BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780452|ref|YP_003064865.1| hypothetical protein
CLIBASIA_01685 [Candidatus Liberibacter asiaticus str. psy62]
         (259 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780452|ref|YP_003064865.1| hypothetical protein CLIBASIA_01685 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040129|gb|ACT56925.1| hypothetical protein CLIBASIA_01685 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 259

 Score =  510 bits (1313), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 259/259 (100%), Positives = 259/259 (100%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD
Sbjct: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
           AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA
Sbjct: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL
Sbjct: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY
Sbjct: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           MDFIQIFVHLLRFLGSRRD
Sbjct: 241 MDFIQIFVHLLRFLGSRRD 259


>gi|315122100|ref|YP_004062589.1| hypothetical protein CKC_01750 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495502|gb|ADR52101.1| hypothetical protein CKC_01750 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 259

 Score =  364 bits (934), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 181/259 (69%), Positives = 219/259 (84%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MSDIR+YQRV NS  GF STIDQGLRAYMI+VYNLMALGL VTGI+SFL++  ATT+DP 
Sbjct: 1   MSDIRDYQRVQNSRGGFDSTIDQGLRAYMIKVYNLMALGLVVTGIVSFLISGFATTLDPY 60

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
           AAS ++  GVMLT FG L+Y SPL W+ +FAPLGV IF++VR++SLS  AA++ F +Y+A
Sbjct: 61  AASYVLKSGVMLTSFGTLLYASPLSWVVMFAPLGVCIFMSVRINSLSINAARITFFVYAA 120

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           LIGL++SS F++YT+KSIVQTFFITAASF SLSLYGYTTK+DLGPIGSFM+MG  GLFLL
Sbjct: 121 LIGLAISSIFIMYTNKSIVQTFFITAASFVSLSLYGYTTKKDLGPIGSFMLMGVCGLFLL 180

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            L N+FM SS +D+ ++AMG+VIFSALTAYDTQ IKE Y+D Y + Y ERQSV+GAL LY
Sbjct: 181 MLANIFMGSSVVDMAIAAMGVVIFSALTAYDTQVIKEQYADNYGMEYIERQSVLGALRLY 240

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           MDF+ IF+ LLR LG+RRD
Sbjct: 241 MDFVNIFISLLRLLGNRRD 259


>gi|15889937|ref|NP_355618.1| hypothetical protein Atu2682 [Agrobacterium tumefaciens str. C58]
 gi|15157894|gb|AAK88403.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 260

 Score =  294 bits (753), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 149/260 (57%), Positives = 197/260 (75%), Gaps = 1/260 (0%)

Query: 1   MSDIRNYQ-RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D  NYQ R+  + +  G+ ID+GLRAYM++VYNLMAL L +TG+ +F   +LATT DP
Sbjct: 1   MADFNNYQNRMAQTRAQSGAMIDEGLRAYMLKVYNLMALALVITGVAAFGFAMLATTTDP 60

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
            AA   +  G MLT  GAL+Y SPLRW+ + APLG+  FL+ R+ ++S  AA+  F +Y+
Sbjct: 61  AAAVATLPNGKMLTSLGALVYASPLRWVVMLAPLGLVFFLSFRIQNMSVSAAQSTFWVYA 120

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           AL+G+SLSS FL YT  SIVQTFF+TAASFG+LSLYGYTTK+DL  IGSF+IMG FGL +
Sbjct: 121 ALMGVSLSSIFLRYTEGSIVQTFFVTAASFGALSLYGYTTKKDLSGIGSFLIMGLFGLII 180

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            S+VN+F+ S A+   +SA+G++IF+ LTAYDTQKIKE Y D  DVA A R++++GAL L
Sbjct: 181 ASIVNIFLGSGALQFAISAIGVLIFAGLTAYDTQKIKEMYFDADDVAVAGRKAIMGALTL 240

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y+DFI +F  LL+FLG+R D
Sbjct: 241 YLDFINLFTFLLQFLGNRND 260


>gi|222150083|ref|YP_002551040.1| hypothetical protein Avi_4182 [Agrobacterium vitis S4]
 gi|221737065|gb|ACM38028.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 256

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 141/258 (54%), Positives = 194/258 (75%), Gaps = 2/258 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MSD RNYQ    +G G    IDQGLR+YM++VYNLM LGL +TG+ ++++ +LATT D  
Sbjct: 1   MSDFRNYQ--ARTGVGSAEMIDQGLRSYMLKVYNLMGLGLAITGVAAYVIAMLATTTDTS 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A      G+MLT  GA +Y SPL+W+ + AP+G+  FL+ ++ S+S  AA+  FL+Y+ 
Sbjct: 59  QAVGQFGNGIMLTSLGAAIYGSPLKWVIMLAPIGLVFFLSFKIQSMSVSAARTTFLVYAG 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L+YT +S+VQTFF+TAASFG+LSLYGYTTKR L  +GSF+IMG FGL + 
Sbjct: 119 LVGLSLSSILLIYTGQSVVQTFFVTAASFGALSLYGYTTKRSLSAMGSFLIMGLFGLIIA 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           SLVN+F++SSA+   +SA+G+VIF+ LTAYDTQKIKE Y ++     A R++++GAL LY
Sbjct: 179 SLVNIFLQSSALAFAVSAIGVVIFAGLTAYDTQKIKEMYFEQDGADTAGRKAILGALTLY 238

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DFI +F+ +LRF+G RR
Sbjct: 239 LDFINLFLFMLRFMGDRR 256


>gi|86359520|ref|YP_471412.1| hypothetical protein RHE_CH03940 [Rhizobium etli CFN 42]
 gi|86283622|gb|ABC92685.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 242

 Score =  279 bits (713), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 191/258 (74%), Gaps = 16/258 (6%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D+RNYQ  V +G      IDQGLRAYM++VYNLMALGL +TG+ ++L           
Sbjct: 1   MADLRNYQSRVQTGE----MIDQGLRAYMLKVYNLMALGLAITGVAAYL----------- 45

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
             +  +  G  LT FG L++ SPLRW+ I APL V  FL+ R+H +S  AA+  F +Y+A
Sbjct: 46  GFNFAVQDG-QLTQFGVLLFQSPLRWVVILAPLAVVFFLSFRIHQMSVSAAQTTFWIYAA 104

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS FLVYT +S+VQTFF+TAASFG+LSLYGYTTKRDL  +GSF+IMG FGL + 
Sbjct: 105 LVGLSLSSIFLVYTGQSVVQTFFVTAASFGALSLYGYTTKRDLSAMGSFLIMGLFGLIIA 164

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           SLVN+F+ SSA+   +S +G++IF+ LTAYDTQ+IKE Y +  DVA A R++++GAL LY
Sbjct: 165 SLVNIFLASSALQFAISVIGVLIFAGLTAYDTQRIKELYYEADDVAVAGRKAIMGALTLY 224

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DF+ +F+ LL+F+G+RR
Sbjct: 225 LDFLNLFMFLLQFMGNRR 242


>gi|190893788|ref|YP_001980330.1| hypothetical protein [Rhizobium etli CIAT 652]
 gi|190699067|gb|ACE93152.1| hypothetical conserved membrane protein [Rhizobium etli CIAT 652]
 gi|327190200|gb|EGE57305.1| hypothetical conserved membrane protein [Rhizobium etli CNPAF512]
          Length = 242

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 139/258 (53%), Positives = 190/258 (73%), Gaps = 16/258 (6%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D+RNYQ    +G      IDQGLRAYM++VYNLMALGL +TG+ ++L   LA +    
Sbjct: 1   MADLRNYQSRAQTGE----MIDQGLRAYMLKVYNLMALGLAITGVAAYLSFQLAFSNGE- 55

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                      +T FG  +Y SPL+W+ I APL +  FL+ R+HS++  AA+  F +Y+A
Sbjct: 56  -----------ITAFGQAIYLSPLKWVVILAPLALVFFLSFRIHSMTVSAAQTTFAIYAA 104

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS FL+YT +S+VQTFF+TAASFG+LSLYGYTTKRDL  IGSF+IMG FGL + 
Sbjct: 105 LVGLSLSSIFLIYTGQSVVQTFFVTAASFGALSLYGYTTKRDLSAIGSFLIMGLFGLIIA 164

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           SLVN+F+ SSA+   +S +G++IF+ LTAYDTQ+IKE Y +  DVA A R++++GAL LY
Sbjct: 165 SLVNVFLASSAMQFAISVIGVLIFAGLTAYDTQRIKELYYEADDVAVAGRKAIMGALTLY 224

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DFI +F+ LL+F+G+R+
Sbjct: 225 LDFINLFMFLLQFMGNRK 242


>gi|260467318|ref|ZP_05813492.1| protein of unknown function UPF0005 [Mesorhizobium opportunistum
           WSM2075]
 gi|259028922|gb|EEW30224.1| protein of unknown function UPF0005 [Mesorhizobium opportunistum
           WSM2075]
          Length = 257

 Score =  275 bits (702), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 144/259 (55%), Positives = 189/259 (72%), Gaps = 6/259 (2%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA 61
             IRNYQ  V  G+G    IDQGLRAYM++VYNLM LGL +TG+ +    +LATT DP +
Sbjct: 3   EPIRNYQTRVVPGAGV--DIDQGLRAYMVKVYNLMGLGLLITGLAAVGTIMLATTTDPAS 60

Query: 62  ASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
           A   +  G MLT FG  ++ SPLRW+ I APL   +FL+ R+ S+S  AA+  F +Y+ L
Sbjct: 61  AVATLPSGEMLTSFGYAIFGSPLRWVVILAPLAAVMFLSFRVQSMSVSAAQTTFWVYAGL 120

Query: 122 IGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS 181
           +GLSLSS FLVYT+ SI QTFF TAA FG+LSLYGYTTKRDL  +GSF+IMG FGL +  
Sbjct: 121 VGLSLSSIFLVYTTASIAQTFFATAAGFGALSLYGYTTKRDLTAMGSFLIMGVFGLIIAM 180

Query: 182 LVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALML 239
           ++N+F++SSA+   +SA+G++IF+ LTAYDTQKIKE Y   D  DV  A R++++GAL L
Sbjct: 181 VINIFLQSSALSFAVSAIGVLIFAGLTAYDTQKIKEMYFEGDASDV--AGRKAIMGALRL 238

Query: 240 YMDFIQIFVHLLRFLGSRR 258
           Y+DFI +F+ LL+F+G RR
Sbjct: 239 YLDFINLFMFLLQFMGDRR 257


>gi|222087505|ref|YP_002546042.1| hypothetical protein Arad_4388 [Agrobacterium radiobacter K84]
 gi|221724953|gb|ACM28109.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 247

 Score =  271 bits (694), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 193/259 (74%), Gaps = 13/259 (5%)

Query: 1   MSDIRNYQ-RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D RNYQ R   +G+  G+ ID+GLRAYM++VYNLMALGL +TG+ ++           
Sbjct: 1   MADFRNYQNRTPQAGAQTGAMIDEGLRAYMLKVYNLMALGLAITGLAAYF---------- 50

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
            A S+  + G  +T FG  +Y SPL+W+ IFAPL +  FL+ R++S+S  AA   F +Y+
Sbjct: 51  -AFSLSFSDG-QITAFGQAIYQSPLKWVVIFAPLAMVFFLSFRINSMSVAAATTTFWVYA 108

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           AL+GLSLSS F++YT +S+VQTFF+TAASFG+LSLYGYTTKRDL  +GSF++MG FGL +
Sbjct: 109 ALVGLSLSSIFIIYTGQSVVQTFFVTAASFGALSLYGYTTKRDLSAMGSFLMMGLFGLII 168

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            SLVN+F+ SSA+   +S +G++IF+ LTAYDTQ+IKE Y    DVA A R++++GAL L
Sbjct: 169 ASLVNIFLASSAMQFAISVIGVLIFAGLTAYDTQRIKEMYYQADDVAVAGRKAIMGALSL 228

Query: 240 YMDFIQIFVHLLRFLGSRR 258
           Y+DFI +F+ LL+F+G+R+
Sbjct: 229 YLDFINLFMFLLQFMGNRK 247


>gi|325294052|ref|YP_004279916.1| hypothetical protein AGROH133_08964 [Agrobacterium sp. H13-3]
 gi|325061905|gb|ADY65596.1| hypothetical protein AGROH133_08964 [Agrobacterium sp. H13-3]
          Length = 245

 Score =  271 bits (693), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 139/258 (53%), Positives = 192/258 (74%), Gaps = 16/258 (6%)

Query: 1   MSDIRNYQ-RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D  NYQ R+  + +  G+ ID+GLRAYM++VYNLMAL L +TG+ +F    LATT +P
Sbjct: 1   MADFNNYQNRMAQTRAQTGAMIDEGLRAYMLKVYNLMALALVITGVAAFATFTLATT-NP 59

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                          F  L+Y SPLRW+ + APLG+  FL+ R+ ++S  AA+M F +Y+
Sbjct: 60  --------------AFAQLLYASPLRWVVMLAPLGLVFFLSFRIQNMSVSAAQMTFWVYA 105

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           AL+G+SLSS FLVYT +S+VQTFF+TAASFG+LSLYGYTTK+DL  +GSF+IMG FGL +
Sbjct: 106 ALMGVSLSSIFLVYTGQSVVQTFFVTAASFGALSLYGYTTKKDLSGMGSFLIMGLFGLII 165

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            S+VN+F+ SSA+   +SA+G++IF+ LTAYDTQKIKE Y D  +VA A R++++GAL L
Sbjct: 166 ASIVNIFLASSALQFAISAIGVLIFAGLTAYDTQKIKEMYFDGDEVAVAGRKAIMGALTL 225

Query: 240 YMDFIQIFVHLLRFLGSR 257
           Y+DFI +F+ LL+F+G+R
Sbjct: 226 YLDFINLFMFLLQFMGNR 243


>gi|209551305|ref|YP_002283222.1| hypothetical protein Rleg2_3734 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537061|gb|ACI56996.1| protein of unknown function UPF0005 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 242

 Score =  271 bits (692), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 138/258 (53%), Positives = 189/258 (73%), Gaps = 16/258 (6%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D+RNYQ    +G      IDQGLRAYM++VYNLMALGL +TG+ ++L           
Sbjct: 1   MADLRNYQSRAQTGE----MIDQGLRAYMLKVYNLMALGLAITGVAAYL----------- 45

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
             +  +  G  LT FG L++ SPLRW+ I APL    FL+ R++S+S  AA+  F +Y+ 
Sbjct: 46  GFNFAVQDG-QLTQFGVLLFQSPLRWVVILAPLAAVFFLSFRINSMSVAAAQTTFWVYAG 104

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS FLVYT +S+VQTFF+TAASFG+LSLYGYTTKRDL  +GSF+IMG FGL + 
Sbjct: 105 LVGLSLSSIFLVYTGQSVVQTFFVTAASFGALSLYGYTTKRDLSAMGSFLIMGLFGLIIA 164

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           S+VN+F+ SSA+   +S +G++IF+ LTAYDTQ+IKE Y +  DVA A R++++GAL LY
Sbjct: 165 SIVNIFLASSAMQFAISVIGVLIFAGLTAYDTQRIKELYLEADDVAVAGRKAIMGALTLY 224

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DFI +F+ LL+F+G+R+
Sbjct: 225 LDFINLFMFLLQFMGNRK 242


>gi|110635681|ref|YP_675889.1| hypothetical protein Meso_3353 [Mesorhizobium sp. BNC1]
 gi|110286665|gb|ABG64724.1| protein of unknown function UPF0005 [Chelativorans sp. BNC1]
          Length = 248

 Score =  268 bits (684), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 134/259 (51%), Positives = 189/259 (72%), Gaps = 11/259 (4%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D+RNYQ  V  G+   + ID+GLRAYMIRVYNLMALGL +TG+ ++     A   D  
Sbjct: 1   MADLRNYQARVTPGARVDTAIDEGLRAYMIRVYNLMALGLAITGLAAWGAFNFAVAADGQ 60

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                      LT FG L++ SPL+W+ IFAPL +  F++ R+H+LS  AA+ +F +Y+A
Sbjct: 61  -----------LTAFGQLLFVSPLKWVIIFAPLALVFFISFRIHTLSVSAAQSIFWVYAA 109

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLS+ FLVYT +SIV+TFFITAASFG+LSL+GYTT+RDL  +GSF+ MG  G+ + 
Sbjct: 110 LVGLSLSTIFLVYTQESIVRTFFITAASFGALSLWGYTTRRDLSGMGSFLFMGLIGIVIA 169

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           S+VN+F+ SSA+   +S +G+++F+ LTAYDTQ+IKE Y +  D   A R++++GAL LY
Sbjct: 170 SIVNIFLGSSALQFAISVIGVLVFAGLTAYDTQQIKEMYYEGDDQLVAGRKAIMGALRLY 229

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DF+ +F+ LL+FLGS R+
Sbjct: 230 LDFLNLFMFLLQFLGSNRE 248


>gi|116254259|ref|YP_770097.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258907|emb|CAK10016.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 242

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 134/258 (51%), Positives = 188/258 (72%), Gaps = 16/258 (6%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D+RNYQ    +G      IDQGLRAYM++VYNLMALGL +TG+ ++L    A      
Sbjct: 1   MADLRNYQSRAQTGE----MIDQGLRAYMLKVYNLMALGLAITGVAAYLSFQFAFANGE- 55

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                      LT FG  +Y SPL+W+ I APL +  FL+ R+++++  AA+  F +Y+A
Sbjct: 56  -----------LTAFGQAIYVSPLKWVVILAPLALVFFLSFRINTMTVAAAQTTFAVYAA 104

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS FL+YT +S+VQTFF+TAASFG+LSLYGYTTKR+L  +GSF++MG FGL + 
Sbjct: 105 LVGLSLSSIFLIYTGQSVVQTFFVTAASFGALSLYGYTTKRNLSAMGSFLMMGLFGLIIA 164

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           SLVN+F+ SSA+   +S +G++IF+ LTAYDTQ+IKE Y +  DVA A R++++GAL LY
Sbjct: 165 SLVNIFLASSAVQFAISVLGVLIFAGLTAYDTQRIKELYLEADDVAVAGRKAIMGALTLY 224

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DFI +F+ LL+F+G+R+
Sbjct: 225 LDFINLFMFLLQFMGNRK 242


>gi|227823755|ref|YP_002827728.1| hypothetical protein NGR_c32420 [Sinorhizobium fredii NGR234]
 gi|227342757|gb|ACP26975.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 245

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 193/260 (74%), Gaps = 16/260 (6%)

Query: 1   MSDIRNYQ-RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D+RNYQ R+  +G+  G+ ID+GLRAYM++VYNLMALGL +TG+ ++    LA + +P
Sbjct: 1   MADLRNYQTRMSPAGAQAGAVIDEGLRAYMLKVYNLMALGLAITGVAAYGTYALAVS-NP 59

