RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780448|ref|YP_003064861.1| hypothetical protein CLIBASIA_01665 [Candidatus Liberibacter asiaticus str. psy62] (311 letters) >gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein. This model describes glucan exporter ATP binding protein in bacteria. It belongs to the larger ABC transporter superfamily with the characteristic ATP binding motif. The In general, this protein is in some ways implicated in osmoregulation and suggested to participate in the export of glucan from the cytoplasm to periplasm. The cyclic beta-1,2-glucan in the bactrerial periplasmic space is suggested to confer the property of high osmolority. It has also been demonstrated that mutants in this loci have lost functions of virulence and motility. It is unclear as to how virulence and osmoadaptaion are related. Length = 585 Score = 31.0 bits (70), Expect = 0.45 Identities = 14/63 (22%), Positives = 29/63 (46%) Query: 38 GKVLFGLVRGSSIATKIATTGIATVVQEATVMTKTTQEGALLAKEGIEATHIMEGGSTAI 97 G++L + +++ + IATV Q+A + ++ +E L +EG + E A Sbjct: 390 GQILIDGIDINTVTRESLRKSIATVFQDAGLFNRSIRENIRLGREGATDEEVYEAAKAAA 449 Query: 98 KSE 100 + Sbjct: 450 AHD 452 >gnl|CDD|102532 PRK06755, PRK06755, hypothetical protein; Validated. Length = 209 Score = 30.0 bits (67), Expect = 0.88 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Query: 246 NIYQLSNPRYSYQFNTLKDKTISFVAKEEGLVTYLNGSLHRNYGIKAEGILSRNAP 301 +IY+ S+ Q T+ IS + EEG VT+ S+ R +G EGI P Sbjct: 85 DIYKKSSAECILQVQTVDSHLISELYGEEGEVTFDKRSVERVFG--KEGITEMTIP 138 >gnl|CDD|180713 PRK06826, dnaE, DNA polymerase III DnaE; Reviewed. Length = 1151 Score = 29.9 bits (68), Expect = 0.91 Identities = 21/83 (25%), Positives = 27/83 (32%), Gaps = 12/83 (14%) Query: 150 PLEEYPR-LQKIGINYFRDFKLLGTNKVYKNLLDASRAT-EFIIDGKKINIDSAQNMLAE 207 PLEEY L+K D L D + II K M+A Sbjct: 957 PLEEYEETLKKQTSATISDIISDEEEDGESKLKDGDKVIIGGIITEVKRKTTRNNEMMAF 1016 Query: 208 LNK----------IFPKDFEKVQ 220 L +FPK +EK + Sbjct: 1017 LTLEDLYGTVEVIVFPKVYEKYR 1039 >gnl|CDD|180130 PRK05562, PRK05562, precorrin-2 dehydrogenase; Provisional. Length = 223 Score = 28.1 bits (63), Expect = 2.8 Identities = 13/46 (28%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Query: 229 HIFCKPFTKDLLNLANKNIYQLSNPRYSYQFNTLKDKTISFVAKEE 274 +I K F+K+ L+L +L Y +F +KDK + +A ++ Sbjct: 52 YILSKKFSKEFLDLKKYGNLKLIKGNYDKEF--IKDKHLIVIATDD 95 >gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein. Length = 214 Score = 27.6 bits (62), Expect = 4.3 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Query: 149 MPLEEYPRL-QKIGINYFRDFKLLGTNKVYKN 179 + + P L ++IG+ F+DF+LL VY+N Sbjct: 69 LRGRQLPLLRRRIGV-VFQDFRLLPDRTVYEN 99 >gnl|CDD|129918 TIGR00838, argH, argininosuccinate lyase. This model describes argininosuccinate lyase, but may include examples of avian delta crystallins, in which argininosuccinate lyase activity may or may not be present and the biological role is to provide the optically clear cellular protein of the eye lens. Length = 455 Score = 27.3 bits (61), Expect = 5.3 Identities = 11/32 (34%), Positives = 18/32 (56%) Query: 161 GINYFRDFKLLGTNKVYKNLLDASRATEFIID 192 I+ +LLG + V +N LDA +FI++ Sbjct: 204 PIDREYLAELLGFDAVTENSLDAVSDRDFILE 235 >gnl|CDD|117618 pfam09052, SipA, Salmonella invasion protein A. Salmonella invasion protein A is an actin-binding protein that contributes to host cytoskeletal rearrangements by stimulating actin polymerisation and counteracting F-actin destabilising proteins. Members of this family possess an all-helical fold consisting of eight alpha-helices arranged so that six long, amphipathic helices form a compact fold that surrounds a final, predominantly hydrophobic helix in the middle of the molecule. Length = 674 Score = 27.3 bits (60), Expect = 5.6 Identities = 18/96 (18%), Positives = 35/96 (36%), Gaps = 4/96 (4%) Query: 47 GSSIATKIATTGIATVVQEATVMTKTTQEGALLAKEGIEATHIMEGGSTAIKSESVGAKE 106 G+ I + G+ T QE + ++ G L + + + + GA+ Sbjct: 413 GAVRLAGIGSDGLTTSSQERSANNSLSRGGRPLNI----QNSSVTDPLHPVLTAADGAEG 468 Query: 107 LISASQNSQTVTQTGNISDATKASSTIKDAQSIDRS 142 + S++ NS T++G A K + D Sbjct: 469 VKSSTDNSSDTTKSGASLSHRVAGQINKFNSNTDSK 504 >gnl|CDD|181775 PRK09314, PRK09314, bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional. Length = 339 Score = 26.5 bits (59), Expect = 8.6 Identities = 20/97 (20%), Positives = 39/97 (40%), Gaps = 21/97 (21%) Query: 210 KIFPKDFEKVQLISSYAHEHI-FCKPFTKDLLNLAN-------KNIYQLSNPRYSYQFNT 261 + EK + +EHI F F ++ N + L++ ++S Sbjct: 214 EFAGFKAEKYTFLDHLQNEHIAFK--F-GEIKLTPNVKFHKIGSDFELLTSDKFSELL-- 268 Query: 262 LKDKTISFVAKEEGLVTYLNG-----SLHRNYGIKAE 293 K I ++ K G++ +LN + ++YGI A+ Sbjct: 269 ---KAIEYLKKNGGVLIFLNTESKENNQVKDYGIGAQ 302 >gnl|CDD|178304 PLN02701, PLN02701, alpha-mannosidase. Length = 1050 Score = 26.3 bits (58), Expect = 9.4 Identities = 20/57 (35%), Positives = 26/57 (45%) Query: 53 KIATTGIATVVQEATVMTKTTQEGALLAKEGIEATHIMEGGSTAIKSESVGAKELIS 109 KI G TVV E M + GA L K EA I++ G + SE +E+ S Sbjct: 664 KIHKNGSETVVGEEIGMYSSQGSGAYLFKPDGEAQPIVQAGGLVVVSEGPLVQEVHS 720 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.315 0.131 0.362 Gapped Lambda K H 0.267 0.0766 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 4,763,097 Number of extensions: 292680 Number of successful extensions: 658 Number of sequences better than 10.0: 1 Number of HSP's gapped: 658 Number of HSP's successfully gapped: 29 Length of query: 311 Length of database: 5,994,473 Length adjustment: 93 Effective length of query: 218 Effective length of database: 3,984,929 Effective search space: 868714522 Effective search space used: 868714522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 57 (25.7 bits)