Query         gi|254780446|ref|YP_003064859.1| hypothetical protein CLIBASIA_01655 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 171
No_of_seqs    7 out of 9
Neff          2.7 
Searched_HMMs 13730
Date          Wed Jun  1 04:14:22 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780446.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1coja2 d.44.1.1 (A:91-212) Fe  28.8      18  0.0013   15.2   3.0   79   28-109    38-119 (122)
  2 d1tdha3 g.39.1.8 (A:247-290) E  27.7      14 0.00099   15.9   1.8   10   32-41     25-34  (44)
  3 d1vjja4 d.3.1.4 (A:141-461) Tr  25.6      16  0.0012   15.4   1.9   14  124-137   136-149 (321)
  4 d1g0da4 d.3.1.4 (A:141-461) Tr  25.5      16  0.0012   15.4   1.9   14  124-137   136-149 (321)
  5 d1ex0a4 d.3.1.4 (A:191-510) Tr  23.7      18  0.0013   15.1   1.9   14  124-137   128-141 (320)
  6 d1xfja_ d.194.1.2 (A:) Hypothe  19.2      27   0.002   14.1   2.2   45   23-69     71-115 (256)
  7 d1p22a1 a.158.1.1 (A:135-252)   15.6      30  0.0022   13.8   1.5   13  157-170   106-118 (118)
  8 d1bm9a_ a.4.5.7 (A:) Replicati  14.8     9.5 0.00069   16.8  -1.2   13   52-64     41-53  (120)
  9 d2q3za4 d.3.1.4 (A:146-461) Tr  14.3      37  0.0027   13.3   1.9   22  123-150   135-156 (316)
 10 d1xdna_ d.142.2.4 (A:) RNA edi  12.7      41   0.003   13.1   2.4   77   44-142   123-212 (265)

No 1  
>d1coja2 d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]}
Probab=28.77  E-value=18  Score=15.17  Aligned_cols=79  Identities=15%  Similarity=0.209  Sum_probs=51.1

Q ss_pred             EEEEEECCCCCEEEEEECEEECCCCCEEEECCCCCCCEEEEECCCCHHCCCCCCEEE---EEECCHHHHHHHHHHHHHHH
Q ss_conf             489998799887545413024477867322258000177763045010133345069---98454689887679899889
Q gi|254780446|r   28 RLLVVFDSNKEFVAELDGLVVNKDGKFKPIGYLPSDRLKVFEFKYPCLYKEDQEQVV---LCSSSEECVMSRWNAAVHTK  104 (171)
Q Consensus        28 ~~~V~~D~~~~~laeL~GLaTsk~G~~~pIGY~~sd~Lk~~~~~~~~~y~~sq~q~i---v~~~~~e~~~~rwn~~~~~~  104 (171)
                      =.|++.|..++.+   .=..|+....+.+.|..|==.+-+||-.|=.+|+..-..=+   .=.=+=+.+..||..+..+.
T Consensus        38 W~wL~~~~~~~~l---~i~~~~~~~~~~~~~~~PlL~iDvWEHAYylDY~n~r~~Yi~~f~~~InW~~v~~r~~~A~~~~  114 (122)
T d1coja2          38 WAILGLDIFSGRL---VVNGLDAHNVYNLTGLIPLIVIDTYEHAYYVDYKNKRPPYIDAFFKNINWDVVNERFEKAMKAY  114 (122)
T ss_dssp             EEEEEEETTTTEE---EEEEESBTTBSCCTTCEEEEEEECSGGGTHHHHTTCHHHHHHHHHHTBBHHHHHHHHHHHHHHH
T ss_pred             CEEEEEECCCCCC---EEEECCCCCCCCCCCCCEEEEEECCHHHHHHHHCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             3267863036752---2343489998643445203687500455298757568999999998669999999999999999


Q ss_pred             HHHHH
Q ss_conf             88873
Q gi|254780446|r  105 EILNE  109 (171)
Q Consensus       105 ~~IN~  109 (171)
                      ++++.
T Consensus       115 ~~~~~  119 (122)
T d1coja2         115 EALKD  119 (122)
T ss_dssp             HHHTT
T ss_pred             HHHHH
T ss_conf             99998


No 2  
>d1tdha3 g.39.1.8 (A:247-290) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens) [TaxId: 9606]}
Probab=27.67  E-value=14  Score=15.86  Aligned_cols=10  Identities=10%  Similarity=0.052  Sum_probs=4.9

Q ss_pred             EECCCCCEEE
Q ss_conf             9879988754
Q gi|254780446|r   32 VFDSNKEFVA   41 (171)
Q Consensus        32 ~~D~~~~~la   41 (171)
                      ++|.+|+++|
T Consensus        25 L~D~~GRTIW   34 (44)
T d1tdha3          25 LQDRHGRTIW   34 (44)
T ss_dssp             EECTTSCEEE
T ss_pred             HHCCCCCEEE
T ss_conf             4406897798