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                          F  L+Y SPL+W+ + APL +  F++ R++S+S  AA+  F +Y+
Sbjct: 60  --------------AFAQLIYASPLKWVVMLAPLALVFFMSFRINSMSVSAAQTTFWIYA 105

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           AL+GLSLSS FLV+T +SIVQTFF+TAASFG+LSLYGYTTK+DL   G+F+IMG FGL +
Sbjct: 106 ALMGLSLSSIFLVFTGQSIVQTFFVTAASFGALSLYGYTTKKDLSGFGTFLIMGLFGLII 165

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            S+VN+F+ SSA+   +S +G+++F+ LTAYDTQKIKE Y +  DVA A R++++GAL L
Sbjct: 166 ASIVNIFLASSALSFAISVIGVLVFAGLTAYDTQKIKEMYFEADDVAVAGRKAIMGALTL 225

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y+DFI +F+ LL+F+G++ +
Sbjct: 226 YLDFINLFMFLLQFMGNKNE 245


>gi|241206741|ref|YP_002977837.1| hypothetical protein Rleg_4057 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860631|gb|ACS58298.1| protein of unknown function UPF0005 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 242

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 133/258 (51%), Positives = 188/258 (72%), Gaps = 16/258 (6%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D+RNYQ    +G      IDQGLRAYM++VYNLMALGL +TG+ ++L    A      
Sbjct: 1   MADLRNYQSRAQTGE----MIDQGLRAYMLKVYNLMALGLAITGVAAYLSFQFAFANGE- 55

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                      LT FG  +Y SPL+W+ I APL +  FL+ R+++++  AA+  F +Y+A
Sbjct: 56  -----------LTAFGQAIYVSPLKWVVILAPLALVFFLSFRINTMTVAAAQTTFAVYAA 104

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS FL+YT +S+VQTFF+TAASFG+LSLYGYTTKR+L  +GSF++MG FGL + 
Sbjct: 105 LVGLSLSSIFLIYTGQSVVQTFFVTAASFGALSLYGYTTKRNLSAMGSFLMMGLFGLIIA 164

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           S+VN+F+ SSA+   +S +G++IF+ LTAYDTQ+IKE Y +  DVA A R++++GAL LY
Sbjct: 165 SIVNIFLASSAVQFAISVLGVLIFAGLTAYDTQRIKELYLEADDVAVAGRKAIMGALTLY 224

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DFI +F+ LL+F+G+R+
Sbjct: 225 LDFINLFMFLLQFMGNRK 242


>gi|150398270|ref|YP_001328737.1| hypothetical protein Smed_3076 [Sinorhizobium medicae WSM419]
 gi|150029785|gb|ABR61902.1| protein of unknown function UPF0005 [Sinorhizobium medicae WSM419]
          Length = 245

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 192/260 (73%), Gaps = 16/260 (6%)

Query: 1   MSDIRNYQ-RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D+RNYQ R+  +G+  G+ ID+GLRAYM++VYNLMALGL +TG+ ++    LA + +P
Sbjct: 1   MADLRNYQTRMSPAGAQAGAVIDEGLRAYMLKVYNLMALGLAITGVAAYGTYALAAS-NP 59

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                          F  L+Y SPL+W+ + APL +  FL+ R++S+S   A+M F +Y+
Sbjct: 60  --------------AFAQLIYASPLKWVVMLAPLALVFFLSFRINSMSVATAQMTFWVYA 105

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           AL+GLSLSS FLV+T +SIVQTFF+TAASFG+LSLYGYTTK+DL  +GSF+IMG FG+ +
Sbjct: 106 ALMGLSLSSIFLVFTGQSIVQTFFVTAASFGALSLYGYTTKKDLSGLGSFLIMGLFGVII 165

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            S+VN+F+ SSA+   +S +G++IF+ LTAYDTQK+KE Y +  D   A R++++GAL L
Sbjct: 166 ASVVNIFLASSALGFAISVIGVLIFAGLTAYDTQKLKEMYFEGDDALVAGRKAIMGALTL 225

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y+DFI +F+ +L+FLG+R +
Sbjct: 226 YLDFINLFMFMLQFLGNRNE 245


>gi|15966975|ref|NP_387328.1| hypothetical protein SMc03839 [Sinorhizobium meliloti 1021]
 gi|307302443|ref|ZP_07582200.1| protein of unknown function UPF0005 [Sinorhizobium meliloti BL225C]
 gi|307316227|ref|ZP_07595671.1| protein of unknown function UPF0005 [Sinorhizobium meliloti AK83]
 gi|15076248|emb|CAC47801.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306898067|gb|EFN28809.1| protein of unknown function UPF0005 [Sinorhizobium meliloti AK83]
 gi|306903113|gb|EFN33703.1| protein of unknown function UPF0005 [Sinorhizobium meliloti BL225C]
          Length = 245

 Score =  261 bits (668), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 132/260 (50%), Positives = 192/260 (73%), Gaps = 16/260 (6%)

Query: 1   MSDIRNYQ-RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D+RNYQ R+  +G+  G+ ID+GLRAYM++VYNLMALGL +TG+ ++    LA + +P
Sbjct: 1   MADLRNYQTRMSPAGAQAGAVIDEGLRAYMLKVYNLMALGLAITGVAAYGTYALAAS-NP 59

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                          F  L+Y SPL+W+ + APL +  FL+ R++S+S  AA+  F +Y+
Sbjct: 60  --------------AFAQLIYASPLKWVVMLAPLALVFFLSFRINSMSVSAAQTTFWVYA 105

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           AL+GLSLSS FLV+T +SIVQTFF+TAASFG+LSLYGYTTK+DL  +GSF+IMG FG+ +
Sbjct: 106 ALMGLSLSSIFLVFTGQSIVQTFFVTAASFGALSLYGYTTKKDLSGLGSFLIMGLFGVII 165

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            S+VN+F+ SSA+   +S +G++IF+ LTAYDTQK+KE Y +  D   A R++++GAL L
Sbjct: 166 ASVVNIFLASSALGFAISVIGVLIFAGLTAYDTQKLKEMYFEGDDALVAGRKAIMGALTL 225

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y+DFI +F+ +L+FLG++ +
Sbjct: 226 YLDFINLFMFMLQFLGNKNE 245


>gi|319780702|ref|YP_004140178.1| hypothetical protein Mesci_0964 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166590|gb|ADV10128.1| protein of unknown function UPF0005 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 259

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 144/261 (55%), Positives = 194/261 (74%), Gaps = 5/261 (1%)

Query: 1   MSD-IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D IRNYQ     G G G+ IDQGLRAYMI+VYNLM LGL +TG+ +    +LATT DP
Sbjct: 1   MADPIRNYQTRAVPGVGVGADIDQGLRAYMIKVYNLMGLGLLITGLAAVGTIMLATTTDP 60

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
            +A   +  G MLT FG  ++ SPLRW+ + APL   +FL+ R+ S+S  AA+  F +Y+
Sbjct: 61  ASAVATLPSGEMLTSFGYAIFGSPLRWVVMLAPLAAVLFLSFRVQSMSVSAAQTTFWVYA 120

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
            L+GLSLSS FLVYT+ SI QTFF TAA+FG+LSL+GYTTKRDL  +GSF+IMG FG+ +
Sbjct: 121 GLVGLSLSSIFLVYTTASISQTFFATAAAFGALSLFGYTTKRDLTAMGSFLIMGVFGIII 180

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGAL 237
            S++N+F++SSA+   +SA+G+++F+ LTAYDTQKIKE Y   D  DV  A R++++GAL
Sbjct: 181 ASVINIFLQSSALSFAVSAIGVLVFAGLTAYDTQKIKEMYFEGDSSDV--AGRKAIMGAL 238

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY+DFI +F+ LL+F+G RR
Sbjct: 239 TLYLDFINLFMFLLQFMGDRR 259


>gi|163757367|ref|ZP_02164456.1| hypothetical protein HPDFL43_18192 [Hoeflea phototrophica DFL-43]
 gi|162284869|gb|EDQ35151.1| hypothetical protein HPDFL43_18192 [Hoeflea phototrophica DFL-43]
          Length = 243

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 128/258 (49%), Positives = 187/258 (72%), Gaps = 15/258 (5%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D RN    V SG+   + ID+GLRAYM+RVYN+MA+GLG+TG+ ++   +LA+T +P 
Sbjct: 1   MADFRNSNVRVASGAHADAAIDEGLRAYMLRVYNIMAMGLGITGVAAYGTYMLAST-NP- 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                         F  L+Y SPL+W+ + APL +  FL+ R+  +S  AA+  F +Y+A
Sbjct: 59  -------------AFAQLLYASPLKWVIMLAPLAMVFFLSFRIEKMSVSAAQTTFWVYAA 105

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           ++GLSLSS F+V+T  SI QTFF+TAASFG+LSLYGYTTK+DL  +GSF+IMG FG+ + 
Sbjct: 106 MMGLSLSSIFIVFTGASITQTFFVTAASFGALSLYGYTTKKDLSGMGSFLIMGVFGIIIA 165

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +VN+F++SSA++  +SA+G+++F+ LTAYDTQ+IKE Y +    A A R++++GAL LY
Sbjct: 166 MVVNIFLQSSALEFAISAIGVLVFAGLTAYDTQQIKEMYYEGDGAATAGRKAIMGALRLY 225

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DFI +F+ LL+FLG+R 
Sbjct: 226 LDFINLFMFLLQFLGNRE 243


>gi|153007445|ref|YP_001368660.1| hypothetical protein Oant_0100 [Ochrobactrum anthropi ATCC 49188]
 gi|151559333|gb|ABS12831.1| protein of unknown function UPF0005 [Ochrobactrum anthropi ATCC
           49188]
          Length = 260

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 143/261 (54%), Positives = 186/261 (71%), Gaps = 4/261 (1%)

Query: 1   MSDIRN---YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           M+D RN    QR V  G+   + IDQGLR+YM+ VYN+MA+GL VTG+ +F V  LATT 
Sbjct: 1   MADFRNIQAQQRPVG-GARADAGIDQGLRSYMLGVYNMMAIGLAVTGLAAFAVAALATTT 59

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           DP AA   +  G MLTG G  +YTSPLRW+ + APL    FL+ R+  LS   A  +F  
Sbjct: 60  DPSAAVAQLANGKMLTGLGVALYTSPLRWVVMLAPLAAVFFLSFRIERLSVSTANAVFWG 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           Y+AL+GLSLSS FLV+T +SIV+TFF+TAASFG+LSLYGYTTKRDL  +GSF+IMG FGL
Sbjct: 120 YAALVGLSLSSIFLVFTGQSIVRTFFVTAASFGALSLYGYTTKRDLSAMGSFLIMGLFGL 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGAL 237
            L S+VN+F+ S+A+   +S +G++IF+ LTAYDTQ IKE Y +        R+ V+GAL
Sbjct: 180 ILASVVNIFLGSTALQFAISVIGVLIFAGLTAYDTQSIKEMYYEGDSSDAHGRKVVMGAL 239

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY+DFI +F  LL+F+G+R 
Sbjct: 240 RLYLDFINMFTFLLQFMGNRE 260


>gi|307943801|ref|ZP_07659145.1| inner membrane protein YbhL [Roseibium sp. TrichSKD4]
 gi|307773431|gb|EFO32648.1| inner membrane protein YbhL [Roseibium sp. TrichSKD4]
          Length = 261

 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 130/256 (50%), Positives = 182/256 (71%), Gaps = 2/256 (0%)

Query: 5   RNYQRVVN-SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           RN Q     +GS   + ID+GLRAYM+ VYN M  GL +TG  +    +LATT DP AA 
Sbjct: 6   RNTQAPYQVAGSHAEAGIDEGLRAYMLGVYNYMTFGLALTGFFALGTAMLATTSDPSAAV 65

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
             +  G +LT  GA +Y SPL+W+ + APLG+ ++L+ R+ S+SA  A+ MFL+Y+A++G
Sbjct: 66  AQLGNGQLLTQLGATLYGSPLKWVVMLAPLGMVLWLSFRIQSMSASGARTMFLVYAAVMG 125

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +SLSS FLVYT  SI + FFITAA+FG LSL+GYTTK+DL  +GSF++MG  G+F+ SLV
Sbjct: 126 VSLSSIFLVYTGGSIARVFFITAAAFGGLSLFGYTTKKDLSGLGSFLVMGLIGIFIASLV 185

Query: 184 N-LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           N LF+ SSA+   +S +G+++F+ LTAYDTQ+IKE Y +      A ++SV+GAL LY+D
Sbjct: 186 NMLFLESSALQFAISVIGVLVFAGLTAYDTQQIKEMYYEGDGHEVATKKSVMGALRLYLD 245

Query: 243 FIQIFVHLLRFLGSRR 258
           FI +F+ LL+  G+R 
Sbjct: 246 FINLFLMLLQLFGNRE 261


>gi|239830938|ref|ZP_04679267.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239823205|gb|EEQ94773.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 260

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 182/260 (70%), Gaps = 2/260 (0%)

Query: 1   MSDIRNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVD 58
           M+D RN Q       G    + IDQGLR+YM+ VYN+MA+GL VTG+ +F V  LATT D
Sbjct: 1   MADFRNIQAQQRPVGGVRTDAGIDQGLRSYMLGVYNMMAIGLAVTGLAAFAVAALATTTD 60

Query: 59  PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
           P AA   +  G MLT  G  +YTSPLRW+ + APL    FL+ R+  +S   A  +F  Y
Sbjct: 61  PSAAVAQLANGKMLTSLGVALYTSPLRWVVMLAPLAAVFFLSFRIERMSVGTANAVFWGY 120

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
           +AL+GLSLSS FLV+T +SIV+TFF+TAASFG+LSLYGYTTKRDL  +GSF++MG FGL 
Sbjct: 121 AALVGLSLSSIFLVFTGQSIVRTFFVTAASFGALSLYGYTTKRDLSAMGSFLVMGLFGLI 180

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALM 238
           L S+VN+F+ S+A+   +S +G++IF+ LTAYDTQ IKE Y +        R+ V+GAL 
Sbjct: 181 LASVVNIFLGSTALQFAISVIGVLIFAGLTAYDTQSIKEMYYEGDSSDAHGRKVVMGALR 240

Query: 239 LYMDFIQIFVHLLRFLGSRR 258
           LY+DFI +F  LL+F+G+R 
Sbjct: 241 LYLDFINMFTFLLQFMGNRE 260


>gi|13473668|ref|NP_105236.1| hypothetical protein mll4343 [Mesorhizobium loti MAFF303099]
 gi|14024418|dbj|BAB51022.1| mll4343 [Mesorhizobium loti MAFF303099]
          Length = 257

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 141/261 (54%), Positives = 193/261 (73%), Gaps = 7/261 (2%)

Query: 1   MSD-IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D IRNYQ   ++  G  + IDQGLRAYMI+VYNLM LGL +TG+ +    +LATT DP
Sbjct: 1   MADPIRNYQ--TSAVPGVRADIDQGLRAYMIKVYNLMGLGLLITGLAAVGTIMLATTTDP 58

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
            +A   +  G MLT FG  ++ SPLRW+ + APL    FL+ R+ S+S  AA+  F +Y+
Sbjct: 59  ASAVATLPSGEMLTSFGYAIFGSPLRWVVMLAPLAAVFFLSFRIQSMSVAAAQTTFWVYA 118

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
            L+GLSLSS FLVYT+ SI QTFF TAA+FG+LSLYGYTTKRDL  +GSF+IMG FG+ +
Sbjct: 119 GLVGLSLSSIFLVYTTASISQTFFATAAAFGALSLYGYTTKRDLTAMGSFLIMGVFGIII 178

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGAL 237
            +++N+F++SSA+   +SA+G+++F+ LTAYDTQKIKE Y   D  D+  A R++++GAL
Sbjct: 179 ATVINIFLQSSALSFAVSAIGVLVFAGLTAYDTQKIKEMYFEGDASDI--AGRKAIMGAL 236

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY+DFI +F+ LL+F+G RR
Sbjct: 237 RLYLDFINLFMFLLQFMGDRR 257


>gi|158422583|ref|YP_001523875.1| hypothetical protein AZC_0959 [Azorhizobium caulinodans ORS 571]
 gi|158329472|dbj|BAF86957.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 261

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 132/260 (50%), Positives = 187/260 (71%), Gaps = 1/260 (0%)

Query: 1   MSDI-RNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           MSD  RN      S +   + IDQGLRAYM+RVYN MALGL +TG  +  + +L+ T +P
Sbjct: 1   MSDYDRNVAARYGSVTRSEAAIDQGLRAYMLRVYNYMALGLAITGAAALGIFMLSVTTNP 60

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
            AA+  +  G+MLT FG  ++ SPL+W+ + APL    FL+ R+ S+S  AA+ +F  Y+
Sbjct: 61  GAAAGQVAGGIMLTQFGYALFVSPLKWVVMLAPLAAVFFLSFRIQSMSVGAAQAVFWGYA 120

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           AL+G+SLSS FLVYT +SIV+ FFITAASFG+LSL+GYTTKRDL  +GSF+IMG FG+ +
Sbjct: 121 ALVGISLSSIFLVYTHESIVRVFFITAASFGALSLWGYTTKRDLTGMGSFLIMGLFGIII 180

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            SLVN+F+ SS +   +S +G+++F+ LTAYDTQ+IKE Y +  D   A +++++GAL L
Sbjct: 181 ASLVNIFLASSMLQFIVSVVGVLVFAGLTAYDTQRIKEMYFEADDDVVAGKKAIMGALTL 240

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y+DFI +F+ LL+  G+R +
Sbjct: 241 YLDFINLFMMLLQLFGNRNN 260


>gi|118592344|ref|ZP_01549736.1| hypothetical protein SIAM614_25991 [Stappia aggregata IAM 12614]
 gi|118435002|gb|EAV41651.1| hypothetical protein SIAM614_25991 [Stappia aggregata IAM 12614]
          Length = 260

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 120/237 (50%), Positives = 172/237 (72%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           IDQGLR YM+ VYN M +GL +TG ++    +LATT DP++A   +  G MLT  G  +Y
Sbjct: 23  IDQGLRTYMLGVYNYMTIGLALTGFLALATVMLATTTDPNSAVASLGNGRMLTQLGVAIY 82

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            SPL+W+ + APLG+  +L+ R+ S+SA AA+ +F +Y++++G+SLSS FLVYT  SI Q
Sbjct: 83  DSPLKWVVMLAPLGMVFWLSFRIQSMSAGAARTLFFVYASVMGISLSSIFLVYTPGSIAQ 142

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            FFITA +FG+LSL+GYTTK+DL   GSF+ +G  G+ + SLVN+FM SSA+   +S +G
Sbjct: 143 VFFITAGTFGALSLFGYTTKKDLSGWGSFLFIGLIGIVIASLVNIFMASSALQFAISVIG 202

