>pfam04218 CENP-B_N CENP-B N-terminal DNA-binding domain. Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere. Within the N-terminal 125 residues, there is a DNA-binding region, which binds to a corresponding 17bp CENP-B box sequence. CENP-B dimers either bind two separate DNA molecules or alternatively, they may bind two CENP-B boxes on one DNA molecule, with the intervening stretch of DNA forming a loop structure. The CENP-B DNA-binding domain consists of two repeating domains, RP1 and RP2. This family corresponds to RP1 has been shown to consist of four helices in a helix-turn-helix structure.

Probab=93.17 E-value=0.22 Score=29.02 Aligned_cols=41 Identities=20% Similarity=0.267 Sum_probs=35.0 Q ss_pred CCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHC Q ss_conf 7755899999999999964999889999828998798899751 Q gi|254780444|r 2 TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF 44 (223) Q Consensus 2 ~~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~ 44 (223) T Consensus 5 ~~LTl~eKi~iI~~~--e~G~s~~~lar~~gi~~STl~~I~Kn 45 (53) T pfam04218 5 TSLTLREKIEVIQRS--EEGESKASLARRFNVPRSTLRDILKN 45 (53) T ss_pred EEECHHHHHHHHHHH--HCCCCHHHHHHHHCCCHHHHHHHHHH T ss_conf 141699999999999--85896889999969879799999980

HHsearch alignment for GI: 254780444 and conserved domain: pfam04218