No 3  
>d1vjja4 d.3.1.4 (A:141-461) Transglutaminase catalytic domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
Probab=25.63  E-value=16  Score=15.44  Aligned_cols=14  Identities=21%  Similarity=0.484  Sum_probs=11.3

Q ss_pred             HHHHHHHHHHHCCC
Q ss_conf             26899999983887
Q gi|254780446|r  124 NSVASTLIRCMGLK  137 (171)
Q Consensus       124 NSva~Tl~r~M~l~  137 (171)
                      -.|+-|++||+||+
T Consensus       136 agV~~TvlRcLGIP  149 (321)
T d1vjja4         136 AGTLNTALRSLGIP  149 (321)
T ss_dssp             HHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHCCCC
T ss_conf             56545456514898


No 4  
>d1g0da4 d.3.1.4 (A:141-461) Transglutaminase catalytic domain {Red sea bream (Chrysophrys major) [TaxId: 143350]}
Probab=25.52  E-value=16  Score=15.42  Aligned_cols=14  Identities=43%  Similarity=0.990  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHCCC
Q ss_conf             26899999983887
Q gi|254780446|r  124 NSVASTLIRCMGLK  137 (171)
Q Consensus       124 NSva~Tl~r~M~l~  137 (171)
                      -.|+-|++||+||+
T Consensus       136 AgV~~TvlRcLGIP  149 (321)
T d1g0da4         136 AAVACTVLRCLGIP  149 (321)
T ss_dssp             HHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHCCCC
T ss_conf             88999999863898


No 5  
>d1ex0a4 d.3.1.4 (A:191-510) Transglutaminase catalytic domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
Probab=23.73  E-value=18  Score=15.10  Aligned_cols=14  Identities=36%  Similarity=0.885  Sum_probs=11.6

Q ss_pred             HHHHHHHHHHHCCC
Q ss_conf             26899999983887
Q gi|254780446|r  124 NSVASTLIRCMGLK  137 (171)
Q Consensus       124 NSva~Tl~r~M~l~  137 (171)
                      -.|+-|++||+||+
T Consensus       128 agV~~TvlR~LGIP  141 (320)
T d1ex0a4         128 AGVFNTFLRCLGIP  141 (320)
T ss_dssp             HHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHCCCCC
T ss_conf             55565454126898


No 6  
>d1xfja_ d.194.1.2 (A:) Hypothetical protein CC0490 {Caulobacter crescentus [TaxId: 155892]}
Probab=19.22  E-value=27  Score=14.05  Aligned_cols=45  Identities=18%  Similarity=0.042  Sum_probs=31.7

Q ss_pred             CEEEEEEEEEECCCCCEEEEEECEEECCCCCEEEECCCCCCCEEEEE
Q ss_conf             00102489998799887545413024477867322258000177763
Q gi|254780446|r   23 LFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGYLPSDRLKVFE   69 (171)
Q Consensus        23 ~~fgH~~~V~~D~~~~~laeL~GLaTsk~G~~~pIGY~~sd~Lk~~~   69 (171)
                      -+-|.+++++.++......+-|||.|++.|-...|=  -+|-+-++.
T Consensus        71 QvH~~~v~~v~~~~~~~~~~~DalvT~~~~~~l~v~--tADC~PIll  115 (256)
T d1xfja_          71 QIHSTIAIVADGSWGDARPEGDAVVSKTPGVICGAM--AADCAPVLL  115 (256)
T ss_dssp             CCSCCCEEECSSCCTTCCCBCSEEEECSTTCEEEEE--ESSSEEEEE
T ss_pred             CCCCCEEEEEECCCCCCCCCCCCHHCCCCCEEEEEE--ECHHHHHHE
T ss_conf             045522599831356666564301015676245675--201023440


No 7  
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}
Probab=15.57  E-value=30  Score=13.84  Aligned_cols=13  Identities=46%  Similarity=1.122  Sum_probs=9.3

Q ss_pred             HHHHHHHHHHHHHC
Q ss_conf             77999999866411
Q gi|254780446|r  157 DRKINEIQNNWIRC  170 (171)
Q Consensus       157 e~~i~~i~~~~~~~  170 (171)
                      -.+...|++|| ||
T Consensus       106 y~~r~~l~~nW-r~  118 (118)
T d1p22a1         106 IQDIETIESNW-RC  118 (118)
T ss_dssp             HHHHHHHHHHT-TT
T ss_pred             HHHHHHHHHCC-CC
T ss_conf             99999999847-97