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           +++F+ LTAYDTQ+IKE Y +      A ++SV+GAL LY+DFI +F+ LL+  G+R
Sbjct: 203 VLVFAGLTAYDTQQIKEMYYEGDSGEVATKKSVMGALRLYLDFINLFIMLLQLFGNR 259


>gi|154245986|ref|YP_001416944.1| hypothetical protein Xaut_2043 [Xanthobacter autotrophicus Py2]
 gi|154160071|gb|ABS67287.1| protein of unknown function UPF0005 [Xanthobacter autotrophicus
           Py2]
          Length = 261

 Score =  243 bits (619), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 120/241 (49%), Positives = 176/241 (73%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + IDQGLR YM+ VYN MALGL +TG  +  + +L+ T DP  A+  +  G+MLT FG  
Sbjct: 21  AAIDQGLRTYMLSVYNYMALGLAITGAAALGIYLLSVTTDPSQAAGRVAGGIMLTQFGYA 80

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           ++ SPL+W+ +FAPL    FL+ R+  +S  AA++ F +Y+AL+G SLS+ FLVYT +SI
Sbjct: 81  LFVSPLKWVVMFAPLAAVFFLSFRIERMSVSAAQITFWVYAALVGTSLSTIFLVYTHESI 140

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           V+ FFITAASFG+LSLYGYTTK+DL  +GSF++MG FG+ + SLVN+F+ S+ +   +S 
Sbjct: 141 VRVFFITAASFGALSLYGYTTKKDLSGMGSFLMMGLFGIIIASLVNIFLGSTMLQFIVSV 200

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +G+++F+ LTAYDTQ+IKE Y    D +   +++++GAL LY+DFI +F+ LL+  G+R 
Sbjct: 201 VGVLVFAGLTAYDTQRIKEMYFVGDDGSVMGKKAIMGALSLYLDFINMFMMLLQLFGNRN 260

Query: 259 D 259
           +
Sbjct: 261 N 261


>gi|240849690|ref|YP_002971078.1| hypothetical membrane protein [Bartonella grahamii as4aup]
 gi|240266813|gb|ACS50401.1| hypothetical membrane protein [Bartonella grahamii as4aup]
          Length = 257

 Score =  240 bits (612), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 182/259 (70%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M++ +N +    S +   ++IDQGLR YM+ VYN MA+GL +T   ++++  LATT D  
Sbjct: 1   MANFKNLRSAPTSHAD--ASIDQGLRDYMLGVYNTMAIGLLITAAAAYVIVSLATTTDMS 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A+  IN  V LT FG   YTSP  +I +FAPL   +FL+ ++++LS  AA+ +F  Y+A
Sbjct: 59  QAAAQINSSVYLTSFGVTFYTSPFSYIVMFAPLIAVLFLSFKINTLSTNAARSLFFGYAA 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT++S+VQTF I+AA+FG+LSLYGYTTKRDL  IGSF+ +G  GLFL 
Sbjct: 119 LVGLSLSSIVLRYTTESVVQTFVISAAAFGALSLYGYTTKRDLTAIGSFLFIGLIGLFLS 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +VN+F+ SSA+   +S +G++IF+ LTAYDTQ IK  Y +  +     R+ ++GAL LY
Sbjct: 179 MIVNIFLGSSALQFAISVIGVLIFAGLTAYDTQSIKLMYYEGDESDTRGRKVIMGALNLY 238

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +FV LL+FLGS RD
Sbjct: 239 LDFINMFVFLLQFLGSNRD 257


>gi|319404921|emb|CBI78521.1| conserved membrane hypothetical protein [Bartonella sp. AR 15-3]
          Length = 257

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 131/261 (50%), Positives = 180/261 (68%), Gaps = 6/261 (2%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D +N +    S S   ++IDQGLR YM+ VYN MA+GL VT + ++ +  LATT +  
Sbjct: 1   MADFKNLRSA--SVSHADASIDQGLRNYMLGVYNTMAIGLLVTAVAAYAIASLATTTNMS 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A+  IN  V LT FG   Y SP  ++ +FAPL   +FL+ ++++LS   A+ +F  Y+ 
Sbjct: 59  QAAAQINGSVYLTSFGVTFYMSPFSYVIMFAPLVAVLFLSFKINALSTGVARSLFFAYAT 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YTS+SIVQTF IT+A+FGSLSLYGYTTKRDL  +GSF+ MG  GL L 
Sbjct: 119 LVGLSLSSIILRYTSESIVQTFVITSAAFGSLSLYGYTTKRDLTAVGSFLFMGLVGLMLA 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALM 238
           ++VN+F+ SSA+   +S +G+++F+ LTAY+TQ IK  Y   D YD     R+ ++GAL 
Sbjct: 179 AIVNIFLASSALQFAISVIGVLVFAGLTAYNTQNIKLMYYEGDGYDT--RGRKIIMGALN 236

Query: 239 LYMDFIQIFVHLLRFLGSRRD 259
           LY+DFI +FV LL+FLGS RD
Sbjct: 237 LYLDFINMFVFLLQFLGSNRD 257


>gi|254700900|ref|ZP_05162728.1| hypothetical protein Bsuib55_08584 [Brucella suis bv. 5 str. 513]
 gi|261751415|ref|ZP_05995124.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261741168|gb|EEY29094.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
          Length = 245

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 181/261 (69%), Gaps = 19/261 (7%)

Query: 1   MSDIRN---YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           M+D RN    QR V  G+   + IDQGLR+YM+ VYN+MA+GL VTG+ +F   +LA + 
Sbjct: 1   MADFRNIQAQQRPVG-GAHADAGIDQGLRSYMLGVYNMMAIGLAVTGLAAFGTAVLAQS- 58

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           +P               F  L++ SPLRW+ + APL    FL+ R+ SLS   A+ +F  
Sbjct: 59  NP--------------AFQQLLFASPLRWVIMLAPLAAVFFLSFRIQSLSVGTAQAIFWG 104

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           Y+AL+GLSLSS F+V+T +SIV+TFF+TAASFG+LSLYGYTTKR+L  +GSF++MG FGL
Sbjct: 105 YAALVGLSLSSIFIVFTGQSIVRTFFVTAASFGALSLYGYTTKRNLSAMGSFLMMGLFGL 164

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGAL 237
            L S+VN+F+ S+A+   +S +G++IF+ LTAYDTQ+IKE Y +        R+ V+GAL
Sbjct: 165 ILASVVNIFLGSTALQFAISVIGVLIFAGLTAYDTQEIKEMYYEGDAADTQGRKIVMGAL 224

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY+DFI +F+ LL+F+G+R 
Sbjct: 225 RLYLDFINMFMFLLQFMGNRE 245


>gi|17988142|ref|NP_540776.1| integral membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|23501002|ref|NP_697129.1| hypothetical protein BR0088 [Brucella suis 1330]
 gi|62289071|ref|YP_220864.1| hypothetical protein BruAb1_0086 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699008|ref|YP_413582.1| hypothetical protein BAB1_0084 [Brucella melitensis biovar Abortus
           2308]
 gi|161618075|ref|YP_001591962.1| hypothetical protein BCAN_A0090 [Brucella canis ATCC 23365]
 gi|163842362|ref|YP_001626766.1| hypothetical protein BSUIS_A0092 [Brucella suis ATCC 23445]
 gi|189023345|ref|YP_001934113.1| hypothetical protein BAbS19_I00790 [Brucella abortus S19]
 gi|225626630|ref|ZP_03784669.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225851627|ref|YP_002731860.1| hypothetical protein BMEA_A0093 [Brucella melitensis ATCC 23457]
 gi|237814560|ref|ZP_04593558.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254690399|ref|ZP_05153653.1| hypothetical protein Babob68_09549 [Brucella abortus bv. 6 str.
           870]
 gi|254694887|ref|ZP_05156715.1| hypothetical protein Babob3T_09537 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696516|ref|ZP_05158344.1| hypothetical protein Babob28_02055 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254705264|ref|ZP_05167092.1| hypothetical protein Bsuib36_15368 [Brucella suis bv. 3 str. 686]
 gi|254707212|ref|ZP_05169040.1| hypothetical protein BpinM_09628 [Brucella pinnipedialis
           M163/99/10]
 gi|254709242|ref|ZP_05171053.1| hypothetical protein BpinB_03041 [Brucella pinnipedialis B2/94]
 gi|254713335|ref|ZP_05175146.1| hypothetical protein BcetM6_08282 [Brucella ceti M644/93/1]
 gi|254716311|ref|ZP_05178122.1| hypothetical protein BcetM_07725 [Brucella ceti M13/05/1]
 gi|254718307|ref|ZP_05180118.1| hypothetical protein Bru83_01963 [Brucella sp. 83/13]
 gi|254731429|ref|ZP_05190007.1| hypothetical protein Babob42_09574 [Brucella abortus bv. 4 str.
           292]
 gi|256030765|ref|ZP_05444379.1| hypothetical protein BpinM2_08952 [Brucella pinnipedialis
           M292/94/1]
 gi|256045879|ref|ZP_05448753.1| hypothetical protein Bmelb1R_15329 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256060229|ref|ZP_05450405.1| hypothetical protein Bneo5_07700 [Brucella neotomae 5K33]
 gi|256112592|ref|ZP_05453513.1| hypothetical protein Bmelb3E_07915 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158785|ref|ZP_05456646.1| hypothetical protein BcetM4_07868 [Brucella ceti M490/95/1]
 gi|256254169|ref|ZP_05459705.1| hypothetical protein BcetB_07720 [Brucella ceti B1/94]
 gi|256258653|ref|ZP_05464189.1| hypothetical protein Babob9C_15161 [Brucella abortus bv. 9 str.
           C68]
 gi|256264861|ref|ZP_05467393.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|256368554|ref|YP_003106060.1| hypothetical protein BMI_I91 [Brucella microti CCM 4915]
 gi|260169668|ref|ZP_05756479.1| hypothetical protein BruF5_15173 [Brucella sp. F5/99]
 gi|260546366|ref|ZP_05822106.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260563165|ref|ZP_05833651.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260567268|ref|ZP_05837738.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260755944|ref|ZP_05868292.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260759169|ref|ZP_05871517.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260760893|ref|ZP_05873236.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884968|ref|ZP_05896582.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261215220|ref|ZP_05929501.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261218091|ref|ZP_05932372.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261221319|ref|ZP_05935600.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261314694|ref|ZP_05953891.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316747|ref|ZP_05955944.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321062|ref|ZP_05960259.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261324206|ref|ZP_05963403.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261755977|ref|ZP_05999686.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261759204|ref|ZP_06002913.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265983267|ref|ZP_06096002.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265987819|ref|ZP_06100376.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265992293|ref|ZP_06104850.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994034|ref|ZP_06106591.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265997279|ref|ZP_06109836.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|294851493|ref|ZP_06792166.1| hypothetical protein BAZG_00398 [Brucella sp. NVSL 07-0026]
 gi|297247486|ref|ZP_06931204.1| hypothetical protein BAYG_00392 [Brucella abortus bv. 5 str. B3196]
 gi|306837239|ref|ZP_07470129.1| integral membrane protein [Brucella sp. NF 2653]
 gi|306842632|ref|ZP_07475280.1| integral membrane protein [Brucella sp. BO2]
 gi|306846354|ref|ZP_07478905.1| integral membrane protein [Brucella sp. BO1]
 gi|17983899|gb|AAL53040.1| integral membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|23346863|gb|AAN29044.1| membrane protein, putative [Brucella suis 1330]
 gi|62195203|gb|AAX73503.1| hypothetical membrane protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615109|emb|CAJ10040.1| Protein of unknown function UPF0005 [Brucella melitensis biovar
           Abortus 2308]
 gi|161334886|gb|ABX61191.1| hypothetical protein BCAN_A0090 [Brucella canis ATCC 23365]
 gi|163673085|gb|ABY37196.1| hypothetical protein BSUIS_A0092 [Brucella suis ATCC 23445]
 gi|189018917|gb|ACD71639.1| hypothetical protein BAbS19_I00790 [Brucella abortus S19]
 gi|225618287|gb|EEH15330.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225639992|gb|ACN99905.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|237789397|gb|EEP63607.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|255998712|gb|ACU47111.1| hypothetical protein BMI_I91 [Brucella microti CCM 4915]
 gi|260096473|gb|EEW80349.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260153181|gb|EEW88273.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260156786|gb|EEW91866.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260669487|gb|EEX56427.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260671325|gb|EEX58146.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676052|gb|EEX62873.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260874496|gb|EEX81565.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260916827|gb|EEX83688.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260919903|gb|EEX86556.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260923180|gb|EEX89748.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261293752|gb|EEX97248.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261295970|gb|EEX99466.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261300186|gb|EEY03683.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261303720|gb|EEY07217.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261739188|gb|EEY27184.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261745730|gb|EEY33656.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262551747|gb|EEZ07737.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262765015|gb|EEZ10936.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003359|gb|EEZ15652.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263095316|gb|EEZ18943.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264660016|gb|EEZ30277.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|264661859|gb|EEZ32120.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294820082|gb|EFG37081.1| hypothetical protein BAZG_00398 [Brucella sp. NVSL 07-0026]
 gi|297174655|gb|EFH34002.1| hypothetical protein BAYG_00392 [Brucella abortus bv. 5 str. B3196]
 gi|306273197|gb|EFM55088.1| integral membrane protein [Brucella sp. BO1]
 gi|306287224|gb|EFM58715.1| integral membrane protein [Brucella sp. BO2]
 gi|306407698|gb|EFM63887.1| integral membrane protein [Brucella sp. NF 2653]
 gi|326408101|gb|ADZ65166.1| integral membrane protein [Brucella melitensis M28]
 gi|326537815|gb|ADZ86030.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 245

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 181/261 (69%), Gaps = 19/261 (7%)

Query: 1   MSDIRN---YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           M+D RN    QR V  G+   + IDQGLR+YM+ VYN+MA+GL VTG+ +F   +LA + 
Sbjct: 1   MADFRNIQAQQRPVG-GARADAGIDQGLRSYMLGVYNMMAIGLAVTGLAAFGTAVLAQS- 58

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           +P               F  L++ SPLRW+ + APL    FL+ R+ SLS   A+ +F  
Sbjct: 59  NP--------------AFQQLLFASPLRWVIMLAPLAAVFFLSFRIQSLSVGTAQAIFWG 104

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           Y+AL+GLSLSS F+V+T +SIV+TFF+TAASFG+LSLYGYTTKR+L  +GSF++MG FGL
Sbjct: 105 YAALVGLSLSSIFIVFTGQSIVRTFFVTAASFGALSLYGYTTKRNLSAMGSFLMMGLFGL 164

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGAL 237
            L S+VN+F+ S+A+   +S +G++IF+ LTAYDTQ+IKE Y +        R+ V+GAL
Sbjct: 165 ILASVVNIFLGSTALQFAISVIGVLIFAGLTAYDTQEIKEMYYEGDAADTQGRKIVMGAL 224

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY+DFI +F+ LL+F+G+R 
Sbjct: 225 RLYLDFINMFMFLLQFMGNRE 245


>gi|148559281|ref|YP_001258129.1| hypothetical protein BOV_0086 [Brucella ovis ATCC 25840]
 gi|148370538|gb|ABQ60517.1| putative membrane protein [Brucella ovis ATCC 25840]
          Length = 245

 Score =  235 bits (600), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 181/261 (69%), Gaps = 19/261 (7%)

Query: 1   MSDIRN---YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           M+D RN    QR V  G+   + IDQGLR+YM+ VYN+MA+GL VTG+ +F   +LA + 
Sbjct: 1   MADFRNIQAQQRPVG-GARADAGIDQGLRSYMLGVYNMMAIGLAVTGLAAFGTAVLAQS- 58

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           +P               F  L++ SPLRW+ + APL    FL+ R+ SLS   A+ +F  
Sbjct: 59  NP--------------AFQQLLFASPLRWVIMLAPLAAVFFLSFRIQSLSVGTAQAIFWG 104

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           Y+AL+GLSLSS F+V+T +SIV+TFF+TAASFG+LSLYGYTTKR+L  +GSF++MG FGL
Sbjct: 105 YAALVGLSLSSIFIVFTGQSIVRTFFVTAASFGALSLYGYTTKRNLSAMGSFLMMGLFGL 164

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGAL 237
            L S+VN+F+ S+A+   +S +G++IF+ LTAYDTQ+IKE Y +        R+ V+GAL
Sbjct: 165 TLASVVNIFLGSTALQFAISVIGVLIFAGLTAYDTQEIKEMYYEGDAADTQGRKIVMGAL 224

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY+DFI +F+ LL+F+G+R 
Sbjct: 225 RLYLDFINMFMFLLQFMGNRE 245


>gi|319407883|emb|CBI81535.1| conserved membrane hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 257

 Score =  235 bits (600), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 129/259 (49%), Positives = 181/259 (69%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D +N +    S S   ++IDQGLR+YM+ VYN MA+GL +T   ++++  LATT D +
Sbjct: 1   MADFKNLRSA--SVSHADASIDQGLRSYMLGVYNTMAIGLLITASAAYIIASLATTADIN 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A   IN  V LT FG   YTSPL ++ +F+PL   +FL+ ++++LS  AA+ +F  Y+A
Sbjct: 59  QAVAQINDSVYLTSFGVTFYTSPLSYVIMFSPLVAVLFLSFKINTLSTNAARSLFFGYAA 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT +SIVQTF IT+A+FGSLSLYGYTTKRDL  +GSF+ MG  GL L 
Sbjct: 119 LVGLSLSSIILRYTPESIVQTFVITSAAFGSLSLYGYTTKRDLTAMGSFLFMGLIGLLLA 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +VN+F+ SSA+   +S +G+++F+ LTAY+TQ IK  Y +        R+ ++GAL LY
Sbjct: 179 MVVNIFLGSSALQFAISVIGVLVFAGLTAYNTQTIKLMYYEGDADDTRGRKIIMGALNLY 238

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +FV LL+FLGS R+
Sbjct: 239 LDFINMFVFLLQFLGSNRN 257


>gi|49473696|ref|YP_031738.1| hypothetical protein BQ00080 [Bartonella quintana str. Toulouse]
 gi|49239199|emb|CAF25515.1| hypothetical protein BQ00080 [Bartonella quintana str. Toulouse]
          Length = 257

