjct: 242 VTGGIIQISNIVGRAIASRETGIISAIQY--AERIYSL 277 >gi|254780662|ref|YP_003065075.1| NAD-glutamate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 1576 Score = 22.3 bits (46), Expect = 4.5, Method: Compositional matrix adjust. Identities = 9/36 (25%), Positives = 18/36 (50%) Query: 19 LRWRQQEERPRIIKAISEARAYGDLSENAEYQAAKE 54 L W R I+KAI+ + + +N +++ K+ Sbjct: 1510 LDWMYSARREMIVKAITTGSSVATIMQNEKWKEVKD 1545 >gi|254780622|ref|YP_003065035.1| bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 405 Score = 21.6 bits (44), Expect = 6.5, Method: Compositional matrix adjust. Identities = 13/38 (34%), Positives = 17/38 (44%) Query: 23 QQEERPRIIKAISEARAYGDLSENAEYQAAKELQNLNE 60 Q+ P I+ AIS R Y L E + +Q NE Sbjct: 44 QKFITPLIVGAISNRRVYTHLLSYKEGYESNHIQLANE 81 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.312 0.131 0.354 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,664 Number of Sequences: 1233 Number of extensions: 3630 Number of successful extensions: 10 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 10 length of query: 158 length of database: 328,796 effective HSP length: 67 effective length of query: 91 effective length of database: 246,185 effective search space: 22402835 effective search space used: 22402835 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 35 (18.1 bits)