>cd06529 S24_LexA-like Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The LexA-like proteins contain two-domains: an N-terminal DNA binding domain and a C-terminal domain (CTD) that provides LexA dimerization as well as cleavage activity. They undergo autolysis, cleaving at an Ala-Gly or a Cys-Gly bond, separating the DNA-binding domain from the rest of the

Probab=99.70 E-value=1.2e-16 Score=127.80 Aligned_cols=81 Identities=22% Similarity=0.372 Sum_probs=74.0 Q ss_pred EEEEECCCCCCCCCCCCCEEEEECCCCCCCCCEEEEEEECCCEEEEEEEEECCCEEEEEECCCCCCCEEECHHHEEEEEE Q ss_conf 99996283324214878689993689740588899997179689999999779879999685898875854786599977 Q gi|254780444|r 138 TRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIAR 217 (223) Q Consensus 138 ~~l~V~GDSM~P~i~~Gd~vlVd~~~~~~~g~~v~~~~~~~~~~iKrl~~~~~~~~~l~s~Np~y~~~~i~~~~i~iigr 217 (223) T Consensus 1 ~~l~v~GdSM~P~i~~Gd~vivd~~~~~~~g~i~vv~~~-~~~~iKrl~~~~~~~~~L~s~N~~y~~~~~~~~~~~~~~i 79 (81) T cd06529 1 FALRVKGDSMEPTIPDGDLVLVDPSDTPRDGDIVVARLD-GELTVKRLQRRGGGRLRLISDNPAYPPIEIDEEELEIVGV 79 (81) T ss_pred CEEEEECCCCCCCCCCCCEEEEECCCCCCCCCEEEEEEC-CCCEEEEEEECCCCEEEEEECCCCCCCEECCCCCEEEEEE T ss_conf 989996774771406999999937750479989999975-9806999999189639999799998988308021899999 Q ss_pred EE Q ss_conf 99 Q gi|254780444|r 218 IL 219 (223) Q Consensus 218 Vv 219 (223) T Consensus 80 vg 81 (81) T cd06529 80 VG 81 (81) T ss_pred EC T ss_conf 89

HHsearch alignment for GI: 254780444 and conserved domain: cd06529