 Score =  234 bits (598), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 177/259 (68%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D +N +    S +   ++IDQGLR+YM+ VYN MA+GL VT   ++ +  LATT +  
Sbjct: 1   MADFKNLRSAPISHAD--ASIDQGLRSYMVGVYNTMAIGLLVTAATAYAIASLATTTEMS 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A+  IN  V LT FG   YTSP  +I +FAPL   +FL+ ++++LS   A+ +F  Y+A
Sbjct: 59  QAAAQINSSVYLTSFGVTFYTSPFSYIVMFAPLVAVLFLSFKINTLSTSVARSLFFGYAA 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT++SIVQTF ITAA+FG+LSLYGYTTKRDL  +GSF  +G  GL L 
Sbjct: 119 LVGLSLSSIILRYTTESIVQTFVITAATFGALSLYGYTTKRDLTAMGSFFFIGLVGLMLS 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +VN+F+ SSA+   +S +G+ IF+ LTAYDTQ IK  Y +        R+ ++GAL LY
Sbjct: 179 MIVNIFLGSSALQFAISVIGVFIFAGLTAYDTQNIKLMYYEGDGNDTQGRKIIMGALNLY 238

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +FV LL+FLGS RD
Sbjct: 239 LDFINMFVFLLQFLGSNRD 257


>gi|319898200|ref|YP_004158293.1| hypothetical protein BARCL_0009 [Bartonella clarridgeiae 73]
 gi|319402164|emb|CBI75690.1| conserved membrane protein of unknown function [Bartonella
           clarridgeiae 73]
          Length = 257

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 178/259 (68%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D +N + V  S S   ++IDQGLR+YM+ VYN MA+GL +T   ++ +  L TT D +
Sbjct: 1   MADFKNLRSV--SASHADASIDQGLRSYMLGVYNTMAIGLLITAAAAYAIASLVTTTDMN 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A+  IN  V LT FG   Y SP  ++ +FAPL   +FL  ++++LS   A+ +F  Y+ 
Sbjct: 59  QAAAQINGSVYLTPFGVTFYMSPFSYVIMFAPLVAVLFLTFKINTLSTSVARSLFFAYAT 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT +SIVQTFFIT+A+FGSLSLYGYTTKRDL  +GSF+ MG  GL L 
Sbjct: 119 LVGLSLSSIILRYTPESIVQTFFITSAAFGSLSLYGYTTKRDLTAVGSFLFMGLIGLMLA 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           ++VN+F+ SSA+   +S +G+++F+ LTAY+TQ IK  Y +        R+ ++GAL LY
Sbjct: 179 AIVNIFLGSSALQFAISVIGILVFAGLTAYNTQNIKLMYYEGDGDDTRGRKIIMGALNLY 238

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +FV LL+FLGS RD
Sbjct: 239 LDFINMFVFLLQFLGSNRD 257


>gi|254472425|ref|ZP_05085825.1| integral membrane protein [Pseudovibrio sp. JE062]
 gi|211958708|gb|EEA93908.1| integral membrane protein [Pseudovibrio sp. JE062]
          Length = 249

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 123/257 (47%), Positives = 174/257 (67%), Gaps = 13/257 (5%)

Query: 3   DIRNYQRVVNSGS-GFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA 61
           D  N  R   +GS    +  D GLRAYM+RVYN MA+G+ +TG++++            A
Sbjct: 5   DRNNSTRYGMAGSHANAAAFDAGLRAYMLRVYNYMAIGIAITGVVAY-----------AA 53

Query: 62  ASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
             + ++ G  LT FG L++TSPLRW+ + APLG   FL+ R+H +SA  A++ F L++  
Sbjct: 54  FQMAVSNGA-LTEFGVLLFTSPLRWVVMLAPLGFVFFLSARIHKMSASGAQLAFWLFAGA 112

Query: 122 IGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS 181
           +GLSLSS FLVYT  SI + FFITAASFG+LSL+GYTTK+DL   GSF+ MG  G+ + S
Sbjct: 113 MGLSLSSIFLVYTGNSIARVFFITAASFGALSLFGYTTKKDLSAWGSFLFMGLIGIIIAS 172

Query: 182 LVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYM 241
           LVNLF+ SSA+   +S +G+++F+ LTAYDTQ+IKE Y+   D   A +++++GAL LY+
Sbjct: 173 LVNLFLASSALQFAISVVGVLVFAGLTAYDTQQIKEMYAAVDDSEVAGKKAIMGALRLYL 232

Query: 242 DFIQIFVHLLRFLGSRR 258
           DFI +F+ LL   G+R 
Sbjct: 233 DFINLFIMLLSLFGNRE 249


>gi|121602380|ref|YP_988340.1| hypothetical protein BARBAKC583_0001 [Bartonella bacilliformis
           KC583]
 gi|120614557|gb|ABM45158.1| putative membrane protein [Bartonella bacilliformis KC583]
          Length = 257

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 179/259 (69%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D +N +    S S   ++IDQGLR+YM+ VYN MA+GL VT   ++ +  L TT D +
Sbjct: 1   MADFKNLRSA--SVSHADASIDQGLRSYMLSVYNTMAIGLLVTAAAAYAIASLTTTTDMN 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A+  IN  V LT FG   YTSPL ++ +F+PL   +FL+ ++++LS  AA+ +F  Y+ 
Sbjct: 59  LAAAQINSSVYLTSFGVAFYTSPLSYVIMFSPLIAVLFLSFKINTLSTSAARSLFYGYAM 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT +SIVQTF ITAA+FGSLSLYGYTTKRDL  +GSF+ +G  GL L 
Sbjct: 119 LVGLSLSSIILRYTPESIVQTFVITAAAFGSLSLYGYTTKRDLTAMGSFLFIGMIGLMLS 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            ++N+F+ S A+   +S +G++IF+ LTAY+TQ IK  Y +  +     R+ ++GAL LY
Sbjct: 179 MIINIFLGSDALQFAISVIGVLIFAGLTAYNTQTIKTMYYEGDEDDTRGRKIIMGALNLY 238

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +FV LL+FLGS RD
Sbjct: 239 LDFINMFVFLLQFLGSNRD 257


>gi|217978072|ref|YP_002362219.1| protein of unknown function UPF0005 [Methylocella silvestris BL2]
 gi|217503448|gb|ACK50857.1| protein of unknown function UPF0005 [Methylocella silvestris BL2]
          Length = 261

 Score =  228 bits (582), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 171/243 (70%), Gaps = 5/243 (2%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + IDQGLR YM+ VYN M +GL +TG+++  VN+LA   D   A   + R + LT FGA 
Sbjct: 22  AEIDQGLRTYMLGVYNNMMVGLALTGLVALGVNMLAVAGDSSQAVAQMGR-IPLTAFGAA 80

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +Y SPLR++ + APL   +F + R++ +SA +A++MF  ++A +GLSLSS  L+YT  SI
Sbjct: 81  IYGSPLRYVVMLAPLAFVLFFSFRINQMSASSARIMFFAFAATMGLSLSSILLIYTGASI 140

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            + FFITAA+FG LSLYGYTTKRDL  +GSF++MG  GL + S+VNLF++S+A    +S 
Sbjct: 141 TRAFFITAAAFGGLSLYGYTTKRDLSAMGSFLVMGLIGLVIASVVNLFVQSTAFQFGLSI 200

Query: 199 MGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           + ++IFS LTA+DTQ IKE Y  SD Y+V  A ++S+ GALMLY+DFI IF  LL   G 
Sbjct: 201 LSVLIFSGLTAWDTQSIKEMYYESDGYEV--ATKKSINGALMLYLDFINIFQSLLFLSGD 258

Query: 257 RRD 259
           R +
Sbjct: 259 RNN 261


>gi|114705370|ref|ZP_01438278.1| hypothetical protein FP2506_10536 [Fulvimarina pelagi HTCC2506]
 gi|114540155|gb|EAU43275.1| hypothetical protein FP2506_10536 [Fulvimarina pelagi HTCC2506]
          Length = 252

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 115/258 (44%), Positives = 178/258 (68%), Gaps = 6/258 (2%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D RN        +G  + IDQGLR+YM++VYNLMA G+ +TG+ ++++ +L + V  D
Sbjct: 1   MADYRNTSARTVPAAGTRADIDQGLRSYMLKVYNLMAGGVALTGVAAYVMYML-SFVTND 59

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
           A  +     V LT  G  ++ +PL+W+ + APLG+  FL+ R+H +S  AA+  F +Y+A
Sbjct: 60  AGQV-----VGLTQLGNTLFNTPLKWVVMLAPLGMVFFLSFRIHKMSVAAAQTTFWVYAA 114

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           ++G+SL+S F V+T +SI Q FFITAASFG+LSL+GYTTKRD+   GSF+ MG  G+ + 
Sbjct: 115 MVGVSLASIFAVFTGESITQVFFITAASFGALSLWGYTTKRDISGWGSFLFMGVIGIVIA 174

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +VN+F+ S A+   +S +G+++F+ LTAYDTQ+IKE Y +    A   R++++GAL LY
Sbjct: 175 MIVNIFLASPALQFAISVIGVLVFAGLTAYDTQQIKEMYYEGDGSAVMGRKAIMGALRLY 234

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DF+ +F+ LL+  G+R 
Sbjct: 235 LDFLNMFLFLLQLFGNRE 252


>gi|254502631|ref|ZP_05114782.1| Uncharacterized protein family UPF0005, putative [Labrenzia
           alexandrii DFL-11]
 gi|222438702|gb|EEE45381.1| Uncharacterized protein family UPF0005, putative [Labrenzia
           alexandrii DFL-11]
          Length = 254

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 169/238 (71%), Gaps = 6/238 (2%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           IDQGLRAYM+ VYN M  GL +TG  + +   + + V  DA SI     V LT  G  ++
Sbjct: 23  IDQGLRAYMLGVYNYMTFGLALTGFFA-IGTYMMSVVTNDAGSI-----VGLTPLGNAIF 76

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            SPL+W+ + APLG+ ++L+ R+ S+SA  A+ MFL+YSAL+G+SLSS F+VYT  SI +
Sbjct: 77  ASPLKWVVMLAPLGMVLWLSFRIQSMSASTARTMFLIYSALMGVSLSSIFMVYTGGSIAR 136

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            FFITAASFG+LS++GYTTK+DL   GSF+ MG  G+ + SLVN+F+ SSA+   +S +G
Sbjct: 137 VFFITAASFGALSIFGYTTKKDLSAWGSFLFMGLIGIVIASLVNIFLGSSALQFAISVVG 196

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +++F+ LTAYDTQ+IKE Y +      A ++SV+GAL LY+DFI +F+ LL+  G+R 
Sbjct: 197 VLVFAGLTAYDTQQIKEMYYEGDSGEVATKKSVMGALRLYLDFINMFLMLLQLFGNRE 254


>gi|319406410|emb|CBI80050.1| conserved membrane hypothetical protein [Bartonella sp. 1-1C]
          Length = 257

 Score =  228 bits (580), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 130/261 (49%), Positives = 178/261 (68%), Gaps = 6/261 (2%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D +N +    S S   ++IDQGLR+YM+ VYN MA+GL  T   ++ +  LATT D  
Sbjct: 1   MADFKNLRSA--SVSHADASIDQGLRSYMLGVYNTMAIGLLTTAAAAYAIASLATTTDMS 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A+  IN  V LT FG   Y SP  ++ +FAPL   +FL+ ++++LS   A+ +F  Y+ 
Sbjct: 59  QAAAQINGSVYLTSFGVTFYMSPFSYVIMFAPLVAVLFLSFKINTLSTSVARSLFFGYAT 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT +SIVQTF IT+A+FGSLSLYGYTTKRDL  +GSF+ MG  GL L 
Sbjct: 119 LVGLSLSSIILRYTPESIVQTFVITSAAFGSLSLYGYTTKRDLTAVGSFLFMGLIGLMLA 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALM 238
           ++VN+F+ SSA+   +S +G+++F+ LTAY+TQ IK  Y   D YD     R+ ++GAL 
Sbjct: 179 TIVNIFLGSSALQFAISVIGVLVFAGLTAYNTQHIKLMYYEGDGYDT--RSRKIIMGALN 236

Query: 239 LYMDFIQIFVHLLRFLGSRRD 259
           LY+DFI +FV LL+FLGS RD
Sbjct: 237 LYLDFINMFVFLLQFLGSNRD 257


>gi|319403496|emb|CBI77075.1| conserved membrane hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 257

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 130/261 (49%), Positives = 178/261 (68%), Gaps = 6/261 (2%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D +N +    S S   ++IDQGLR+YM+ VYN MA+GL +T   ++ +  LATT D  
Sbjct: 1   MADFKNLRSA--SISHADASIDQGLRSYMLGVYNTMAIGLLITAAAAYAIASLATTTDMS 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A   IN  V LT FG   Y SP  ++ +FAPL   +FL+ ++++LS   A+ +F  Y+ 
Sbjct: 59  QAVAQINGSVYLTSFGVTFYMSPFSYVIMFAPLVAVLFLSFKINTLSTSVARSLFFGYAT 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT +SIVQTF IT+A+FGSLSLYGYTTKRDL  +GSF+ MG  GL L 
Sbjct: 119 LVGLSLSSIILRYTPESIVQTFVITSAAFGSLSLYGYTTKRDLTAVGSFLFMGLIGLMLA 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALM 238
           ++VN+F+ SSA+   +S +G+++F+ LTAY+TQ IK  Y   D YD     R+ ++GAL 
Sbjct: 179 TIVNIFLGSSALQFAISVIGVLVFAGLTAYNTQNIKLMYYEGDGYDT--RSRKIIMGALN 236

Query: 239 LYMDFIQIFVHLLRFLGSRRD 259
           LY+DFI +FV LL+FLGS RD
Sbjct: 237 LYLDFINMFVFLLQFLGSNRD 257


>gi|90421112|ref|ZP_01229014.1| conserved hypothetical membrane protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334604|gb|EAS48384.1| conserved hypothetical membrane protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 295

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 116/258 (44%), Positives = 177/258 (68%), Gaps = 6/258 (2%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M++ RN        +G  + IDQGLR+YM++VYNLMA G+ +TG+ ++ + +L + V  D
Sbjct: 44  MAEYRNAGARTVPAAGSRADIDQGLRSYMLKVYNLMAGGVALTGVAAYALYML-SFVTND 102

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
           A ++     V LT  G  ++ +PL+W+ + APLG+  FL+ R+H +S  AA+  F +YSA
Sbjct: 103 AGNV-----VGLTQLGNTLFNTPLKWVVMLAPLGMVFFLSFRVHKMSVAAAQTTFWIYSA 157

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           ++G+SL+S F VYT +SI Q FFITAASFG+LSL+GYTTKRD+   GSF+ MG  G+ + 
Sbjct: 158 MVGVSLASIFAVYTGESITQVFFITAASFGALSLWGYTTKRDISGWGSFLFMGVIGIVIA 217

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +VN+F+ S A+   +S +G+++F+ LTAYDTQ+IKE Y +        R++V+GAL LY
Sbjct: 218 MVVNIFLASPALQFAISVIGVLVFAGLTAYDTQQIKEMYYEGDGSTVMGRKAVMGALRLY 277

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DF+ +F+ LL+  G+R 
Sbjct: 278 LDFLNMFLFLLQLFGNRE 295


>gi|328542062|ref|YP_004302171.1| hypothetical protein SL003B_0440 [polymorphum gilvum SL003B-26A1]
 gi|326411812|gb|ADZ68875.1| Hypothetical transmembrane protein [Polymorphum gilvum SL003B-26A1]
          Length = 250

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 168/256 (65%), Gaps = 10/256 (3%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D  N      +GS   + IDQGLRAYM+ VYN M LGL +TG+++      A  +D    
Sbjct: 5   DRNNQVPYATAGSYADAGIDQGLRAYMLGVYNYMTLGLAITGLVAMATVYFA--IDTATG 62

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                    LT FG  +Y SPL+W+ + APL +  FL+ R+ S+SA AA+  F +Y+AL+
Sbjct: 63  G--------LTTFGLAIYASPLKWVIMLAPLAMVFFLSFRIQSMSASAAQTTFWIYAALM 114

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G SLSS FLVYT  SI + FFITAASFG+LSL+GYTTK+DL   GSF+ MG  G+ L SL
Sbjct: 115 GASLSSIFLVYTGGSIARVFFITAASFGALSLFGYTTKKDLSAWGSFLFMGLIGIVLASL 174

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           VN+F+ SSA+   +S +G+++F+ LTAYDTQ+IKE Y +        ++SV+GAL LY+D
Sbjct: 175 VNIFLASSALQFAVSVIGVLVFAGLTAYDTQQIKEMYYEGDGHEATTKKSVMGALRLYLD 234

Query: 243 FIQIFVHLLRFLGSRR 258
           FI +F+ LL+  G+R 
Sbjct: 235 FINMFLMLLQLFGNRE 250


>gi|170743563|ref|YP_001772218.1| hypothetical protein M446_5468 [Methylobacterium sp. 4-46]
 gi|168197837|gb|ACA19784.1| protein of unknown function UPF0005 [Methylobacterium sp. 4-46]
          Length = 274

 Score =  221 bits (564), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 163/246 (66%), Gaps = 7/246 (2%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP------DAASIIINRGVMLTG 74
           +DQGLRA+M+ VYN M LGL V+ +++  VN LATT  P       A  ++   G  LT 
Sbjct: 29  VDQGLRAFMLGVYNNMVLGLAVSALVALGVNKLATTAVPAEAARNGAGQMVRIGGQYLTQ 88

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           FG  +YT+PL W+   APL    F + R+  +SA +A+  FL ++A++G SLS+  L YT
Sbjct: 89  FGITLYTTPLMWVVALAPLAFIFFFSFRMDRMSAASARTTFLAFAAVMGASLSTLLLRYT 148

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             S+VQ FFITAA+FG LSLYGYTT R L  IGSF++MG  GL + SLVN+F+ SSA+  
Sbjct: 149 GASVVQVFFITAAAFGGLSLYGYTTARSLSGIGSFLVMGLIGLVIASLVNIFLASSALQF 208

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAY-SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
            +S +GL+IF+ LTAYDTQK+KE Y    +D   A + SV GAL LY+DFI +F  LL  
Sbjct: 209 AISVIGLLIFAGLTAYDTQKLKEMYLYGNFDQEAAAKVSVFGALTLYLDFINMFQFLLAL 268

Query: 254 LGSRRD 259
           +G+R +
Sbjct: 269 MGNRNE 274


>gi|49474839|ref|YP_032880.1| hypothetical protein BH00080 [Bartonella henselae str. Houston-1]
 gi|49237644|emb|CAF26824.1| hypothetical protein BH00080 [Bartonella henselae str. Houston-1]
          Length = 257

 Score =  221 bits (563), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 124/241 (51%), Positives = 169/241 (70%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           ++IDQGLR+YM+ VYN MA+GL +T   ++ V  LATT +   A+  I+  V LT FG  
Sbjct: 17  ASIDQGLRSYMLGVYNTMAIGLLITAAAAYAVASLATTTEMSQAAAQISSSVYLTSFGVT 76

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
            YTSP  +I +FAPL   +FL+ ++++LS   A+ +F  Y+AL+GLSLSS  L YT++SI
Sbjct: 77  FYTSPFSYIIMFAPLVAVLFLSFKINTLSTSTARSLFFGYAALVGLSLSSIILRYTTESI 136