No 8  
>d1bm9a_ a.4.5.7 (A:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
Probab=14.83  E-value=9.5  Score=16.78  Aligned_cols=13  Identities=38%  Similarity=0.861  Sum_probs=10.4

Q ss_pred             CCEEEECCCCCCC
Q ss_conf             8673222580001
Q gi|254780446|r   52 GKFKPIGYLPSDR   64 (171)
Q Consensus        52 G~~~pIGY~~sd~   64 (171)
                      -+++|.||-|.|+
T Consensus        41 ~eFk~~Gy~P~hs   53 (120)
T d1bm9a_          41 SEFKEIGFKPNHT   53 (120)
T ss_dssp             HHHTTTTCCCCHH
T ss_pred             HHHHHCCCCCCHH
T ss_conf             9878538899778


No 9  
>d2q3za4 d.3.1.4 (A:146-461) Transglutaminase catalytic domain {Human (Homo sapiens), tissue isozyme [TaxId: 9606]}
Probab=14.27  E-value=37  Score=13.32  Aligned_cols=22  Identities=27%  Similarity=0.641  Sum_probs=15.9

Q ss_pred             CHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             1268999999838874578865416766
Q gi|254780446|r  123 SNSVASTLIRCMGLKELAIPNAKIAPYQ  150 (171)
Q Consensus       123 SNSva~Tl~r~M~l~~~~ip~~r~~Pg~  150 (171)
                      --+++-|++||+||+      +|++-|+
T Consensus       135 FA~v~~tvlR~lGIP------aRvVT~f  156 (316)
T d2q3za4         135 FAAVACTVLRCLGIP------TRVVTNY  156 (316)
T ss_dssp             HHHHHHHHHHHHTCC------EEEEEEE
T ss_pred             HHHHHHHHHHHCCCC------CEEECCC
T ss_conf             898999999856997------0476265


No 10 
>d1xdna_ d.142.2.4 (A:) RNA editing ligase MP52 {Trypanosoma brucei [TaxId: 5691]}
Probab=12.73  E-value=41  Score=13.05  Aligned_cols=77  Identities=22%  Similarity=0.243  Sum_probs=38.4

Q ss_pred             ECEEECCCCCEEE-----------ECCCCCCCEEEEECCCCHHCCCCCCEEEEEECCHHHHHHHHHHHHHHHHHHH-HCC
Q ss_conf             1302447786732-----------2258000177763045010133345069984546898876798998898887-368
Q gi|254780446|r   44 DGLVVNKDGKFKP-----------IGYLPSDRLKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVHTKEILN-EKN  111 (171)
Q Consensus        44 ~GLaTsk~G~~~p-----------IGY~~sd~Lk~~~~~~~~~y~~sq~q~iv~~~~~e~~~~rwn~~~~~~~~IN-~~n  111 (171)
                      .+..+.++|++.|           |-|.|.-.-=||.+.+.-..   -...++|-+.++           +++.-- ..+
T Consensus       123 ~~~~~~~~g~~~~~~~~~iQk~~~v~Y~p~l~FyAFDI~~~~~~---~~~~~~fl~~d~-----------~~e~~~~~~g  188 (265)
T d1xdna_         123 EKWCTLPNGKKFPIAGVQIQREPFPQYSPELHFFAFDIKYSVSG---AEEDFVLLGYDE-----------FVEFSSKVPN  188 (265)
T ss_dssp             CCEEECTTSCEEEGGGCCSCCCSSCCCEEEEEEEEEEEEEESSC---CGGGEEECCHHH-----------HHHHHHTSTT
T ss_pred             CCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCEEEEEEEECCCC---CCCEEEECCHHH-----------HHHHHHHCCC
T ss_conf             34311356762343220001355333477751799998851577---753256501899-----------9998865069


Q ss_pred             CCCCC-CCCCCCCHHHHHHHHHHHCCCCCCCC
Q ss_conf             99872-12344512689999998388745788
Q gi|254780446|r  112 MPYPF-LGIGKNSNSVASTLIRCMGLKELAIP  142 (171)
Q Consensus       112 L~YPi-~Gl~~NSNSva~Tl~r~M~l~~~~ip  142 (171)
                      |+|-+ ++-        +||.+||.++...+.
T Consensus       189 l~yap~L~r--------Gt~~e~~~~pv~~F~  212 (265)
T d1xdna_         189 LLYARALVR--------GTLDECLAFDVENFM  212 (265)
T ss_dssp             CEECCCSEE--------ESHHHHHTCCGGGCB
T ss_pred             CCCCCHHHC--------CCHHHHHCCCCCCCC
T ss_conf             631204410--------569998507500155


Done!