BLAST/PSIBLAST alignment of GI: 254780446 and GI: 332969447 at iteration 1
>gi|332969447|gb|EGK08469.1| hypothetical protein HMPREF0476_1333 [Kingella kingae ATCC 23330] Length = 240
 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 93/153 (60%), Gaps = 4/153 (2%)

Query: 9   SQNFTIVLSQLT-IGLFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGYLPSDRLKV 67
           S+N+ IV SQL  +G    H  + V D + + V EL+GL  ++DG  KPIGYLPSDRLKV
Sbjct: 7   SENYRIVKSQLPLVGGMGGHNFIAVLDPSGKVVHELNGLATSEDGAIKPIGYLPSDRLKV 66

Query: 68  FEFKYPC--LYKEDQEQVVLCSSSEECVMSRWNAAVHTKEILNEKNMPYPFLGIGKNSNS 125
           +         Y   Q Q  L   S E VM ++N      + +N++N+PYPF G+GKNSNS
Sbjct: 67  YSETEAGGFFYNPSQRQQTLYEGSYESVMDKYNKGYEAGKKINDQNLPYPFFGLGKNSNS 126

Query: 126 VASTLIRCMGLKELAIPNAKIAPYQGIILLDDR 158
           VASTL+  MGL +  + NA + P +G +LL ++
Sbjct: 127 VASTLLNQMGLDDPDLGNA-LTPGEGSLLLPEK 158