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           VQTF I+AA+FG+LSLYGYTTKRDL  +GSF  +G  GL L  +VN+F+ SSA+   +S 
Sbjct: 137 VQTFVISAATFGALSLYGYTTKRDLTAMGSFFFIGLVGLMLSMIVNIFLGSSALQFAISV 196

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +G+ IF+ LTAYDTQ IK  Y +        R+ ++GAL LY+DFI +FV LL+FLGS R
Sbjct: 197 IGVFIFAGLTAYDTQNIKLMYYEGDANDTQGRKIIMGALNLYLDFINMFVFLLQFLGSNR 256

Query: 259 D 259
           D
Sbjct: 257 D 257


>gi|163867314|ref|YP_001608508.1| hypothetical protein Btr_0009 [Bartonella tribocorum CIP 105476]
 gi|161016955|emb|CAK00513.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 257

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 178/259 (68%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M++ +N +    S +   ++IDQGLR YM+ VYN MA+GL +T   ++ +  LATT D  
Sbjct: 1   MANFKNLRSAPASHAD--ASIDQGLRDYMLGVYNTMAIGLLITAAAAYAIVSLATTTDMS 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A   IN  V LT FG   YTSP  +I +FAPL   +FL+ ++++LS  AA+ +FL Y+A
Sbjct: 59  QAVAQINSSVYLTSFGVTFYTSPFAYIVMFAPLIAVLFLSFKINTLSTNAARSLFLGYAA 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT++SI QTF I+AA+FG+LSLYGYTTKRDL  IGSF+ +G  GL L 
Sbjct: 119 LVGLSLSSIVLRYTTESIAQTFVISAATFGALSLYGYTTKRDLTAIGSFLFIGLIGLLLS 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +VN+F+ SSA+   +S +G+ IF+ LTAYDTQ IK  Y +  +     R+ ++GAL LY
Sbjct: 179 MVVNIFLGSSALQFAISVIGVFIFAGLTAYDTQNIKLMYYEGDEGDTRGRKVIMGALSLY 238

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +FV LL+FLGS RD
Sbjct: 239 LDFINMFVFLLQFLGSNRD 257


>gi|39933275|ref|NP_945551.1| acetate transporter [Rhodopseudomonas palustris CGA009]
 gi|39652900|emb|CAE25642.1| possible acetate transporter, stationary-phase anti-death (SAD)
           family [Rhodopseudomonas palustris CGA009]
          Length = 263

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 127/266 (47%), Positives = 180/266 (67%), Gaps = 11/266 (4%)

Query: 1   MSDI-RNYQRVVNSGSG--FGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY       +G    +T+D GLRAYM+R+YN M +GL +TG+ +  V + A T 
Sbjct: 1   MSDLDRNYTSPFGRAAGRVETATVDAGLRAYMLRIYNYMTIGLAITGLAALGVYMGAVTT 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           D  AA+  +    MLT FG  M+ SPL+W+FI APL +   ++  ++ L    A+++F  
Sbjct: 61  DAGAAAARVGN-TMLTSFGVAMFVSPLKWVFILAPLAMVFVISFGINRLKPATAQLLFWA 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           +SAL+G+SLSS FLVYT  SIV+ FFITAA+FG+LSLYGYTTKRD+  +GSF+IMG FG+
Sbjct: 120 FSALMGISLSSIFLVYTHTSIVRVFFITAAAFGALSLYGYTTKRDMTGMGSFLIMGLFGV 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY-----DVAYAERQS 232
            + SLVNLF+ SS +   +S +G+++F+ LTA+DTQ++K  Y   Y     DV  AER +
Sbjct: 180 VIASLVNLFVASSMLQFIVSVVGVLVFAGLTAWDTQRLKNDYIYGYGSMGGDV--AERAA 237

Query: 233 VIGALMLYMDFIQIFVHLLRFLGSRR 258
           + GAL LY++FI +F  LL+ LG + 
Sbjct: 238 ITGALSLYLNFINLFTLLLQLLGQKE 263


>gi|220921771|ref|YP_002497072.1| hypothetical protein Mnod_1779 [Methylobacterium nodulans ORS 2060]
 gi|219946377|gb|ACL56769.1| protein of unknown function UPF0005 [Methylobacterium nodulans ORS
           2060]
          Length = 274

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 119/246 (48%), Positives = 162/246 (65%), Gaps = 7/246 (2%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP------DAASIIINRGVMLTG 74
           +DQGLRA+M+ VYN M LGL V+ +++  VN LATT  P       A  ++   G  LT 
Sbjct: 29  VDQGLRAFMLGVYNNMVLGLAVSALVALGVNKLATTAVPAEAARNGAGQMVRIGGQYLTQ 88

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           FG  +YT+PL W+   APL      + R+  +SA +A+  FL ++A++G SLS+  L YT
Sbjct: 89  FGLTLYTTPLMWVVALAPLAFIFLFSFRMDRMSAASARTTFLAFAAVMGASLSTLLLRYT 148

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             S+VQ FFITAA+FG LSLYGY+T R L  IGSF++MG  GL + SLVN+F+ SSA+  
Sbjct: 149 GASVVQVFFITAAAFGGLSLYGYSTSRSLSGIGSFLVMGLIGLLIASLVNIFLASSALQF 208

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAY-SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
            +S +G+VIF+ LTAYDTQK+KE Y    +D   A + SV GAL LY+DFI +F  LL  
Sbjct: 209 AISVIGVVIFAGLTAYDTQKLKEMYLYGNFDQEAAAKVSVFGALTLYLDFINMFQFLLSL 268

Query: 254 LGSRRD 259
           +G+R +
Sbjct: 269 IGNRNE 274


>gi|86360280|ref|YP_472168.1| hypothetical protein RHE_PE00002 [Rhizobium etli CFN 42]
 gi|86284382|gb|ABC93441.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 236

 Score =  218 bits (556), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 113/247 (45%), Positives = 159/247 (64%), Gaps = 19/247 (7%)

Query: 12  NSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVM 71
           N+  G  +  D+GLR +M+RVYN M+LGL +TGI++F+V        P            
Sbjct: 9   NAVPGSQALFDEGLRQHMLRVYNYMSLGLVITGIVAFIVGSTPALYVP------------ 56

Query: 72  LTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFL 131
                  ++ SPL+W+ + APL    F + R+ ++SA  A++ F  + A++GLSL+S FL
Sbjct: 57  -------IFGSPLKWVVMLAPLAFVFFFSFRIQTMSASTAQITFWAFCAVMGLSLASVFL 109

Query: 132 VYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSA 191
           V+T  SI QTFFITAA FGS SLYGYTTKRDL  +GSF++MG FG+ +  +VN+F+ SSA
Sbjct: 110 VFTKTSIAQTFFITAAMFGSTSLYGYTTKRDLSKMGSFLMMGLFGIIIAGIVNIFLGSSA 169

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLL 251
           +   +S +G+V+F  LTAYDTQ IKE YS+ YD    ++ +V GAL LY++F+ IF  LL
Sbjct: 170 LQFAISVIGIVVFVGLTAYDTQNIKEQYSENYDQESNQKLAVFGALSLYLNFVNIFQLLL 229

Query: 252 RFLGSRR 258
            F G R 
Sbjct: 230 NFTGERE 236


>gi|323138794|ref|ZP_08073858.1| protein of unknown function UPF0005 [Methylocystis sp. ATCC 49242]
 gi|322395942|gb|EFX98479.1| protein of unknown function UPF0005 [Methylocystis sp. ATCC 49242]
          Length = 255

 Score =  218 bits (554), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 121/264 (45%), Positives = 172/264 (65%), Gaps = 17/264 (6%)

Query: 4   IRNYQRVVNSGSGFG------STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           + NY R  + G G G      + ID+GLRAYM+ VYN M +GL VTG+++ L   + +  
Sbjct: 1   MSNYDRNTSFGYGRGVARSTTAEIDEGLRAYMLGVYNYMTIGLAVTGLVA-LGTYMLSVA 59

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
              A  II      LT FG +++TSPLRW+ I +PL   +FL  R  ++SA  A+ +F  
Sbjct: 60  KVGAGQII------LTPFGQMIFTSPLRWVIILSPLAFVMFLGARATTMSAATARNLFFA 113

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           ++A++GLS+SS  LV+T  SI + FFITAA+FG LSLYGY TKRDL   GSF++MG +GL
Sbjct: 114 FAAVMGLSMSSILLVFTGASIARIFFITAAAFGGLSLYGYMTKRDLSAFGSFLVMGVWGL 173

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIG 235
            +  LVNLF++S+ +   +S + +++F+ LTA+DTQ IK+ Y   D Y+V  A+++SV G
Sbjct: 174 VIAGLVNLFLQSTGLQFALSIIAVLVFAGLTAWDTQNIKDMYYEGDGYEV--AQKKSVFG 231

Query: 236 ALMLYMDFIQIFVHLLRFLGSRRD 259
           AL LY+DFI +F  LL   G R D
Sbjct: 232 ALSLYLDFINMFQSLLYLFGQRND 255


>gi|144897621|emb|CAM74485.1| Protein of unknown function UPF0005 [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 240

 Score =  216 bits (551), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 162/241 (67%), Gaps = 19/241 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + ID GLR YM+RVYN+MALGL +TG ++ LV        P A  +I             
Sbjct: 18  AQIDVGLRQYMLRVYNMMALGLALTGGVALLV-----ASSPAALQMI------------- 59

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
            + +PL+W+ + AP+G+  FL++R+H++ A  A+ +F LY+AL+G SL+S F+V+T  SI
Sbjct: 60  -FGTPLKWVVMLAPVGLAFFLSMRIHAMKASTAQGVFWLYAALMGASLASVFIVFTGASI 118

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            +TFF+TAA+F  LSL+GYTTKR L  +G+F+ MG  GL + S+VN+F+ SS +   +SA
Sbjct: 119 ARTFFVTAAAFAGLSLWGYTTKRSLSGMGTFLFMGTIGLLIASVVNIFLASSMLQFVISA 178

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            G++IF+ LTAYDTQKIKE Y +  D   A +++V GAL LYMDFI +F  LL F+G R 
Sbjct: 179 AGVLIFAGLTAYDTQKIKEMYFELDDSETASKKAVFGALSLYMDFIMLFQFLLHFMGVRN 238

Query: 259 D 259
           D
Sbjct: 239 D 239


>gi|255262200|ref|ZP_05341542.1| inner membrane protein YbhL [Thalassiobium sp. R2A62]
 gi|255104535|gb|EET47209.1| inner membrane protein YbhL [Thalassiobium sp. R2A62]
          Length = 258

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 115/257 (44%), Positives = 177/257 (68%), Gaps = 5/257 (1%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
            Y  V + GS   + ID GLRA+M +VY  M++G+ +T + ++ ++ LATT DP  A+  
Sbjct: 3   QYDTVGSVGSVRTANIDAGLRAHMNKVYGTMSVGMLITALAAWAISGLATTTDPALAAAQ 62

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIF-LNVRLHSLSAYAAKMMFLLYSALIGL 124
           I++   LT  G  +YTSPLRW+ +FAPL VF+F  +  ++ +SA  A+++F  ++A++GL
Sbjct: 63  ISQNTYLTNLGVTLYTSPLRWVIMFAPL-VFVFGFSAMINRMSAATAQVVFYAFAAVMGL 121

Query: 125 SLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN 184
           SLS  F+VYTS SI+Q F +TA +F  LSL+GYTTK+D+   GSF+IMG  GL + S++N
Sbjct: 122 SLSWIFMVYTSFSIIQVFLVTAIAFAGLSLWGYTTKKDISGWGSFLIMGVIGLIVASIIN 181

Query: 185 LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYM 241
           +++ S AI   +S +G++IF+ LTAYDTQKIK    A++   D  +  + +++GAL LY+
Sbjct: 182 IWLASPAILYAISIIGVLIFAGLTAYDTQKIKNDYLAHAAHGDSEWLGKSAIMGALNLYL 241

Query: 242 DFIQIFVHLLRFLGSRR 258
           DFI +F+ LL+ LG+R 
Sbjct: 242 DFINMFMFLLQLLGNRE 258


>gi|316931832|ref|YP_004106814.1| hypothetical protein Rpdx1_0440 [Rhodopseudomonas palustris DX-1]
 gi|315599546|gb|ADU42081.1| protein of unknown function UPF0005 [Rhodopseudomonas palustris
           DX-1]
          Length = 263

 Score =  216 bits (550), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 123/264 (46%), Positives = 177/264 (67%), Gaps = 7/264 (2%)

Query: 1   MSDI-RNYQRVVNSGSG--FGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY       +G    +T+D GLRAYM+R+YN M +GL +TG+ +  V + A T 
Sbjct: 1   MSDLDRNYASPFGRAAGRVETATVDAGLRAYMLRIYNYMTIGLAITGLAALGVYMGAVTT 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           D  AA+  +    MLT FG  M+ SPL+W+FI APL +   ++  ++ L    A+++F  
Sbjct: 61  DAGAAAARVGN-TMLTSFGVAMFVSPLKWVFILAPLAMVFVISFGINRLKPATAQLLFWA 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           +SAL+G+SLSS FLVYT  SIV+ FFITAA+FG+LSLYGYTTKRD+  +GSF+IMG  G+
Sbjct: 120 FSALMGISLSSIFLVYTHTSIVRVFFITAAAFGALSLYGYTTKRDMTGMGSFLIMGLIGV 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVI 234
            + SLVNLF+ SS +   +S +G+++F+ LTA+DTQ++K  Y   +       AER ++ 
Sbjct: 180 VIASLVNLFVASSMLQFIVSVVGVLVFAGLTAWDTQRLKNDYIYGAGSMGGEVAERAAIT 239

Query: 235 GALMLYMDFIQIFVHLLRFLGSRR 258
           GAL LY++FI +F  LL+ LG + 
Sbjct: 240 GALSLYLNFINLFTLLLQLLGQKE 263


>gi|182677821|ref|YP_001831967.1| hypothetical protein Bind_0828 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633704|gb|ACB94478.1| protein of unknown function UPF0005 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 256

 Score =  216 bits (549), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 177/264 (67%), Gaps = 13/264 (4%)

Query: 1   MSDI-RNYQRVVNSG-SGFG-STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD  RN       G +G G +TIDQGLRAYM+ VYN M +GL +TG+++   N+LA   
Sbjct: 1   MSDFDRNVSARWGQGLAGAGRTTIDQGLRAYMLGVYNHMVIGLAITGLVALGTNMLAVVH 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           D +           LT FG  +Y SPL+W+ + APLG  +F+++R+  ++A  A+ +F  
Sbjct: 61  DANG------HIAGLTAFGQALYLSPLKWVAMLAPLGFVLFISLRIEQMAASTARTLFFA 114

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           ++A +GLSLS+  LVYT  S+ + FFITAA+F  LSLYGYTTKRDL PIGSF++MG  GL
Sbjct: 115 FAATMGLSLSTLLLVYTGTSVARAFFITAAAFAGLSLYGYTTKRDLSPIGSFLVMGLIGL 174

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIG 235
            + SLVNLF++S+A    +S + ++IFS LTA+DTQ IK  Y  SD Y+V  A ++SV G
Sbjct: 175 VIASLVNLFVQSTAFQFGLSILSVLIFSGLTAWDTQAIKAMYYESDGYEV--ATKKSVNG 232

Query: 236 ALMLYMDFIQIFVHLLRFLGSRRD 259
           ALMLY+DFI IF  LL   GSR D
Sbjct: 233 ALMLYLDFINIFQSLLMLTGSRND 256


>gi|154251848|ref|YP_001412672.1| hypothetical protein Plav_1395 [Parvibaculum lavamentivorans DS-1]
 gi|154155798|gb|ABS63015.1| protein of unknown function UPF0005 [Parvibaculum lavamentivorans
           DS-1]
          Length = 252

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 173/258 (67%), Gaps = 12/258 (4%)

Query: 6   NYQRVVNSGSGFGS----TIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA 61
           NY++     S  G+     +D+GLR+YM+RVYN MA  L +TG++++     A  V   A
Sbjct: 3   NYEQERLHQSRLGARANMAVDEGLRSYMLRVYNYMAGALALTGLVAYFAYTAA--VQETA 60

Query: 62  ASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
                  G +LT  G  +Y SPL+W+ + APL   + L+  +  LS  A +++F  ++ +
Sbjct: 61  G------GPVLTSLGETLYASPLKWVVMLAPLAFVMVLSFGIQRLSLSATQLLFWAFAGV 114

Query: 122 IGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS 181
           +GLSLSS FLV+T +SI  TFF+TAA+FGSLSLYGYTTKRDL  +GSF+ MG  G+ +  
Sbjct: 115 MGLSLSSIFLVFTGESITTTFFVTAAAFGSLSLYGYTTKRDLTGMGSFLFMGLIGIIIAM 174

Query: 182 LVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYM 241
           +VN+F+ SSA+   +S +G++IF+ LTAYDTQ+IK  Y +   VA A +++V+GAL LY+
Sbjct: 175 VVNIFLASSALQFAISVLGVLIFAGLTAYDTQRIKGMYYEGDSVAAAGKKAVMGALSLYL 234

Query: 242 DFIQIFVHLLRFLGSRRD 259
           DFI +F+ LL+F+GS+R 
Sbjct: 235 DFINMFMFLLQFMGSQRS 252


>gi|75674611|ref|YP_317032.1| hypothetical protein Nwi_0413 [Nitrobacter winogradskyi Nb-255]
 gi|74419481|gb|ABA03680.1| Protein of unknown function UPF0005 [Nitrobacter winogradskyi
           Nb-255]
          Length = 263

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 124/264 (46%), Positives = 175/264 (66%), Gaps = 7/264 (2%)

Query: 1   MSDI-RNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY   +    G    + +D GLRAYM+++YN M++GL +TG+ +  V + A T 
Sbjct: 1   MSDLDRNYATPLGRADGRVDAAAVDAGLRAYMLKIYNYMSIGLAITGLAALGVYMAAVTG 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           DP  A+  +     LT FG  M+ SPL+W+FI APL +   ++  ++ L    A+M+F  
Sbjct: 61  DPSGAAAKLGN-AYLTPFGYAMFVSPLKWVFILAPLAMVFVISFGINRLKPATAQMLFWA 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           +SAL+GLSLSS FLVYT  SIV+ FFITAASFG+LSL+GYTTKRD+  +GSF+ MG  G+
Sbjct: 120 FSALMGLSLSSIFLVYTHTSIVRVFFITAASFGALSLFGYTTKRDMTGMGSFLFMGLIGV 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDV---AYAERQSVI 234
            + SLVNLF+ SSA+   +S  G+++F+ LTA+DTQ++K  Y   Y       AER ++ 
Sbjct: 180 IIASLVNLFIASSALQFVVSVAGVLVFAGLTAWDTQRLKNDYIYGYASQGGEIAERAAIT 239

