RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780446|ref|YP_003064859.1| hypothetical protein CLIBASIA_01655 [Candidatus Liberibacter asiaticus str. psy62] (171 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 43.4 bits (102), Expect = 2e-05 Identities = 27/191 (14%), Positives = 51/191 (26%), Gaps = 86/191 (45%) Query: 2 ISAESDTSQNFTIVLSQLTIGL-------FFAHRLLVVFDSNKEFVAEL----DGLVVNK 50 + A S T+ L L F A +L ++F L +G + Sbjct: 1 MDAYSTRP--LTLSHGSLEHVLLVPTASFFIASQL------QEQFNKILPEPTEGFAADD 52 Query: 51 D--------GKFKPIGYLPSDRLKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNAAVH 102 + GKF +GY+ S + E + ++ + Sbjct: 53 EPTTPAELVGKF--LGYV-SSLV------------EPSKV----GQFDQVL--------- 84 Query: 103 TKEILN--EKNMPYPFLGIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKI 160 L E +L G + +++A+ L L ++ Sbjct: 85 -NLCLTEFENC----YLE-GNDIHALAAKL-----------------------LQENDTT 115 Query: 161 NEIQNNWIRCY 171 I+ Y Sbjct: 116 LVKTKELIKNY 126 >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Score = 29.8 bits (67), Expect = 0.29 Identities = 13/53 (24%), Positives = 18/53 (33%), Gaps = 16/53 (30%) Query: 118 GIGKNSNSVASTLIRC-MGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIR 169 G GK STL + P G +L+D + NW+R Sbjct: 45 GSGK------STLTKLIQRF---------YIPENGQVLIDGHDLALADPNWLR 82 >2vqp_A Matrix protein; viral protein, peripheral membrane protein, RSV, virion, envelope protein; HET: GOL; 1.60A {Human respiratory syncytial virus A2} Length = 257 Score = 28.4 bits (63), Expect = 0.85 Identities = 10/16 (62%), Positives = 13/16 (81%) Query: 140 AIPNAKIAPYQGIILL 155 AI NAKI PY G++L+ Sbjct: 189 AITNAKIIPYSGLLLV 204 >1r8j_A KAIA; circadian clock protein; 2.03A {Synechococcus elongatus pcc 7942} SCOP: a.186.1.1 c.23.1.5 PDB: 1m2e_A 1m2f_A Length = 289 Score = 27.8 bits (62), Expect = 1.3 Identities = 11/58 (18%), Positives = 19/58 (32%), Gaps = 22/58 (37%) Query: 13 TIVLSQLTIGLF-----FAHRL----------LVVFDSNKEFVAEL-------DGLVV 48 IVLSQ+ I ++ L V +S + + D L++ Sbjct: 4 DIVLSQIAICIWVESTAILQDCQRALSADRYQLQVCESGEMLLEYAQTHRDQIDCLIL 61 >3o4x_E Protein diaphanous homolog 1; autoinhibition, actin nucleator, actin binding, protein BIND; 3.20A {Mus musculus} PDB: 2bap_D Length = 467 Score = 27.8 bits (61), Expect = 1.3 Identities = 17/95 (17%), Positives = 33/95 (34%), Gaps = 8/95 (8%) Query: 5 ESDTSQNFTIVLSQLTIGLFFAHRLLVVFDSNKEFVAELDGLVVNKDGKFKPIGYLPSDR 64 +S T+QN +I L + +++ + + + L+ K P P Sbjct: 103 DSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLI-----KQMPE---PEQL 154 Query: 65 LKVFEFKYPCLYKEDQEQVVLCSSSEECVMSRWNA 99 + E K + EQ + + + R NA Sbjct: 155 KMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNA 189 >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Score = 27.0 bits (60), Expect = 2.1 Identities = 11/52 (21%), Positives = 17/52 (32%), Gaps = 15/52 (28%) Query: 118 GIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIR 169 G GK STL+ ++ +G I +D + I R Sbjct: 57 GSGK------STLLSAF---------LRLLNTEGEIQIDGVSWDSITLEQWR 93 >1l2t_A Hypothetical ABC transporter ATP-binding protein MJ0796; ABC transporters, ATPase, walker-A, NBD, transport protein; HET: ATP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1f3o_A* Length = 235 Score = 25.9 bits (57), Expect = 4.2 Identities = 12/54 (22%), Positives = 26/54 (48%), Gaps = 8/54 (14%) Query: 116 FLGIGKNSNSVASTLIRCMGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIR 169 F+ I S S ST++ +G + P +G + +D+ K N++ ++ + Sbjct: 33 FVSIMGPSGSGKSTMLNIIGCLD--------KPTEGEVYIDNIKTNDLDDDELT 78 >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Score = 26.1 bits (57), Expect = 4.4 Identities = 12/53 (22%), Positives = 22/53 (41%), Gaps = 16/53 (30%) Query: 118 GIGKNSNSVASTLIRC-MGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIR 169 G GK ST+++ + P G + LD ++I ++ W+R Sbjct: 1069 GCGK------STVVQLLERFYD---------PMAGSVFLDGKEIKQLNVQWLR 1106 >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Score = 25.8 bits (56), Expect = 4.7 Identities = 10/55 (18%), Positives = 17/55 (30%), Gaps = 10/55 (18%) Query: 116 FLGIGKNSNSVASTLIRC-MGLKELAIPNAKIAPYQGIILLDDRKINEIQNNWIR 169 + + S S ST+ +G IL+D + E +R Sbjct: 371 TVALVGRSGSGKSTIASLITRF---------YDIDEGHILMDGHDLREYTLASLR 416 >1b7y_B Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer; HET: FYA; 2.50A {Thermus thermophilus} SCOP: a.6.1.1 a.6.1.1 b.40.4.4 b.153.1.1 d.58.13.1 d.104.1.1 PDB: 1b70_B* 1eiy_B 1jjc_B* 1pys_B 2akw_B* 2aly_B* 2amc_B* 3hfz_B* 2iy5_B* Length = 785 Score = 25.3 bits (54), Expect = 7.9 Identities = 5/32 (15%), Positives = 11/32 (34%) Query: 33 FDSNKEFVAELDGLVVNKDGKFKPIGYLPSDR 64 + + EL + +K F+ P+ Sbjct: 663 LELPPVHLFELRLPLPDKPLAFQDPSRHPAAF 694 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.321 0.137 0.408 Gapped Lambda K H 0.267 0.0492 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,409,009 Number of extensions: 59651 Number of successful extensions: 111 Number of sequences better than 10.0: 1 Number of HSP's gapped: 111 Number of HSP's successfully gapped: 13 Length of query: 171 Length of database: 5,693,230 Length adjustment: 86 Effective length of query: 85 Effective length of database: 3,608,246 Effective search space: 306700910 Effective search space used: 306700910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (24.8 bits)