RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780443|ref|YP_003064856.1| hypothetical protein CLIBASIA_01640 [Candidatus Liberibacter asiaticus str. psy62] (141 letters) >2zz8_A LIPL32 protein; outer-membrane protein, unknown function; 2.01A {Leptospira interrogans} PDB: 3frl_A* (A:) Length = 241 Score = 29.3 bits (65), Expect = 0.23 Identities = 10/28 (35%), Positives = 14/28 (50%) Query: 98 DEFNIVDIKNCYTRGYLRVGFTEYDTGQ 125 D+ +D K RG R+ FT Y G+ Sbjct: 174 DDLKNIDTKKLLVRGLYRISFTTYKPGE 201 >3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} (A:364-444) Length = 81 Score = 26.7 bits (59), Expect = 1.1 Identities = 5/38 (13%), Positives = 14/38 (36%) Query: 38 AVGYPAVKGGWMTEGWWQIPGNTCETVVKGALHSRYYY 75 G ++G + +G+W+ E +++ Sbjct: 19 ESGEIVIRGPNIFKGYWKREKENQECWWYDEKGRKFFR 56 >2d0t_A Indoleamine 2,3-dioxygenase; helix bundle, riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: HEM PIM NHE; 2.30A {Homo sapiens} (A:1-128,A:242-262) Length = 149 Score = 25.5 bits (56), Expect = 3.1 Identities = 8/21 (38%), Positives = 13/21 (61%) Query: 37 VAVGYPAVKGGWMTEGWWQIP 57 + VG P + G + EG+W+ P Sbjct: 126 ILVGNPQLSDGLVYEGFWEDP 146 >1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} (A:1-214,A:311-483) Length = 387 Score = 24.7 bits (53), Expect = 5.6 Identities = 12/86 (13%), Positives = 25/86 (29%) Query: 6 LICFCFGAMIFCSNVSFAGFRVCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNTCETVV 65 LIC G + N+ + G + + + G+ + N V Sbjct: 288 LICNNKGVLDTIDNLKWGGIKGFSDDAVSFDWIHKSKSTDDSEEFSGYVKYDRNLTFVSV 347 Query: 66 KGALHSRYYYLYAEGVSHSEHWAGNV 91 A H + + ++ +V Sbjct: 348 YNASHMVPFDKSLVSRGIVDIYSNDV 373 >2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} (A:360-434) Length = 75 Score = 24.0 bits (52), Expect = 8.9 Identities = 7/34 (20%), Positives = 12/34 (35%) Query: 38 AVGYPAVKGGWMTEGWWQIPGNTCETVVKGALHS 71 VG +KG +W + T + + S Sbjct: 18 EVGDLYIKGPSAAVMYWNNREKSRATFLGEWIRS 51 >2g7c_A Toxin A; linear B trisaccharide, protein-carbohydrate complex, bacterial toxin; HET: GLA GAL NAG; 2.00A {Clostridium difficile} (A:44-117) Length = 74 Score = 23.7 bits (51), Expect = 9.2 Identities = 5/57 (8%), Positives = 12/57 (21%), Gaps = 13/57 (22%) Query: 45 KGGWMTEGWWQIPGNTCETVVKGALHSRYYYLYAEGVSHSEHWAGNVQMCVGQDEFN 101 G M G ++ P + Y + ++ + Sbjct: 18 TDGIMQIGVFKGPDG-------------FEYFAPANTDANNIEGQAIRYQNRFLYLH 61 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.325 0.139 0.478 Gapped Lambda K H 0.267 0.0685 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,184,526 Number of extensions: 50333 Number of successful extensions: 208 Number of sequences better than 10.0: 1 Number of HSP's gapped: 208 Number of HSP's successfully gapped: 28 Length of query: 141 Length of database: 4,956,049 Length adjustment: 80 Effective length of query: 61 Effective length of database: 2,251,649 Effective search space: 137350589 Effective search space used: 137350589 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.1 bits)