Query: 235 GALMLYMDFIQIFVHLLRFLGSRR 258
           GAL LY++FI +F  LL+ LG R 
Sbjct: 240 GALSLYLNFINLFTLLLQLLGQRE 263


>gi|298293318|ref|YP_003695257.1| hypothetical protein Snov_3364 [Starkeya novella DSM 506]
 gi|296929829|gb|ADH90638.1| protein of unknown function UPF0005 [Starkeya novella DSM 506]
          Length = 260

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 121/241 (50%), Positives = 168/241 (69%), Gaps = 2/241 (0%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + ID GLR+YM+RVYN M LGL +TG  +  + +LA +  P  A+I    GV LT FG  
Sbjct: 22  AEIDLGLRSYMLRVYNYMTLGLAITGAAALGIYMLAVSDVPTQAAI--APGVYLTQFGVA 79

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           M+ SPLRW+ + APL    FL+ R+  LS  AA+ +F LY+ L+G+SL+S FLVY  +SI
Sbjct: 80  MFFSPLRWVVMLAPLAAVFFLSFRVDRLSVGAAQGIFWLYAGLVGVSLASIFLVYAHESI 139

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           V+ FFITAA+FG LSLYGYTT R L  +GSF+IMG  G+ + SLVN+F+ SS +   +S 
Sbjct: 140 VRVFFITAATFGGLSLYGYTTTRSLSGMGSFLIMGLIGIIIASLVNIFLGSSMLQFVISV 199

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +G+++F+ LTAYDTQ+IKE Y    D   A R++++GAL LY+DFI +F+ LL+  G+R 
Sbjct: 200 VGVLVFAGLTAYDTQRIKEMYFAGDDDVVAGRKAIMGALTLYLDFINLFLMLLQLFGNRN 259

Query: 259 D 259
           +
Sbjct: 260 N 260


>gi|163793901|ref|ZP_02187875.1| hypothetical protein BAL199_12751 [alpha proteobacterium BAL199]
 gi|159181012|gb|EDP65529.1| hypothetical protein BAL199_12751 [alpha proteobacterium BAL199]
          Length = 243

 Score =  215 bits (547), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 112/237 (47%), Positives = 166/237 (70%), Gaps = 12/237 (5%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GLR YM+ VYN M   L  TGI+++   +LA           +  G M TGFG  +Y 
Sbjct: 19  DVGLRQYMLGVYNHMVSALVFTGIVAYATTVLA-----------VQDGAM-TGFGQAIYA 66

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           SPL+W+ + APLG+   L+ R+ S+S  +A++ F +++AL+GLSLSS FLV+T +S+V+ 
Sbjct: 67  SPLKWVVMLAPLGMVFLLSARIRSMSLGSARISFYVFAALMGLSLSSIFLVFTGESVVRV 126

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FFITAA+FG LSLYGYTTK+DL   GSF+IMG FG+ + S+VN+F+ SSA+   +S +G+
Sbjct: 127 FFITAAAFGGLSLYGYTTKKDLSGFGSFLIMGLFGIIIASIVNIFLASSALQFAISVIGV 186

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++F+ LTAYDTQ+IKE Y++      A +++++GAL LY++FI +F+ LL+  G+R 
Sbjct: 187 LVFAGLTAYDTQRIKEMYNEIDASDIAGKKAIMGALSLYLNFINMFMLLLQLFGNRE 243


>gi|190895319|ref|YP_001985611.1| hypothetical protein RHECIAT_PA0000002 [Rhizobium etli CIAT 652]
 gi|218515855|ref|ZP_03512695.1| hypothetical protein Retl8_20301 [Rhizobium etli 8C-3]
 gi|190699264|gb|ACE93348.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 236

 Score =  214 bits (546), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 110/237 (46%), Positives = 154/237 (64%), Gaps = 19/237 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D+GLR +M+RVYN M LGL +TGI++F+V        P                   ++ 
Sbjct: 19  DEGLRQHMLRVYNYMGLGLVITGIVAFIVGSTPALYVP-------------------IFG 59

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           SPL+W+ + APL    F + R+ ++SA  A++ F  + A++GLSL+S FLV+T  SI QT
Sbjct: 60  SPLKWVVMLAPLAFVFFFSFRIQTMSASTAQITFWAFCAVMGLSLASVFLVFTKTSIAQT 119

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FFITAA FG+ SLYGYTTKRDL  +GSF++MG FG+ +  +VN+F+ SSA+   +S +G+
Sbjct: 120 FFITAAMFGTTSLYGYTTKRDLSRMGSFLMMGLFGIIIAGIVNIFLGSSALQFAISVIGI 179

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           V+F  LTAYDTQ IKE YS+ YD    ++ +V GAL LY++F+ IF  LL F G R 
Sbjct: 180 VVFVGLTAYDTQNIKEQYSENYDQESNQKLAVFGALSLYLNFVNIFQLLLNFTGERE 236


>gi|296445157|ref|ZP_06887117.1| protein of unknown function UPF0005 [Methylosinus trichosporium
           OB3b]
 gi|296257331|gb|EFH04398.1| protein of unknown function UPF0005 [Methylosinus trichosporium
           OB3b]
          Length = 258

 Score =  214 bits (546), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 116/243 (47%), Positives = 157/243 (64%), Gaps = 9/243 (3%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + ID+GLRAYMI VYN M LGLGVTG ++   +++A             R + LT FG L
Sbjct: 22  AQIDEGLRAYMIGVYNHMVLGLGVTGFVALATHMMAVASQS-------GRQIELTSFGHL 74

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +Y +PL+W+ + APL    FL  R   +SA  A+ +FL +SA++GLS+S+  LV+T  S+
Sbjct: 75  LYATPLKWVVMLAPLAFVFFLGFRADRISAATARNVFLAFSAVMGLSMSTIMLVFTGASV 134

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            + FFITAA+FG LSLYGY TKRDL   GSF++MG +GL +  LVNLF +SSA+   +S 
Sbjct: 135 AKVFFITAAAFGGLSLYGYLTKRDLSAFGSFLVMGLWGLVIAGLVNLFFQSSALQFGLSI 194

Query: 199 MGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           + + IF+ LTA+DTQ+IK+ Y  S  Y    A + SV GAL LY+DFI +F  LL   G 
Sbjct: 195 LSVFIFAGLTAWDTQQIKDGYYQSAGYGQEVAAKASVFGALSLYLDFINMFQSLLFLFGD 254

Query: 257 RRD 259
           R  
Sbjct: 255 RNS 257


>gi|167045735|gb|ABZ10382.1| putative uncharacterized protein family UPF0005 [uncultured marine
           bacterium HF4000_APKG2098]
          Length = 259

 Score =  214 bits (545), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 111/238 (46%), Positives = 162/238 (68%), Gaps = 6/238 (2%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           ID+GLRA+M++VYN M  G+ +TGI+S  +  L+  + PD +         LT  G  +Y
Sbjct: 28  IDEGLRAHMLKVYNYMTSGIFLTGIISLFLFKLSVVMSPDGSI------AGLTSVGNALY 81

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S L W+ + APLGV  +++  +  +SA  A+M F +++AL+G SLSS FLVYT +SI +
Sbjct: 82  NSALMWVVMLAPLGVVFYMSFGIRKMSAAKAQMTFWIFAALMGASLSSIFLVYTGESITR 141

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            FFITA +FG++S+YGYTTKRDL  +GSF++MG  G+ + S+VN+FM+S+ +   +S +G
Sbjct: 142 VFFITAGTFGAMSIYGYTTKRDLTKLGSFLMMGLIGIIIASIVNIFMKSTMMYFVISILG 201

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++IF  LTAYDTQKIK  YS         +++V+GAL LY+DFI +F+ LLR  G RR
Sbjct: 202 VLIFVGLTAYDTQKIKNMYSVSDSGEIMGKKAVMGALTLYLDFINLFIMLLRLFGQRR 259


>gi|327189278|gb|EGE56454.1| hypothetical protein RHECNPAF_68008 [Rhizobium etli CNPAF512]
          Length = 236

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 109/237 (45%), Positives = 154/237 (64%), Gaps = 19/237 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D+GLR +M+RVYN M LGL +TGI++F+V        P                   ++ 
Sbjct: 19  DEGLRQHMLRVYNYMGLGLVITGIVAFIVGSTPALYVP-------------------IFG 59

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           SPL+W+ + APL    F + R+ ++SA  A++ F  + A++GLSL+S FLV+T  SI QT
Sbjct: 60  SPLKWVVMLAPLAFVFFFSFRIQTMSASTAQITFWAFCAVMGLSLASVFLVFTKTSIAQT 119

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FFITAA FG+ SLYGYTTKRDL  +GSF++MG FG+ +  +VN+F+ SSA+   +S +G+
Sbjct: 120 FFITAAMFGTTSLYGYTTKRDLSRMGSFLMMGLFGIIIAGIVNIFLGSSALQFAISVIGI 179

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++F  LTAYDTQ IKE YS+ YD    ++ +V GAL LY++F+ IF  LL F G R 
Sbjct: 180 IVFVGLTAYDTQNIKEQYSENYDQESNQKLAVFGALSLYLNFVNIFQLLLNFTGERE 236


>gi|86140029|ref|ZP_01058593.1| membrane protein, putative [Roseobacter sp. MED193]
 gi|85823279|gb|EAQ43490.1| membrane protein, putative [Roseobacter sp. MED193]
          Length = 258

 Score =  214 bits (544), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 111/241 (46%), Positives = 164/241 (68%), Gaps = 3/241 (1%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           ID GLRA+M +VY  M+ GL +T + ++ ++ LA T DP +A+ +I  G  LT FG  +Y
Sbjct: 18  IDAGLRAHMNKVYGTMSAGLFITFLAAWALSNLAVTSDPASATAMIGEGKYLTSFGNAIY 77

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            SPL+W+ + APL          + +SA   +++F +++A++GLSLSS FLV+T +SI+Q
Sbjct: 78  LSPLKWVIMLAPLAFIFGFGAAANRMSAAGVQLLFYVFAAVMGLSLSSIFLVFTGQSIIQ 137

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            F ITA SF  LSL GYTTK+DL  +G+F+IMG  GL + S+VN+FM+S A+   +S +G
Sbjct: 138 VFLITAISFAGLSLVGYTTKKDLSAMGAFLIMGLIGLIVASIVNMFMQSGAMAFAISVIG 197

Query: 201 LVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           ++IF+ LTAYDTQKIK  Y   +   D  +  + +++GAL LY+DFI +FV LL+ LG+R
Sbjct: 198 VLIFAGLTAYDTQKIKTTYLEMAHSGDQEWLGKAAIMGALSLYLDFINLFVMLLQLLGNR 257

Query: 258 R 258
            
Sbjct: 258 E 258


>gi|146337543|ref|YP_001202591.1| putative transport protein membrane protein [Bradyrhizobium sp.
           ORS278]
 gi|146190349|emb|CAL74345.1| putative transport protein; putative membrane protein
           [Bradyrhizobium sp. ORS278]
          Length = 263

 Score =  214 bits (544), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 126/263 (47%), Positives = 177/263 (67%), Gaps = 7/263 (2%)

Query: 1   MSDI-RNYQRVVN--SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY       +G    +T+D GLRAYM+R+YN M++GL +TG+ +  V + A T 
Sbjct: 1   MSDLNRNYASPFGRVAGRADAATVDAGLRAYMLRIYNYMSIGLAITGLAALGVYMAAVTG 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           DP AA +       LT FG  M+ SPL+W+FI APL +   ++  ++ L+   A+++F +
Sbjct: 61  DP-AAGVFKFGNAYLTQFGYAMFVSPLKWLFILAPLVMVFAISAGINRLAPSTAQLLFWV 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           +SAL+G+SLSS FLVYT  SIV+ FFITAA+FG+LSLYGYTTKRD+   GSF+ MG  G+
Sbjct: 120 FSALMGVSLSSIFLVYTHTSIVRVFFITAATFGALSLYGYTTKRDMTGFGSFLFMGLIGI 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVA---YAERQSVI 234
            L SLVNLF+ SS +   +S +G+ +F+ LTA+DTQ++K  Y   Y  A    AER ++ 
Sbjct: 180 VLASLVNLFLASSMLQFIVSVIGVFVFAGLTAWDTQRLKNEYIYGYASAGGDIAERAAIT 239

Query: 235 GALMLYMDFIQIFVHLLRFLGSR 257
           GAL LY++FI +F  LL+ LG R
Sbjct: 240 GALSLYLNFINLFTLLLQLLGQR 262


>gi|27375573|ref|NP_767102.1| ABC transporter permease [Bradyrhizobium japonicum USDA 110]
 gi|27348710|dbj|BAC45727.1| blr0462 [Bradyrhizobium japonicum USDA 110]
          Length = 278

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 180/263 (68%), Gaps = 7/263 (2%)

Query: 1   MSDI-RNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY       +G    +T+D GLRAYM+R+YN M++GL +TG+ +  V + A T 
Sbjct: 16  MSDLDRNYASPFGRAAGRVDAATVDAGLRAYMLRIYNYMSIGLAITGLAALGVYMAAVTD 75

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
            P   ++ + + + LT FG  M+ SPL+W+F+ APL +   ++  ++ L+   A+++F +
Sbjct: 76  VPTPEAVRVGK-LFLTPFGYAMFVSPLKWLFMLAPLAMVFVISAGINRLAPSTAQILFWV 134

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           +SAL+G+SLSS FLV+T  SIV+ FFITAA+FG+LSLYGYTTKRDL  +GSF+ MG  G+
Sbjct: 135 FSALMGISLSSIFLVFTHTSIVRVFFITAATFGALSLYGYTTKRDLTGMGSFLFMGLIGI 194

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVA---YAERQSVI 234
            + SLVNLF+ SS +   +S +G+++F+ LTA+DTQ++K  Y   Y  A    AER ++ 
Sbjct: 195 IIASLVNLFLASSMLQFIVSVVGVLVFAGLTAWDTQRLKNDYIYGYAAAGGDIAERAAIT 254

Query: 235 GALMLYMDFIQIFVHLLRFLGSR 257
           GAL LY++FI +F  LL+ LG R
Sbjct: 255 GALSLYLNFINLFTLLLQLLGQR 277


>gi|188581477|ref|YP_001924922.1| hypothetical protein Mpop_2225 [Methylobacterium populi BJ001]
 gi|179344975|gb|ACB80387.1| protein of unknown function UPF0005 [Methylobacterium populi BJ001]
          Length = 255

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 113/239 (47%), Positives = 161/239 (67%), Gaps = 8/239 (3%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           +DQGLR++M+ VYN M +GLG++G+++  +N +A      A  +       LT FG  +Y
Sbjct: 24  VDQGLRSFMLGVYNNMVVGLGISGLVALALN-MAAVAQTGAGRLA------LTPFGQFLY 76

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
           TSP +W+ + APL      + R+  +SA +A+MMF  ++A++G S+S+  LV+T  S+V+
Sbjct: 77  TSPFKWVLMLAPLAFIFVFSFRMDRMSASSARMMFWAFAAVMGASMSTLLLVFTGASVVR 136

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            FFITAA+FG LSLYGYTTKR L  +GSF+IMG  GL + SLVN+F+ SSA+   +S +G
Sbjct: 137 VFFITAATFGGLSLYGYTTKRSLSGMGSFLIMGLIGLIIASLVNIFLASSALQFAISVIG 196

Query: 201 LVIFSALTAYDTQKIKEAY-SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++IF+ LTAYDTQK+KE Y     D   A + SV GAL LY+DFI +F  LL  +G RR
Sbjct: 197 VLIFAGLTAYDTQKLKEMYLYSGLDAEGAAKMSVNGALTLYLDFINMFQFLLSLMGDRR 255


>gi|148251994|ref|YP_001236579.1| putative transport protein [Bradyrhizobium sp. BTAi1]
 gi|146404167|gb|ABQ32673.1| putative transport protein [Bradyrhizobium sp. BTAi1]
          Length = 263

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 125/263 (47%), Positives = 178/263 (67%), Gaps = 7/263 (2%)

Query: 1   MSDI-RNYQRVVN--SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY       +G    +T+D GLRAYM+R+YN M++GL +TG+ +  V + + T 
Sbjct: 1   MSDLDRNYASPFGRVAGRADAATVDAGLRAYMLRIYNYMSIGLAITGLAALGVYMASVTG 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           DP AA +       LT FG  M+ SPL+W+FI APL +   ++  ++ L+   A+++F +
Sbjct: 61  DP-AAGVFKFGNAYLTQFGYAMFVSPLKWLFILAPLVMVFAISAGINRLAPSTAQILFWV 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           +SAL+G+SLSS FLVYT  SIV+ FFITAA+FG+LSLYGYTTKRD+  +GSF+ MG  G+
Sbjct: 120 FSALMGISLSSIFLVYTHTSIVRVFFITAATFGALSLYGYTTKRDMTGMGSFLFMGLIGI 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVA---YAERQSVI 234
            L SLVNLF+ SS +   +S +G+ +F+ LTA+DTQ++K  Y   Y  A    AER ++ 
Sbjct: 180 VLASLVNLFLASSMLQFIVSVVGVFVFAGLTAWDTQRLKNEYIYGYASAGGDIAERAAIT 239

Query: 235 GALMLYMDFIQIFVHLLRFLGSR 257
           GAL LY++FI +F  LL+ LG R
Sbjct: 240 GALSLYLNFINLFTLLLQLLGQR 262


>gi|71082996|ref|YP_265715.1| integral membrane protein [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062109|gb|AAZ21112.1| integral membrane protein [Candidatus Pelagibacter ubique HTCC1062]
          Length = 232

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 108/238 (45%), Positives = 163/238 (68%), Gaps = 6/238 (2%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           +D+GLRAYM++VYN MA G+ +TG++S +   L+   D + +         LT  G  ++
Sbjct: 1   MDEGLRAYMLKVYNYMASGILLTGLISLIFFKLSVVTDANGSI------TALTSLGNTIF 54

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S  +WI + APLGV  +++ R++ ++A  A+  F ++++L+GLSLSS FLVYT  SI +
Sbjct: 55  LSGFKWIVMLAPLGVVFYMSARINKMTASTAQTTFWVFASLMGLSLSSIFLVYTGASITR 114

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            FFIT+ +FG++SLYGYTTKRDL  +GSF++MG  G+ + S+VN+F++SS +D  +S +G
Sbjct: 115 VFFITSITFGAMSLYGYTTKRDLTKLGSFLMMGLIGIIVASVVNMFLKSSMMDFVISILG 174

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++IF  LTAYDTQKIK  Y          +++V+GAL LY+DFI +F+ LLR  G RR
Sbjct: 175 VLIFVGLTAYDTQKIKNMYVSSDTGELMGKKAVMGALTLYLDFINLFIMLLRLFGQRR 232


