Query gi|254780447|ref|YP_003064860.1| hypothetical protein CLIBASIA_01660 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 47 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Sun May 29 16:16:51 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780447.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam09775 Keratin_assoc Kerati 37.1 17 0.00042 18.4 1.2 33 14-47 26-58 (131) 2 pfam02281 Transposase_Tn5 Tran 24.6 32 0.00081 17.1 0.9 14 8-21 77-90 (109) 3 TIGR02749 prenyl_cyano solanes 24.0 14 0.00036 18.7 -1.0 37 1-38 81-123 (325) 4 pfam05112 Baculo_p47 Baculovir 16.7 31 0.00079 17.1 -0.5 20 9-28 128-157 (313) 5 PRK10381 ferric enterobactin t 14.2 1.1E+02 0.0029 14.5 1.8 29 10-41 33-61 (379) 6 TIGR00872 gnd_rel 6-phosphoglu 13.2 1.1E+02 0.0029 14.5 1.6 16 32-47 256-271 (341) 7 TIGR02808 short_TIGR02808 cons 12.0 1.5E+02 0.0039 13.9 2.1 24 23-46 18-41 (42) 8 PRK13711 conjugal transfer pro 11.8 55 0.0014 16.0 -0.4 12 11-22 3-14 (113) 9 TIGR02117 chp_urease_rgn conse 10.6 48 0.0012 16.3 -1.0 21 16-36 190-210 (212) 10 cd07321 Extradiol_Dioxygenase_ 10.3 1.3E+02 0.0033 14.2 1.1 20 13-32 47-66 (77) No 1 >pfam09775 Keratin_assoc Keratinocyte-associated protein 2. Members of this family comprise various keratinocyte-associated proteins. Their exact function has not, as yet, been determined. Probab=37.11 E-value=17 Score=18.41 Aligned_cols=33 Identities=30% Similarity=0.563 Sum_probs=19.3 Q ss_pred HHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCC Q ss_conf 2225444003999974202379999999875069 Q gi|254780447|r 14 WEGWLSIGVTTDLLSKFAAGSFLFILLLRAFSDF 47 (47) Q Consensus 14 wegwlsigvttdllskfaagsflfilllrafsdf 47 (47) ...|+.----..++.-| -||.+|+++|.+++.+ T Consensus 26 y~~~l~sSe~~ti~GGf-lgS~lFil~LTav~N~ 58 (131) T pfam09775 26 YRGQLASSELMTIFGGF-LGSLLFIFSLTAIGNL 58 (131) T ss_pred HHHHHCCCHHHHHHHHH-HHHHHHHHHHHHHHHH T ss_conf 58886202699999989-9999999999999789 No 2 >pfam02281 Transposase_Tn5 Transposase Tn5 dimerization domain. Transposons are mobile DNA sequences capable of replication and insertion into the chromosome. Typically transposons code for the transposase enzyme, which catalyses insertion, found between terminal inverted repeats. Tn5 has a unique method of self- regulation in which a truncated version of the transposase enzyme acts as an inhibitor. The catalytic domain of the Tn5 transposon is found in pfam01609. This domain mediates dimerization in the known structure. Probab=24.61 E-value=32 Score=17.10 Aligned_cols=14 Identities=36% Similarity=0.945 Sum_probs=10.4 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 12464422254440 Q gi|254780447|r 8 MHVNVLWEGWLSIG 21 (47) Q Consensus 8 mhvnvlwegwlsig 21 (47) --+.++||||...