RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780444|ref|YP_003064857.1| bacteriophage repressor protein C1 [Candidatus Liberibacter asiaticus str. psy62] (223 letters) >gnl|CDD|185600 PTZ00410, PTZ00410, NAD-dependent SIR2; Provisional. Length = 349 Score = 31.8 bits (72), Expect = 0.13 Identities = 14/35 (40%), Positives = 19/35 (54%) Query: 119 GVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRK 153 G+P+ RSPH GIYA + + D L L R+ Sbjct: 45 GIPDFRSPHTGIYAKLGKYNLNSPTDAFSLTLLRE 79 >gnl|CDD|162030 TIGR00767, rho, transcription termination factor Rho. Members of this family differ in the specificity of RNA binding. Length = 415 Score = 29.7 bits (67), Expect = 0.57 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 6/51 (11%) Query: 6 HKK----IWEAIDRMAERHNLT--PSGLARKAGLDPTSFNKSKRFGIEGRN 50 HKK + ++I R+A +N SG G+D + ++ KRF RN Sbjct: 253 HKKDVVILLDSITRLARAYNTVTPASGKVLSGGVDANALHRPKRFFGAARN 303 >gnl|CDD|178066 PLN02447, PLN02447, 1,4-alpha-glucan-branching enzyme. Length = 758 Score = 29.6 bits (67), Expect = 0.64 Identities = 10/34 (29%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Query: 98 SGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIY 131 + G + D P K+ EI +P+NG+Y Sbjct: 177 TPDGRWVDR--IPAWIKYAVQAPGEIGAPYNGVY 208 >gnl|CDD|128803 smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins. Length = 56 Score = 28.7 bits (65), Expect = 1.2 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Query: 13 IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQL 72 + + E LT LA K G+ ++ ++ IE R PS E++ K+ A ++ +L Sbjct: 2 LKELREEKGLTQEELAEKLGVSRSTLSR-----IENGKRKPSLETLKKLAKALGVSLDEL 56 >gnl|CDD|132276 TIGR03232, benzo_1_2_benB, benzoate 1,2-dioxygenase, small subunit. Benzoate 1,2-dioxygenase (EC 1.14.12.10) belongs to the larger family of aromatic ring-hydroxylating dioxygenases. Members of this family should all act on benzoate, but several have additional known activities on various benozate analogs. Some members actually may be named more suitably according to such alternate an activity, such as 2-chlorobenzoate 1,2-dioxygenase (1.14.12.13). Length = 155 Score = 28.6 bits (64), Expect = 1.2 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Query: 79 DGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHN 128 D + TE + EI L+Y+P G D VF + ++ VP+ R+ HN Sbjct: 38 DDQLTEDPQSEISLIYYP--NRQGLEDR-VFRIKTERSSATVPDTRTSHN 84 >gnl|CDD|152766 pfam12331, DUF3636, Protein of unknown function (DUF3636). This domain family is found in eukaryotes, and is approximately 160 amino acids in length. Length = 155 Score = 27.3 bits (61), Expect = 3.4 Identities = 9/28 (32%), Positives = 12/28 (42%), Gaps = 5/28 (17%) Query: 195 LMSLNCCYPVDTVEMSDIEWIARILWAS 222 LM LN P+ DI + +L S Sbjct: 36 LMMLNPSQPIR-----DITLMLSLLSTS 58 >gnl|CDD|147833 pfam05895, DUF859, Siphovirus protein of unknown function (DUF859). This family consists of several uncharacterized proteins from the Siphoviruses as well as one bacterial sequence. Some of the members of this family are described as putative minor structural proteins. Length = 534 Score = 27.0 bits (60), Expect = 3.8 Identities = 14/44 (31%), Positives = 19/44 (43%), Gaps = 6/44 (13%) Query: 78 SDGRTTEKKEKEIPLL-YFPPSGSGGFFDSGVFPTGNKWNTVGV 120 S GR ++ E I +L YF P+ V TG N + V Sbjct: 309 SRGRQSDPVETTITVLEYFGPA-----LSFSVQRTGETSNQLVV 347 >gnl|CDD|162065 TIGR00844, c_cpa1, na(+)/h(+) antiporter. This model is specific for the fungal members