HHsearch alignment for GI: 254780452 and conserved domain: COG0670

>COG0670 Integral membrane protein, interacts with FtsH [General function prediction only].
Probab=100.00  E-value=0  Score=316.70  Aligned_cols=225  Identities=47%  Similarity=0.762  Sum_probs=198.3

Q ss_pred             CCH-HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             940-1454210232000245566999999999999999999999999999985455666556678764457999999998
Q gi|254780452|r    1 MSD-IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALM   79 (259)
Q Consensus         1 m~~-~~n~~~~~~~~~~~~~~~d~~lr~Fi~kVY~~la~~L~iT~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (259)
T Consensus         1 m~~~~~~~~~~~~~~~------~~~~~~f~~~vY~~~~~~L~~t~~~a~~~~~~~~~~~~------------------~-   55 (233)
T COG0670           1 MNMFDRSYSRIQAFKS------DLGLNTFLRKVYLLLALGLLVTAVGAALAAYLLFNLGL------------------L-   55 (233)
T ss_pred             CCCCHHHHCCCCCCCC------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------------H-
T ss_conf             9851142302100014------17899999999999999999999999999998887410------------------1-


Q ss_pred             HCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHH
Q ss_conf             3284326777788999998776540145420123899999998776789999742178----899999999999999999
Q gi|254780452|r   80 YTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS----IVQTFFITAASFGSLSLY  155 (259)
Q Consensus        80 ~~~~~~~v~~~~~l~l~~~~~~~~~~~s~~~~~~l~~~f~~~~G~tls~i~~~y~~~~----I~~A~~~Ta~if~~ls~~  155 (259)
T Consensus        56 ~~~~~~~vl~~a~l~~~~~~~~~~~~-s~~~~~~~~~~~t~l~G~tL~~i~~~Y~~~~~~~~i~~af~~t~~~F~~ls~~  134 (233)
T COG0670          56 SLSPPGFVLIIAGLAGVFFLSRKINK-SSPTALILFFVYTALVGLTLSPILLVYAAISGGDAIAAAFGITALVFGALSLY  134 (233)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHCC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             02459999999999999999998514-76249999999999999999999999984054408999999999999999999


Q ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHH
Q ss_conf             98655555542035789999999999997413660799999999999999999999999999721567654350479999
Q gi|254780452|r  156 GYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIG  235 (259)
Q Consensus       156 ~~~tk~D~s~~g~~L~~~l~~lii~~i~~~F~~s~~~~~~~s~~g~~iFs~~i~yDtQ~I~~~~~~~~~~~~~~~~~I~~  235 (259)
T Consensus       135 g~~tk~Dls~l~~~l~~aligLiiasvvn~Fl~s~~l~~~IS~lgvlifsgli~yDtq~I~~~-------~~~~~~~i~~  207 (233)
T COG0670         135 GYTTKRDLSSLGSFLFMALIGLIIASLVNIFLGSSALHLAISVLGVLIFSGLIAYDTQNIKRM-------EGGERLAIMG  207 (233)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HCCCHHHHHH
T ss_conf             999852387799999999999999999999975838999999999999999999999999987-------0340259999


Q ss_pred             HHHHHHHHHHHHHHHHHHHC---CCC
Q ss_conf             99999999999999999937---789
Q gi|254780452|r  236 ALMLYMDFIQIFVHLLRFLG---SRR  258 (259)
Q Consensus       236 Al~LYlDiiNlFl~iL~ilG---~rr  258 (259)
T Consensus       208 AlsLYldfiNlF~~LL~i~g~~~~r~  233 (233)
T COG0670         208 ALSLYLDFINLFLSLLRILGILSNRR  233 (233)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             99999999999999999972401689