- T Consensus 77 asw~~lWeGW~~LQ 90 (109) T pfam02281 77 ASWGALWEGWEALQ 90 (109) T ss_pred CCHHHHHHHHHHHH T ss_conf 31999998899999 No 3 >TIGR02749 prenyl_cyano solanesyl diphosphate synthase; InterPro: IPR014120 This entry contains solanesyl diphosphate synthases from cyanobacteria or plastid-containing eukaryotes. A member from Arabidopsis (where both plastoquinone and ubiquinone contain the C(45) prenyl moiety) was characterised by heterologous expression as a solanesyl diphosphate synthase.. Probab=24.05 E-value=14 Score=18.72 Aligned_cols=37 Identities=46% Similarity=0.601 Sum_probs=28.1 Q ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHC------CHHHHHH Q ss_conf 9410012124644222544400399997420------2379999 Q gi|254780447|r 1 MLMHASLMHVNVLWEGWLSIGVTTDLLSKFA------AGSFLFI 38 (47) Q Consensus 1 mlmhaslmhvnvlwegwlsigvttdllskfa------agsflfi 38 (47) |.--|||.|=.|+=|-=.--|+.| .-|.|. ||-|||- T Consensus 81 mIHTASLVHDDV~DEsd~RRG~~T-Vhs~F~trvAVLAGDFLFA 123 (325) T TIGR02749 81 MIHTASLVHDDVIDESDVRRGVET-VHSLFGTRVAVLAGDFLFA 123 (325) T ss_pred HHHHHHHHCCCEECCCCCCCCCCC-CCCCCCCEEEEECCCHHHH T ss_conf 775232220220035434488855-3456848167620406789 No 4 >pfam05112 Baculo_p47 Baculovirus P47 protein. This family consists of several Baculovirus P47 proteins which is one of the primary components of Baculovirus encoded RNA polymerase, which initiates transcription from late and very late promoters. Probab=16.73 E-value=31 Score=17.12 Aligned_cols=20 Identities=55% Similarity=0.821 Sum_probs=15.1 Q ss_pred HHHHHHHH----------HHHHHHHHHHHH Q ss_conf 24644222----------544400399997 Q gi|254780447|r 9 HVNVLWEG----------WLSIGVTTDLLS 28 (47) Q Consensus 9 hvnvlweg----------wlsigvttdlls 28 (47) --||+||- -|||-+||.|.. T Consensus 128 ~cN~lWERGYEdhYTLGQQLSIriTTkLIQ 157 (313) T pfam05112 128 ACNVLWERGYEDHYTLGQQLSIRITTKLIQ 157 (313) T ss_pred HHHHHEECCCCCCCCCCCEEEEEEEHHHHH T ss_conf 876020025556777543489875233564 No 5 >PRK10381 ferric enterobactin transport protein FepE; Provisional Probab=14.15 E-value=1.1e+02 Score=14.51 Aligned_cols=29 Identities=31% Similarity=0.485 Sum_probs=17.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHH Q ss_conf 46442225444003999974202379999999 Q gi|254780447|r 10 VNVLWEGWLSIGVTTDLLSKFAAGSFLFILLL 41 (47) Q Consensus 10 vnvlwegwlsigvttdllskfaagsflfilll 41 (47) ..+||.|+.-|-.+|-+ |+.++..+.+++ T Consensus 33 f~~LW~gK~~II~it~l---fa~~av~ya~~~ 61 (379) T PRK10381 33 ISVLWKAKKKIIAVTFA---FACAGLLVSFIL 61 (379) T ss_pred HHHHHHCCHHHHHHHHH---HHHHHHHHHHHC T ss_conf 99998354889999999---999999999818 No 6 >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating); InterPro: IPR004849 This family resembles a larger family of bacterial and eukaryotic 6-phosphogluconate dehydrogenases (Gnd) but differs from it by a deep split in a UPGMA similarity clustering tree and the lack of a central region of about 140 residues. Among complete genomes, it is found is found in Bacillus subtilis and Mycobacterium tuberculosis, both of which also contain Gnd, and in Aquifex aeolicus. . Probab=13.18 E-value=1.1e+02 Score=14.52 Aligned_cols=16 Identities=31% Similarity=0.416 Sum_probs=13.3 Q ss_pred CHHHHHHHHHHHHHCC Q ss_conf 2379999999875069 Q gi|254780447|r 32 AGSFLFILLLRAFSDF 47 (47) Q Consensus 32 agsflfilllrafsdf 47 (47) -+|||.=|+.|||.