of this family. Length = 810 Score = 26.8 bits (59), Expect = 4.1 Identities = 14/75 (18%), Positives = 30/75 (40%), Gaps = 3/75 (4%) Query: 116 NTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSMLPLYRKGDILILNSAIQVNCGDRLLIKP 175 T I S + +Y + + + + R+ + + I ++++I+ Sbjct: 604 PTSRYDGIESEIDDVYTYENDSESIASSERRRIKKLREEE---QQAYIAYTEDNQVIIEN 660 Query: 176 RTGDIVAKVLISRRG 190 R G+I+ V I RG Sbjct: 661 RQGEILEYVDIHDRG 675 >gnl|CDD|131387 TIGR02334, prpF, probable AcnD-accessory protein PrpF. The 2-methylcitrate cycle is one of at least five degradation pathways for propionate via propionyl-CoA. Degradation of propionate toward pyruvate consumes oxaloacetate and releases succinate. Oxidation of succinate back into oxaloacetate by the TCA cycle makes the 2-methylcitrate pathway a cycle. This family consists of PrpF, an incompletely characterized protein that appears to be an essential accessory protein for the Fe/S-dependent 2-methylisocitrate dehydratase AcnD (TIGR02333). This protein is related to but distinct from FldA (part of Pfam family pfam04303), a putative fluorene degradation protein of Sphingomonas sp. LB126. Length = 390 Score = 26.7 bits (59), Expect = 5.1 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 13/59 (22%) Query: 75 LPFSDGRTTEKKEKEIPLLYFP----------PSGSGGFFDSGVFPTGNKWNTVGVPEI 123 +P S G+ E + E+ + FP P+ G + +FPTGN + + VP + Sbjct: 146 VPISGGQVQETGDFELDGVTFPAAEVQLEFLDPADDG---EGAMFPTGNLVDDLEVPGV 201 >gnl|CDD|162812 TIGR02346, chap_CCT_theta, T-complex protein 1, theta subunit. Members of this family, all eukaryotic, are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC. The archaeal equivalent group II chaperonin is often called the thermosome. Both are somewhat related to the group I chaperonin of bacterial, GroEL/GroES. This family consists exclusively of the CCT alpha chain (part of a paralogous family) from animals, plants, fungi, and other eukaryotes. Length = 531 Score = 26.6 bits (59), Expect = 5.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Query: 12 AIDRMAERHNLTPSGLARKAGLDPT 36 AI + AE + P LA AGL+P Sbjct: 429 AIKKFAEAFEIIPRTLAENAGLNPN 453 >gnl|CDD|178277 PLN02672, PLN02672, methionine S-methyltransferase. Length = 1082 Score = 26.3 bits (58), Expect = 6.5 Identities = 20/60 (33%), Positives = 24/60 (40%), Gaps = 17/60 (28%) Query: 58 IFKILAATNETICQLLDLPFSDGRTTEKKEKEIPLL-----------YFP---PSGSGGF 103 IFK L + LDL F D ++K IP L YFP P+GS F Sbjct: 375 IFKFLKNGFHEVSGSLDLSFEDESVADEK---IPFLAYLASALKGLSYFPCEPPAGSKRF 431 >gnl|CDD|180973 PRK07424, PRK07424, bifunctional sterol desaturase/short chain dehydrogenase; Validated. Length = 406 Score = 26.2 bits (58), Expect = 6.8 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Query: 143 QDTSMLPLYRKGDILILNSAIQVNCGDR 170 Q+ ++ L K DILI+N I V+ G+R Sbjct: 235 QEAALAELLEKVDILIINHGINVH-GER 261 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.136 0.418 Gapped Lambda K H 0.267 0.0637 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,724,028 Number of extensions: 229232 Number of successful extensions: 418 Number of sequences better than 10.0: 1 Number of HSP's gapped: 418 Number of HSP's successfully gapped: 20 Length of query: 223 Length of database: 5,994,473 Length adjustment: 90 Effective length of query: 133 Effective length of database: 4,049,753 Effective search space: 538617149 Effective search space used: 538617149 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.2 bits)