BLAST/PSIBLAST alignment of GI: 254780446 and GI: 315122105 at iteration 1
>gi|315122105|ref|YP_004062594.1| hypothetical protein CKC_01775 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 179
>gi|313495507|gb|ADR52106.1| hypothetical protein CKC_01775 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 179
 Score =  249 bits (635), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/171 (71%), Positives = 144/171 (84%), Gaps = 1/171 (0%)

Query: 1   MISAESDTS-QNFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGY 59
           ++ AES+ + Q +TIVLSQ  IGL FAHRLL VFDSNK FVAELDGLVVNK+GK KPIGY
Sbjct: 9   VVKAESNCNVQGYTIVLSQWDIGLIFAHRLLTVFDSNKRFVAELDGLVVNKNGKIKPIGY 68

Query: 60  LPSDRLKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVHTKEILNEKNMPYPFLGI 119
           L SDRLKVFEFK P LY+EDQEQVVL SS++E VM +W+ A+  K+ILNEK +PYPFLG+
Sbjct: 69  LRSDRLKVFEFKSPHLYREDQEQVVLFSSTKEYVMRKWHLALRAKDILNEKYLPYPFLGM 128

Query: 120 GKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIRC 170
           G+NSNSVASTLI+CMGL+EL IP+AKIAPYQG ILLDD  I +IQN+ I C
Sbjct: 129 GENSNSVASTLIKCMGLEELEIPHAKIAPYQGRILLDDSVITQIQNSRIHC 179