RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780447|ref|YP_003064860.1| hypothetical protein CLIBASIA_01660 [Candidatus Liberibacter asiaticus str. psy62] (47 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 29.1 bits (65), Expect = 0.22 Identities = 13/72 (18%), Positives = 21/72 (29%), Gaps = 28/72 (38%) Query: 4 HASLMHVNVLWEGWL-SIGVTTD-------------LLSKF-----------AAGSFLFI 38 AS + L E + + T+ L+ KF G F + Sbjct: 24 TASFFIASQLQEQFNKILPEPTEGFAADDEPTTPAELVGKFLGYVSSLVEPSKVGQFDQV 83 Query: 39 L--LLRAF-SDF 47 L L F + + Sbjct: 84 LNLCLTEFENCY 95 >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 Score = 24.5 bits (53), Expect = 6.0 Identities = 11/44 (25%), Positives = 19/44 (43%), Gaps = 10/44 (22%) Query: 8 MHVNVLW-----EGWLSIGVTTDLLSKFAAGSFLFILLLRAFSD 46 H++ LW G++ D L G+F ++R FS+ Sbjct: 343 RHISTLWQEGIIYGYMGRQEVNDALQNQDPGTF----IIR-FSE 381 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.334 0.141 0.452 Gapped Lambda K H 0.267 0.0582 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 364,523 Number of extensions: 9257 Number of successful extensions: 18 Number of sequences better than 10.0: 1 Number of HSP's gapped: 18 Number of HSP's successfully gapped: 2 Length of query: 47 Length of database: 5,693,230 Length adjustment: 20 Effective length of query: 27 Effective length of database: 5,208,350 Effective search space: 140625450 Effective search space used: 140625450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 50 (23.4 bits)