++ T Consensus 256 IrSwL~dLt~~Af~~~ 271 (341) T TIGR00872 256 IRSWLLDLTAKAFEES 271 (341) T ss_pred EEHHHHHHHHHHHHCC T ss_conf 4126888999997507 No 7 >TIGR02808 short_TIGR02808 conserved hypothetical protein TIGR02808; InterPro: IPR014175 This very small protein (about 46 amino acids) consists largely of a single predicted membrane-spanning region. It is found in Photobacterium profundum SS9 and in three species of Vibrio, always near periplasmic nitrate reductase genes, but far from the periplasmic nitrate reductase genes in Aeromonas hydrophila ATCC 7966.. Probab=11.96 E-value=1.5e+02 Score=13.91 Aligned_cols=24 Identities=38% Similarity=0.367 Sum_probs=20.3 Q ss_pred HHHHHHHHCCHHHHHHHHHHHHHC Q ss_conf 399997420237999999987506 Q gi|254780447|r 23 TTDLLSKFAAGSFLFILLLRAFSD 46 (47) Q Consensus 23 ttdllskfaagsflfilllrafsd 46 (47) ..=.|+-|.|-+-.-|.||.+++| T Consensus 18 P~I~L~GF~aVaV~s~~LL~~~~~ 41 (42) T TIGR02808 18 PVIILSGFVAVAVVSILLLALKKD 41 (42) T ss_pred HHHHHHHHHHHHHHHHHHHHHHCC T ss_conf 799998899999999999964237 No 8 >PRK13711 conjugal transfer protein TrbJ; Provisional Probab=11.76 E-value=55 Score=15.98 Aligned_cols=12 Identities=42% Similarity=1.168 Sum_probs=8.4 Q ss_pred HHHHHHHHHHHH Q ss_conf 644222544400 Q gi|254780447|r 11 NVLWEGWLSIGV 22 (47) Q Consensus 11 nvlwegwlsigv 22 (47) .|||.||...-- T Consensus 3 pvlwrgwipfcr 14 (113) T PRK13711 3 PVLWRGWIPFCR 14 (113) T ss_pred CEEECCCCCEEE T ss_conf 612315522468 No 9 >TIGR02117 chp_urease_rgn conserved hypothetical protein; InterPro: IPR011727 This conserved hypothetical protein of unknown function is found in several Proteobacteria. Its function is unknown and its genome context is not well-conserved. It is found amid urease genes in at least one species.. Probab=10.60 E-value=48 Score=16.26 Aligned_cols=21 Identities=29% Similarity=0.278 Sum_probs=16.7 Q ss_pred HHHHHHHHHHHHHHHCCHHHH Q ss_conf 254440039999742023799 Q gi|254780447|r 16 GWLSIGVTTDLLSKFAAGSFL 36 (47) Q Consensus 16 gwlsigvttdllskfaagsfl 36 (47) +--|+|++|.+-+||.+++++ T Consensus 190 ~L~~aGlrt~~w~pl~~~l~~ 210 (212) T TIGR02117 190 ALRSAGLRTGLWSPLPQGLRW 210 (212) T ss_pred HHHHCCCEECCCCCCCCHHHC T ss_conf 998456032156654310101 No 10 >cd07321 Extradiol_Dioxygenase_3A_like Subunit A of Class III extradiol dioxygenases. Extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings. There are two major groups of dioxygenases according to the cleavage site of the aromatic ring. Intradiol enzymes cleave the aromatic ring between two hydroxyl groups, whereas extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Extradiol dioxygenases can be divided into three classes. Class I and II enzymes are evolutionary related and show sequence similarity, with the two domain class II enzymes evolving from the class I enzyme through gene duplication. Class III enzymes are different in sequence and structure and usually have two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents subunit A of c Probab=10.29 E-value=1.3e+02 Score=14.22 Aligned_cols=20 Identities=30% Similarity=0.295 Sum_probs=17.7 Q ss_pred HHHHHHHHHHHHHHHHHHCC Q ss_conf 42225444003999974202 Q gi|254780447|r 13 LWEGWLSIGVTTDLLSKFAA 32 (47) Q Consensus 13 lwegwlsigvttdllskfaa 32 (47) =|.+-..+||.--++.|||+ T Consensus 47 D~~~L~~lGvn~~ll~~~a~ 66 (77) T cd07321 47 DVGALYVLGVNPMLLMHFAI 66 (77) T ss_pred CHHHHHHCCCCHHHHHHHHH T ss_conf 89999997996999999998 Done!