RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780444|ref|YP_003064857.1| bacteriophage repressor protein C1 [Candidatus Liberibacter asiaticus str. psy62] (223 letters) >d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} Length = 77 Score = 35.2 bits (81), Expect = 0.004 Identities = 15/69 (21%), Positives = 28/69 (40%), Gaps = 5/69 (7%) Query: 6 HKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAAT 65 +K + ++ + ++ LA AGL T ++ +E +R S +I KI AA Sbjct: 8 KRKFGRTLKKIRTQKGVSQEELADLAGLHRTYISE-----VERGDRNISLINIHKICAAL 62 Query: 66 NETICQLLD 74 + Sbjct: 63 DIPASTFFR 71 >d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Length = 68 Score = 32.8 bits (75), Expect = 0.023 Identities = 15/64 (23%), Positives = 29/64 (45%), Gaps = 4/64 (6%) Query: 11 EAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC 70 + I + + + S LA KAG+ + + +R PS + + K+ A + ++ Sbjct: 4 QRIKQYRKEKGYSLSELAEKAGVAKSYLSSIER----NLQTNPSIQFLEKVSAVLDVSVH 59 Query: 71 QLLD 74 LLD Sbjct: 60 TLLD 63 >d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Length = 85 Score = 27.2 bits (60), Expect = 1.0 Identities = 18/79 (22%), Positives = 29/79 (36%), Gaps = 11/79 (13%) Query: 7 KKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKS----------KRFGIEGRNRWPSTE 56 KKI EA + + R LT S LA G+ S ++ R + TE Sbjct: 8 KKIKEAAEA-SNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKRGQILNITE 66 Query: 57 SIFKILAATNETICQLLDL 75 +L + ++L + Sbjct: 67 KGLDVLYTEFADLSRILAI 85 >d2diga1 b.34.9.1 (A:8-62) Lamin-b receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Score = 25.7 bits (56), Expect = 3.1 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Query: 41 SKRFGI--EGRNRWPSTESIFKILAATNETICQLLDLPFSDGRTTEKKEKEI 90 S++F R RWP + +++ ++++ QL + + DG E KE +I Sbjct: 3 SRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDI 54 >d1q88a_ e.47.1.1 (A:) 39 kda initiator binding protein, IBP39, C-terminal domains {Trichomonas vaginalis [TaxId: 5722]} Length = 192 Score = 25.3 bits (55), Expect = 4.0 Identities = 8/38 (21%), Positives = 14/38 (36%) Query: 38 FNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDL 75 ++ F + + + E I I+A E DL Sbjct: 40 EKAAEYFKQPEQPKQNAIEVISAIMAPQEEQTKSKADL 77 >d1g8ka2 c.81.1.1 (A:4-682) Arsenite oxidase large subunit {Alcaligenes faecalis [TaxId: 511]} Length = 679 Score = 24.7 bits (52), Expect = 6.7 Identities = 12/101 (11%), Positives = 23/101 (22%), Gaps = 14/101 (13%) Query: 25 SGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIF----KILAATNETICQLLDLPFSDG 80 + +A K++ W + E F + Sbjct: 565 ARIANALRDMYQKDGKAEMAAQFEGFDWKTEEDAFNDGFRRAGQPGAPAIDSQGGSTGHL 624 Query: 81 RTTEKKEKEIPL-LYFP---------PSGSGGFFDSGVFPT 111 T ++ K + P G+ + G F T Sbjct: 625 VTYDRLRKSGNNGVQLPVVSWDESKGLVGTEMLYTEGKFDT 665 >d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} Length = 138 Score = 24.1 bits (52), Expect = 8.9 Identities = 3/28 (10%), Positives = 4/28 (14%) Query: 166 NCGDRLLIKPRTGDIVAKVLISRRGRSI 193 G + GR Sbjct: 85 ELNATHHRPVSEGKVRGVCQPLHLGRQN 112 >d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} Length = 172 Score = 24.3 bits (52), Expect = 9.7 Identities = 7/26 (26%), Positives = 11/26 (42%) Query: 12 AIDRMAERHNLTPSGLARKAGLDPTS 37 + R A L P+ L+ A + S Sbjct: 70 TLYRSAPPEGLRPTELSALAAISGPS 95 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.319 0.136 0.418 Gapped Lambda K H 0.267 0.0579 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 859,241 Number of extensions: 38143 Number of successful extensions: 85 Number of sequences better than 10.0: 1 Number of HSP's gapped: 84 Number of HSP's successfully gapped: 11 Length of query: 223 Length of database: 2,407,596 Length adjustment: 82 Effective length of query: 141 Effective length of database: 1,281,736 Effective search space: 180724776 Effective search space used: 180724776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (23.8 bits)