>gi|86747413|ref|YP_483909.1| hypothetical protein RPB_0287 [Rhodopseudomonas palustris HaA2]
 gi|86570441|gb|ABD04998.1| Protein of unknown function UPF0005 [Rhodopseudomonas palustris
           HaA2]
          Length = 263

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 126/267 (47%), Positives = 179/267 (67%), Gaps = 13/267 (4%)

Query: 1   MSDI-RNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY       +G    + +D GLR+YM+R+YN M +GL +TG+ +  V + A T 
Sbjct: 1   MSDLDRNYASPFGRAAGRVDSAAVDAGLRSYMLRIYNYMTIGLAITGLAALGVYMGAVT- 59

Query: 58  DPDAASIIINRG-VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFL 116
            PDAA      G   LT FG  M+ SPL+W+FI APL +   ++  ++ L    A+++F 
Sbjct: 60  -PDAAGAAGKIGNTYLTTFGVAMFASPLKWVFILAPLAMVFAISFGINRLKPATAQLLFW 118

Query: 117 LYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFG 176
            ++AL+G+SLSS FLVYT  SIV+ FFITAASFG+LSLYGYTTKRD+  +GSF+IMG FG
Sbjct: 119 AFAALMGISLSSIFLVYTHTSIVRVFFITAASFGALSLYGYTTKRDMTGMGSFLIMGLFG 178

Query: 177 LFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY-----SDRYDVAYAERQ 231
           + + S+VNLF+ SS +   +S +G+++F+ LTAYDTQ++K  Y     S+  DV  AER 
Sbjct: 179 VIIASVVNLFVASSMLQFIVSVVGVLVFAGLTAYDTQRLKNDYMYGYASEGGDV--AERA 236

Query: 232 SVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++ GAL LY++FI +F  LL+ LG + 
Sbjct: 237 AITGALSLYLNFINLFTLLLQLLGQKE 263


>gi|222087253|ref|YP_002545788.1| hypothetical protein Arad_4062 [Agrobacterium radiobacter K84]
 gi|221724701|gb|ACM27857.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 238

 Score =  212 bits (539), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 108/246 (43%), Positives = 159/246 (64%), Gaps = 19/246 (7%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
           + +G  +  D+GLR +M+RVYN M +GL VTGI++ +V        P             
Sbjct: 12  AAAGSQALFDEGLRKHMLRVYNYMGIGLVVTGIVAMIVGTTPALYVP------------- 58

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
                 ++ SPL+W+ + APL   +F + R+ ++SA AA+ MF  + A++GLSL+S FLV
Sbjct: 59  ------IFQSPLKWVVMLAPLAFVLFFSFRIQTMSASAAQTMFWAFCAVMGLSLASVFLV 112

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           +T  SI +TFFI A  FG+ SLYGYTTKRDL  IGSF++MG FG+ + S+VN+F+ SSA+
Sbjct: 113 FTGTSIARTFFIAATMFGATSLYGYTTKRDLANIGSFLMMGLFGVIIASVVNIFLGSSAL 172

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
              +S +G+V+F  LTA+DTQ IKE Y++ +D   +++ +V GAL LY++F+ IF  LL 
Sbjct: 173 QFAISIIGIVVFVGLTAWDTQNIKEQYAENHDQETSQKLAVFGALSLYLNFVNIFQLLLN 232

Query: 253 FLGSRR 258
           F G R 
Sbjct: 233 FTGERE 238


>gi|90421724|ref|YP_530094.1| hypothetical protein RPC_0200 [Rhodopseudomonas palustris BisB18]
 gi|90103738|gb|ABD85775.1| protein of unknown function UPF0005 [Rhodopseudomonas palustris
           BisB18]
          Length = 271

 Score =  212 bits (539), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 127/272 (46%), Positives = 177/272 (65%), Gaps = 17/272 (6%)

Query: 1   MSDI-RNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD  RNY       +G    + +D GLRAYM+R+YN M +GL +TG  +  V   A T 
Sbjct: 1   MSDFDRNYASPFGRAAGRVDAAAVDAGLRAYMLRIYNYMTIGLAITGAAALGVYKFAVTS 60

Query: 58  D-------PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYA 110
           D          A+I +  G  LT FG +M+ SPL+W+FI APL +   ++  ++ L    
Sbjct: 61  DMAEAVRSASGAAIRVAEGQFLTSFGYMMFASPLKWVFILAPLVMVFAISFGINRLKPAT 120

Query: 111 AKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFM 170
           A+M+F  ++AL+G+SLSS FLVYT  SIV+ FFITAASFG+LSLYGYTTKRDL  +GSF+
Sbjct: 121 AQMLFWAFAALMGISLSSIFLVYTHTSIVRVFFITAASFGALSLYGYTTKRDLTGMGSFL 180

Query: 171 IMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY-----SDRYDV 225
           +MG FG+ L SLVNLF+ S+ +   +S +G+++F+ LTA+DTQ++K  Y     S   DV
Sbjct: 181 MMGLFGVILASLVNLFVASTMLQFIVSVVGVLVFAGLTAWDTQRLKNDYIYGYASQGGDV 240

Query: 226 AYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
             A+R ++ GAL LY++FI +F  LL+ LG R
Sbjct: 241 --ADRAAITGALSLYLNFINLFTLLLQLLGQR 270


>gi|46201126|ref|ZP_00055766.2| COG0670: Integral membrane protein, interacts with FtsH
           [Magnetospirillum magnetotacticum MS-1]
          Length = 231

 Score =  211 bits (538), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 111/242 (45%), Positives = 158/242 (65%), Gaps = 19/242 (7%)

Query: 18  GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
            S ID GLR YM+ VYN MA  L +TGI+++++           AS+            A
Sbjct: 8   ASQIDVGLRQYMLSVYNYMASALALTGIVAWVI-----------ASV--------PALTA 48

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           +   SPL+W+F+ APLG+  F++ ++ S+ A  A  +F +Y+ L+G SL+S FLV+T  S
Sbjct: 49  IAVYSPLKWVFMLAPLGLVFFMSAKIDSMRASTASTLFWVYAGLMGASLASVFLVFTGAS 108

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           + + FFITAA+F  LSLYGYTTK+DL   GSF+IMG +GL +  +VN+F+ S  +   MS
Sbjct: 109 VARVFFITAAAFAGLSLYGYTTKKDLSGFGSFLIMGVWGLMIAGIVNIFLASPMLHFVMS 168

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           A G++IF+ LTAYDTQ IK+ Y +  D   A +++V GAL LYMDFI +F+ LL+F+G R
Sbjct: 169 AAGVLIFAGLTAYDTQNIKQMYWEGDDSEVASKKAVFGALQLYMDFINLFMFLLQFMGVR 228

Query: 258 RD 259
           RD
Sbjct: 229 RD 230


>gi|218461564|ref|ZP_03501655.1| hypothetical protein RetlK5_19577 [Rhizobium etli Kim 5]
          Length = 236

 Score =  211 bits (538), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 109/244 (44%), Positives = 157/244 (64%), Gaps = 19/244 (7%)

Query: 15  SGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           +G  +  D+GLR +M+RVYN MALGL +TG+++F+V        P               
Sbjct: 12  AGSQAVFDEGLRQHMLRVYNYMALGLVITGLVAFVVGSTPALYVP--------------- 56

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
               ++ SPL+W+ + APL    F + R+ ++SA  A++ F  + A++GLSL+S FLV+T
Sbjct: 57  ----IFGSPLKWVVMLAPLAFVFFFSFRIQAMSASTAQITFWAFCAVMGLSLASVFLVFT 112

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI +TFFITA  FG+ SLYGY TKRDL  +GSF++MG FG+ + S+VN+F+ SSA+  
Sbjct: 113 GMSIARTFFITATMFGATSLYGYVTKRDLSRMGSFLMMGLFGVIIASIVNIFLGSSALQF 172

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
            +S +G+V+F  LTAYDTQ IKE YS+ YD    ++ +V GAL LY++F+ IF  LL F 
Sbjct: 173 AISVIGIVVFVGLTAYDTQNIKEQYSENYDQESNQKLAVFGALSLYLNFVNIFTLLLNFT 232

Query: 255 GSRR 258
           G R 
Sbjct: 233 GERE 236


>gi|299135434|ref|ZP_07028624.1| protein of unknown function UPF0005 [Afipia sp. 1NLS2]
 gi|298589842|gb|EFI50047.1| protein of unknown function UPF0005 [Afipia sp. 1NLS2]
          Length = 263

 Score =  211 bits (538), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 175/264 (66%), Gaps = 7/264 (2%)

Query: 1   MSDI-RNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD  RNY       +G    + +D GLRAYM+++YN M +GL +TG  +  V + A T 
Sbjct: 1   MSDSDRNYASPFGHVAGRVDAAAVDAGLRAYMLKIYNYMTIGLAITGFAALGVYMGAVTT 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           D  AA   +    MLT FG  M+ SPL+W+FIFAPL +   ++  ++ L    A+M+F  
Sbjct: 61  DSAAAVGRVGN-TMLTSFGVAMFVSPLKWVFIFAPLVMVFAISFGINRLRPQTAQMLFWA 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           +SAL+G+SLSS FLVYT  SIV+ FFITAASFG+LSLYGYTTKRD+  +GSF+IMG FG+
Sbjct: 120 FSALMGVSLSSIFLVYTHTSIVRVFFITAASFGALSLYGYTTKRDMTGMGSFLIMGLFGV 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDV---AYAERQSVI 234
            + S+VN+F+ SS +   +S +G+++F+ LTA+DTQ++K  Y   Y       AER ++ 
Sbjct: 180 IIASIVNIFVASSMLQFVVSIVGVLVFAGLTAWDTQRLKNDYIYGYGAMGGDIAERAAIT 239

Query: 235 GALMLYMDFIQIFVHLLRFLGSRR 258
           GAL LY++FI +F  LL+ LG R 
Sbjct: 240 GALSLYLNFINLFTLLLQLLGQRE 263


>gi|115522334|ref|YP_779245.1| hypothetical protein RPE_0306 [Rhodopseudomonas palustris BisA53]
 gi|115516281|gb|ABJ04265.1| protein of unknown function UPF0005 [Rhodopseudomonas palustris
           BisA53]
          Length = 271

 Score =  211 bits (537), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 124/279 (44%), Positives = 182/279 (65%), Gaps = 29/279 (10%)

Query: 1   MSDI-RNYQRVVNSGSGFG--------STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVN 51
           MSD  RNY       S FG        + +D GLRAYM+R+YN M++GL +TG+ +  V 
Sbjct: 1   MSDFDRNY------ASPFGRAATRVDAAAVDAGLRAYMLRIYNYMSIGLAITGLAALGVY 54

Query: 52  ILATTVDPD-------AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLH 104
           + A T D          A++ ++RG  LT FG  M+ SPL+W+F+ APL +   ++  ++
Sbjct: 55  MFAVTTDASQAVQSATGAAVAMSRGQYLTPFGYAMFASPLKWVFMLAPLAMVFAISFGIN 114

Query: 105 SLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLG 164
            L    A+++F  ++AL+G+SLSS FLVYT  SIV+ FFITAASFG+LSLYGYTTKRD+ 
Sbjct: 115 RLKPATAQLLFWAFAALMGISLSSIFLVYTHTSIVRVFFITAASFGALSLYGYTTKRDMT 174

Query: 165 PIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY----- 219
            +GSF++MG  G+ + SLVNLF+ SS +   +S +G+++F+ LTA+DTQ++K  Y     
Sbjct: 175 AMGSFLMMGLIGIIIASLVNLFVASSMLQFIVSVVGVLVFAGLTAWDTQRLKNEYIYGYA 234

Query: 220 SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           S+  +V  AER ++ GAL LY++FI +F  LL+ LG + 
Sbjct: 235 SEGGEV--AERAAITGALSLYLNFINLFTLLLQLLGQKE 271


>gi|209883727|ref|YP_002287584.1| integral membrane protein [Oligotropha carboxidovorans OM5]
 gi|209871923|gb|ACI91719.1| integral membrane protein [Oligotropha carboxidovorans OM5]
          Length = 260

 Score =  211 bits (537), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 174/261 (66%), Gaps = 10/261 (3%)

Query: 5   RNYQRVVN--SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           RNY       +G    + +D GLRAYM+++YN M +GL +TG  +  V + A T D  +A
Sbjct: 3   RNYTSPFGHVAGRADAAAVDAGLRAYMLKIYNYMTIGLAITGFAALGVYMGAVTTDTASA 62

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
              +    MLT FG  M+ SPL+W+FIFAPL +   ++  ++ L    A+M+F  +SAL+
Sbjct: 63  VGRVGN-TMLTSFGVTMFVSPLKWVFIFAPLVMVFAISFGINRLRPATAQMLFWAFSALM 121

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G+SLSS FLVYT  SIV+ FFITAA+FG+LSLYGYTTKRD+  +GSF+IMG FG+ + S+
Sbjct: 122 GISLSSIFLVYTHTSIVRVFFITAAAFGALSLYGYTTKRDMTGMGSFLIMGLFGVIIASI 181

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY-----DVAYAERQSVIGAL 237
           VNLF+ SS +   +S +G+++F+ LTA+DTQ++K  Y   Y     DV  AER ++ GAL
Sbjct: 182 VNLFVASSMLQFVVSIVGVLVFAGLTAWDTQRLKNDYIYGYGAMGGDV--AERAAITGAL 239

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY++FI +F  LL+ LG R 
Sbjct: 240 SLYLNFINLFTLLLQLLGQRE 260


>gi|170747451|ref|YP_001753711.1| hypothetical protein Mrad2831_1019 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653973|gb|ACB23028.1| protein of unknown function UPF0005 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 256

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 164/241 (68%), Gaps = 12/241 (4%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGV--MLTGFGAL 78
           +DQGLR +M+ VYN M +GLG++G+++  +N+         AS+   +G   +LT FG  
Sbjct: 25  VDQGLRTFMLGVYNNMVVGLGISGLVALGLNM---------ASVAAYQGTRPILTPFGQT 75

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +Y SPL+W+ + APL      ++R+  +SA +A+ MF  ++A++G SLSS  LV+T  S+
Sbjct: 76  LYLSPLKWVLMLAPLAFIFVFSMRMDRMSASSARTMFWAFAAVMGASLSSLLLVFTGGSV 135

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           VQ FFITAA+FGSLSL+GYTT+R L  +GSF++MG  G+ L SLVN+F  SSA+   +S 
Sbjct: 136 VQVFFITAAAFGSLSLWGYTTRRSLSGMGSFLMMGLIGIILASLVNIFFASSALQFAISV 195

Query: 199 MGLVIFSALTAYDTQKIKEAY-SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           +G++IF+ LTAYDTQK+KE Y    +D   A + SV GAL LY+DFI +F  LL  +G R
Sbjct: 196 LGVLIFAGLTAYDTQKLKEMYLYGGFDGEMAAKMSVNGALTLYLDFINMFQFLLSLIGDR 255

Query: 258 R 258
           R
Sbjct: 256 R 256


>gi|46202998|ref|ZP_00052253.2| COG0670: Integral membrane protein, interacts with FtsH
           [Magnetospirillum magnetotacticum MS-1]
          Length = 255

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 113/239 (47%), Positives = 160/239 (66%), Gaps = 8/239 (3%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           +DQGLR++M+ VYN M +GLG++G+++  +N +A      A  +       LT FG  +Y
Sbjct: 24  VDQGLRSFMLGVYNNMVVGLGISGLVALGLN-MAAVAQTGAGRLA------LTPFGQFLY 76

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
           TSP +W+ + APL      + R+  +SA +A+ MF  ++A++G S+S+  LV+T  S+V+
Sbjct: 77  TSPFKWVLMLAPLAFIFVFSFRMDRMSAASARTMFWAFAAVMGASMSTLLLVFTGASVVR 136

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            FFITAA+FG LSLYGYTTKR L  +GSF+IMG  GL + SLVN+F+ SSA+   +S +G
Sbjct: 137 VFFITAATFGGLSLYGYTTKRSLSGMGSFLIMGLIGLIIASLVNIFLASSALQFAISVIG 196

Query: 201 LVIFSALTAYDTQKIKEAY-SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++IF+ LTAYDTQK+KE Y     D   A + SV GAL LY+DFI +F  LL  LG RR
Sbjct: 197 VLIFAGLTAYDTQKLKEMYLYSGLDAEGAAKMSVNGALTLYLDFINMFQFLLSLLGDRR 255


>gi|254455452|ref|ZP_05068881.1| integral membrane protein [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082454|gb|EDZ59880.1| integral membrane protein [Candidatus Pelagibacter sp. HTCC7211]
          Length = 253

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 110/238 (46%), Positives = 165/238 (69%), Gaps = 6/238 (2%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           +D+GLRAYM++VYN MA G+ +TGI++ L+    + V  DA SI     V LT  G  +Y
Sbjct: 22  MDEGLRAYMLKVYNYMATGILLTGIVA-LLTFKMSVVTNDAGSI-----VGLTSVGNAIY 75

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S L+W+ + APLG+  +++  ++ +SA  A+  F +++AL+GLSLSS  L+YT  S+ +
Sbjct: 76  MSGLKWLVMLAPLGIVFYMSFGINKMSASKAQTTFWVFAALMGLSLSSILLIYTGMSVTR 135

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            FFI +A+FG++S+YGYTTKRDL  +GSF++MG  G+ + S+VN+FM+SS +   +S +G
Sbjct: 136 VFFICSATFGAMSIYGYTTKRDLTKLGSFLMMGLIGIIIASIVNIFMKSSMMYFVISILG 195

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++IF  LTAYDTQKIK  Y+         +++V+GAL LY+DFI +F+ LLR  G RR
Sbjct: 196 VLIFVGLTAYDTQKIKNMYAVSDTGEIMGKKAVMGALTLYLDFINLFIMLLRLFGQRR 253


>gi|83313423|ref|YP_423687.1| integral membrane protein, interacts with FtsH [Magnetospirillum
           magneticum AMB-1]
 gi|82948264|dbj|BAE53128.1| Integral membrane protein, interacts with FtsH [Magnetospirillum
           magneticum AMB-1]
          Length = 246

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 163/252 (64%), Gaps = 19/252 (7%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
           +R +++     + ID GLR YM+ VYN MA  L +TGI+++++           AS+   
Sbjct: 13  RRYMSAAQAEAAQIDVGLRQYMLSVYNYMASALALTGIVAWVI-----------ASV--- 58

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
                    A+   SPL+W+F+ APLG+  F+  ++ S+ A  A  +F +Y+ L+G SL+
Sbjct: 59  -----PALTAIAVYSPLKWVFMLAPLGLVFFMGAKIDSMRASTASTLFWVYAGLMGASLA 113

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
           S FLV+T  S+ + FF+TAA+F  LSLYGYTTK+DL   GSF+IMG +GL +  +VN+F+
Sbjct: 114 SVFLVFTGASVARVFFVTAAAFAGLSLYGYTTKKDLSGFGSFLIMGVWGLMIAGIVNIFL 173

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIF 247
           +S  +   MSA G++IF+ LTAYDTQ IK+ Y +      A++++V GAL LYMDFI +F
Sbjct: 174 QSPMMHFVMSAAGVLIFAGLTAYDTQNIKQMYWEGDHSEVAQKKAVFGALQLYMDFINLF 233

Query: 248 VHLLRFLGSRRD 259
           + LL+F+G RRD
Sbjct: 234 MFLLQFMGVRRD 245


>gi|116255205|ref|YP_771038.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115259853|emb|CAK02947.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 236

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 108/237 (45%), Positives = 154/237 (64%), Gaps = 19/237 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D+GLR +M+RVYN MALGL +TG+++F+V        P                   ++ 
Sbjct: 19  DEGLRQHMLRVYNYMALGLVITGLVAFVVGSTPALYVP-------------------IFG 59

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           SPL+W+ + APL    F + ++ ++SA  A++ F  + A++GLSL+S FLV+T  SI +T
Sbjct: 60  SPLKWVVMLAPLAFVFFFSFKIQTMSASTAQITFWAFCAVMGLSLASVFLVFTGMSIART 119

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FFITA  FG+ SLYGY TKRDL  +GSF++MG FG+ + S+VN+FM SSA+   +S +G+
Sbjct: 120 FFITATMFGATSLYGYATKRDLSRMGSFLMMGLFGVIIASVVNIFMGSSALQFAISVIGI 179

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           V+F  LTAYDTQ IKE YS+ YD    ++ +V GAL LY++F+ IF  LL F G R 
Sbjct: 180 VVFVGLTAYDTQNIKEQYSENYDQESNQKLAVFGALSLYLNFVNIFQLLLNFTGERE 236


>gi|85713697|ref|ZP_01044687.1| hypothetical protein NB311A_04134 [Nitrobacter sp. Nb-311A]
 gi|85699601|gb|EAQ37468.1| hypothetical protein NB311A_04134 [Nitrobacter sp. Nb-311A]
          Length = 263

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 126/264 (47%), Positives = 177/264 (67%), Gaps = 7/264 (2%)

Query: 1   MSDI-RNYQRVVNSGSGFGST--IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           M D+ RNY       +G   T  +D GLR+YM+++YN M++GL +TG+ +  V + A T 
Sbjct: 1   MPDLDRNYASPFGRTAGRVDTAAVDAGLRSYMLKIYNYMSIGLAITGLAALGVYMAAVTG 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           DP  A+  I     LT FG  ++ SPL+W+FI APL +   ++  ++ L    A+M+F  
Sbjct: 61  DPSGAAAQIGN-AYLTPFGYALFVSPLKWVFILAPLAMVFVISFGINRLKPATAQMLFWA 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           +SAL+GLSLSS FLVYT  SIV+ FFITAASFG+LSL+GYTTKRD+  +GSF+IMG FG+
Sbjct: 120 FSALMGLSLSSIFLVYTHTSIVRVFFITAASFGALSLFGYTTKRDMSGMGSFLIMGLFGV 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDV---AYAERQSVI 234
            + SLVNLF+ SSA+   +S +G+++F+ LTAYDTQ++K  Y   Y       AER ++ 
Sbjct: 180 IIASLVNLFIASSALQFVVSVVGVLVFAGLTAYDTQRLKNDYIYGYASQGGEIAERAAIT 239

Query: 235 GALMLYMDFIQIFVHLLRFLGSRR 258
           GAL LY++FI +F  LL+ LG R 
Sbjct: 240 GALSLYLNFINLFTLLLQLLGQRE 263


>gi|218530497|ref|YP_002421313.1| hypothetical protein Mchl_2543 [Methylobacterium chloromethanicum
           CM4]
 gi|240138856|ref|YP_002963331.1| hypothetical protein MexAM1_META1p2268 [Methylobacterium extorquens
           AM1]
 gi|218522800|gb|ACK83385.1| protein of unknown function UPF0005 [Methylobacterium
           chloromethanicum CM4]
 gi|240008828|gb|ACS40054.1| conserved hypothetical protein; putative inner membrane protein
           [Methylobacterium extorquens AM1]
          Length = 255

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 160/239 (66%), Gaps = 8/239 (3%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           +DQGLR++M+ VYN M +GLG++G+++  +N +A      A  +       LT FG  +Y
Sbjct: 24  VDQGLRSFMLGVYNNMVVGLGISGLVALALN-MAAVAQTGAGRLA------LTPFGQFLY 76

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
           TSP +W+ + APL      + R+  +SA +A+MMF  ++A++G S+S+  LV+T  S+V+
Sbjct: 77  TSPFKWVLMLAPLAFIFVFSFRMDRMSASSARMMFWAFAAVMGASMSTLLLVFTGASVVR 136

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            FFITAA+F  LSLYGYTTKR L  +GSF++MG  G+ + SLVNLF+ SSA+   +S +G
Sbjct: 137 VFFITAATFAGLSLYGYTTKRSLSGMGSFLMMGLIGIIIASLVNLFLASSALQFAISVLG 196

Query: 201 LVIFSALTAYDTQKIKEAY-SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++IF+ LTA+DTQK+KE Y     D   A + SV GAL LY+DFI +F  LL  LG RR
Sbjct: 197 VLIFAGLTAFDTQKLKEMYLYSGLDAEGAAKMSVNGALTLYLDFINMFQFLLSLLGDRR 255


>gi|330813411|ref|YP_004357650.1| membrane protein [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486506|gb|AEA80911.1| membrane protein [Candidatus Pelagibacter sp. IMCC9063]
          Length = 251

 Score =  208 bits (530), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 109/242 (45%), Positives = 164/242 (67%), Gaps = 10/242 (4%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
            ++++GLR YM+ VYN M  G+ +TG+++ +   LA   D           V LTG G  
Sbjct: 18  ESVNEGLRTYMLSVYNFMGSGVLLTGVIAMIFFKLAVVTDGSGNI------VGLTGLGNA 71

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           MY S L W+   APLG+ ++++  + ++SA  A+ +F +++AL+G SLSS F+ YT  SI
Sbjct: 72  MYNSALMWVVALAPLGIVMYMSFGIKNMSASRAQTVFWIFAALMGASLSSIFVQYTGTSI 131

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            + FFITA +FG++SLYGYTTK+DL  +GSF++MG FG+ + S+VN+F++SSA+   +S 
Sbjct: 132 ARVFFITAGTFGAMSLYGYTTKKDLTGLGSFLMMGLFGIIIASIVNIFLKSSAMHFVISI 191

Query: 199 MGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           +G++IF  LTAYDTQKIK  Y  SD  +V    +++++GAL LY+DFI +F+ LLR  G 
Sbjct: 192 LGVLIFVGLTAYDTQKIKNMYLASDGNEV--MSKKAIMGALTLYLDFINLFIMLLRLFGQ 249

Query: 257 RR 258
           RR
Sbjct: 250 RR 251


>gi|56697801|ref|YP_168171.1| hypothetical protein SPO2963 [Ruegeria pomeroyi DSS-3]
 gi|56679538|gb|AAV96204.1| membrane protein, putative [Ruegeria pomeroyi DSS-3]
          Length = 269

 Score =  208 bits (530), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 109/260 (41%), Positives = 172/260 (66%), Gaps = 3/260 (1%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA 61
           + +  +  + ++     + ID+GLRA+M +VY  M++G+ +T   ++ ++ LA T DP A
Sbjct: 10  TQMAQFDTIRSAAGSRAAQIDEGLRAHMNKVYGTMSVGMLITFAAAWAISGLAVTTDPGA 69

Query: 62  ASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
           A   ++    LT  G  +Y SPL+W+ IFAPL      +  ++ LSA AA+++F  ++ +
Sbjct: 70  AVAQLSADKYLTQIGYSLYASPLKWVIIFAPLAFVFGFSAAINRLSAAAAQLIFYTFAFV 129

Query: 122 IGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS 181
           +GLS+SS FLV+T +SI+Q F ITA +F  LSLYGYTTK+DL  +G+F+IMG  GL +  
Sbjct: 130 MGLSISSIFLVFTGQSIIQVFLITAIAFAGLSLYGYTTKKDLSAMGTFLIMGLIGLIVAM 189

Query: 182 LVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALM 238
           +VN+F+ SSA+   +SA+G++IF+ LTAYDTQ IK  Y   +   D  +  + +++GAL 
Sbjct: 190 VVNIFLASSAMAFAISAIGVLIFAGLTAYDTQNIKNTYLQMAHSGDQEWLGKAAIMGALS 249

Query: 239 LYMDFIQIFVHLLRFLGSRR 258
           LY+DFI +F+ LL+ LG+R 
Sbjct: 250 LYLDFINLFMFLLQLLGNRE 269


>gi|222107123|ref|YP_002547914.1| hypothetical protein Avi_6220 [Agrobacterium vitis S4]
 gi|221738302|gb|ACM39198.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 238

 Score =  207 bits (528), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 106/241 (43%), Positives = 154/241 (63%), Gaps = 19/241 (7%)

Query: 18  GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
           G+  DQGLR +M+RVYN M LGL +TG+++F+V        P                  
Sbjct: 17  GALFDQGLRQHMLRVYNYMGLGLVITGLVAFIVGSTPALYVP------------------ 58

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
            ++ SPL+W+ + APL    F + R+ ++SA AA+M F  + A++GLS++S FLV+T  S
Sbjct: 59  -IFQSPLKWVVMLAPLAFVFFFSFRIQTMSASAAQMAFWAFCAVMGLSMASVFLVFTGTS 117

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           I +TFFI A  FGS+SLYGYTTKRDL   GSF++MG  G+ + S+VN+F+ SSA+   +S
Sbjct: 118 IARTFFIAATMFGSMSLYGYTTKRDLSKFGSFLMMGLIGVVIASIVNIFLGSSALQFAIS 177

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            +G+++F  LTA+DTQ IKE Y++  D    ++ +V GAL LY++F+ IF  LL F G R
Sbjct: 178 VIGILVFVGLTAWDTQNIKEQYAENIDQESRQKLAVFGALSLYLNFVNIFQLLLNFTGER 237

Query: 258 R 258
            
Sbjct: 238 E 238


>gi|91975009|ref|YP_567668.1| hypothetical protein RPD_0529 [Rhodopseudomonas palustris BisB5]
 gi|91681465|gb|ABE37767.1| protein of unknown function UPF0005 [Rhodopseudomonas palustris
           BisB5]
          Length = 263

 Score =  207 bits (528), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 125/267 (46%), Positives = 179/267 (67%), Gaps = 13/267 (4%)

Query: 1   MSDI-RNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY       +G    + +D GLRAYM+R+YN M +GL +TG+ +  V + A T 
Sbjct: 1   MSDLDRNYASPFGRAAGRVDSAAVDAGLRAYMLRIYNYMTIGLAITGLAALGVYMGAVTP 60

Query: 58  -DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFL 116
            D  AA  I N    LT FG  M+ SPL+W+FI APL +   ++  ++ L    A+++F 
Sbjct: 61  NDVGAAGRIGN--TYLTTFGVAMFASPLKWVFILAPLAMVFAISFGINRLKPATAQLLFW 118

Query: 117 LYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFG 176
            ++AL+G+SLSS FLVYT  SIV+ FFITAASFG+LSLYGYTTKRD+  +GSF+IMG FG
Sbjct: 119 AFAALMGISLSSIFLVYTHTSIVRVFFITAASFGALSLYGYTTKRDMTGMGSFLIMGLFG 178

Query: 177 LFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY-----SDRYDVAYAERQ 231
           + + S+VNLF+ SS +   +S +G+++F+ LTA+DTQ++K  Y     S+  +V  AER 
Sbjct: 179 VVIASVVNLFVASSMLQFIVSVVGVLVFAGLTAWDTQRLKNDYIYGYASEGGEV--AERA 236

Query: 232 SVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++ GAL LY++FI +F  LL+ LG + 
Sbjct: 237 AITGALSLYLNFINLFTLLLQLLGQKE 263


>gi|27382433|ref|NP_773962.1| hypothetical protein bll7322 [Bradyrhizobium japonicum USDA 110]
 gi|27355604|dbj|BAC52587.1| bll7322 [Bradyrhizobium japonicum USDA 110]
          Length = 232

 Score =  207 bits (528), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 111/253 (43%), Positives = 162/253 (64%), Gaps = 23/253 (9%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           NY +  N  +     +D GLR YM+R+YN MA G+G+T ++++L   L            
Sbjct: 3   NYDQ--NLATSDAIAVDAGLRGYMLRIYNYMAAGVGLTAVVAWLTYQLT----------- 49

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                     G  +  SPL W+FI APL +  F++ R+++LSA  A+++F +Y+AL+G+S
Sbjct: 50  ----------GPALLQSPLMWVFILAPLALVFFISARINTLSAATARLLFFIYAALVGVS 99

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LS    +YTS SI + FFI AA FG+LS++GYTT+RDL  +G+F+ MG  G+ + SLVNL
Sbjct: 100 LSILLHIYTSASITRVFFIAAAMFGALSVFGYTTRRDLSGLGTFLFMGLIGVIIASLVNL 159

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F++SS +D  +S +G+ +F+ LTAYDTQ+IK  Y    D   A R+SVI AL LY++FI 
Sbjct: 160 FLQSSGLDWLISVVGVGVFAGLTAYDTQRIKAMYDSGDDETSAGRKSVISALSLYLNFIN 219

Query: 246 IFVHLLRFLGSRR 258
           +F+ LLR  GSRR
Sbjct: 220 LFMMLLRLAGSRR 232


>gi|92116172|ref|YP_575901.1| hypothetical protein Nham_0551 [Nitrobacter hamburgensis X14]
 gi|91799066|gb|ABE61441.1| protein of unknown function UPF0005 [Nitrobacter hamburgensis X14]
          Length = 271

 Score =  207 bits (528), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 126/271 (46%), Positives = 179/271 (66%), Gaps = 13/271 (4%)

Query: 1   MSDI-RNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY       +G    + +D GLR+YM+++YN M++GL +TG+ +  V + A T 
Sbjct: 1   MSDLDRNYTSPFGRAAGRVDRAAVDAGLRSYMLKIYNYMSIGLAITGLAALGVYMFAVTG 60

Query: 58  DPD-------AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYA 110
           D          AS+ +  G  LT FG  MY SPL+W+FIFAPL +   ++  ++ L    
Sbjct: 61  DATLAAKSATGASLALKGGQYLTPFGLAMYASPLKWVFIFAPLAMVFAISFGINRLKPAT 120

Query: 111 AKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFM 170
           A+M+F  +SAL+G+SLSS FLVYT  SIV+ FFITAASFG+LSLYGYTTKRD+  +GSF+
Sbjct: 121 AQMLFWAFSALMGVSLSSIFLVYTHTSIVRVFFITAASFGALSLYGYTTKRDMTGMGSFL 180

Query: 171 IMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDV---AY 227
           IMG FG+ + S+VN+F+ SS +   +S +G+++F+ LTAYDTQ++K  Y   Y       
Sbjct: 181 IMGLFGVIIASVVNIFVASSMLQFVVSVVGVLVFAGLTAYDTQRLKNDYIYGYASQGGEI 240

Query: 228 AERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AER ++ GAL LY++FI +F  LL+ LG R 
Sbjct: 241 AERAAITGALSLYLNFINLFTLLLQLLGQRE 271


>gi|209546393|ref|YP_002278283.1| hypothetical protein Rleg2_6013 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209539250|gb|ACI59183.1| protein of unknown function UPF0005 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 236

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 156/244 (63%), Gaps = 19/244 (7%)

Query: 15  SGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           +G  +  D+GLR +M+RVYN MALGL +TG+++F+V        P               
Sbjct: 12  AGTQAAFDEGLRQHMLRVYNYMALGLVITGLVAFVVGSTPALYVP--------------- 56

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
               ++ SPL+W+ + APL    F + R+ ++SA  A++ F  + A++GLSL+S FLV+T
Sbjct: 57  ----IFGSPLKWVVMLAPLAFVFFFSFRIQTMSASTAQITFWAFCAVMGLSLASVFLVFT 112

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI +TFFITA  FG+ SLYGY TKRDL  +GSF++MG  G+ + S+VN+F+ SSA+  
Sbjct: 113 GMSIARTFFITATMFGATSLYGYVTKRDLSRMGSFLMMGLIGVIIASIVNIFLGSSALQF 172

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
            +S +G+V+F  LTAYDTQ IKE YS+ +D    ++ +V GAL LY++F+ IF  LL F 
Sbjct: 173 AISVIGIVVFVGLTAYDTQNIKEQYSENFDQESNQKLAVFGALSLYLNFVNIFQLLLNFT 232

Query: 255 GSRR 258
           G R 
Sbjct: 233 GERE 236


>gi|241667047|ref|YP_002985131.1| protein of unknown function UPF0005 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240862504|gb|ACS60169.1| protein of unknown function UPF0005 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 236

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 106/237 (44%), Positives = 154/237 (64%), Gaps = 19/237 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D+GLR +M+RVYN MALGL +TG+++F+V        P                   ++ 
Sbjct: 19  DEGLRQHMLRVYNYMALGLVITGLVAFVVGSTPALYVP-------------------IFG 59

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           SPL+W+ + APL    F + ++ ++SA  A++ F  + A++GLSL+S FLV+T  SI +T
Sbjct: 60  SPLKWVVMLAPLAFVFFFSFKIQTMSAGTAQITFWAFCAVMGLSLASVFLVFTGASIART 119

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FFITA  FG+ SLYGY TKRDL  +GSF++MG FG+ + S+VN+F+ SSA+   +S +G+
Sbjct: 120 FFITATMFGATSLYGYATKRDLSRMGSFLMMGLFGVIIASVVNIFLGSSALQFAISVIGI 179

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           V+F  LTAYDTQ IKE YS+ +D    ++ +V GAL LY++F+ IF  LL F G R 
Sbjct: 180 VVFVGLTAYDTQNIKEQYSENFDQESNQKLAVFGALSLYLNFVNIFQLLLNFTGERE 236


>gi|170742670|ref|YP_001771325.1| hypothetical protein M446_4550 [Methylobacterium sp. 4-46]
 gi|168196944|gb|ACA18891.1| protein of unknown function UPF0005 [Methylobacterium sp. 4-46]
          Length = 236

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 156/237 (65%), Gaps = 19/237 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D+GLR +M+RVYN M LGL +TG+++F V+   +   P                   ++ 
Sbjct: 19  DEGLRQHMLRVYNRMGLGLALTGLVAFAVSATPSIAQP-------------------LFG 59

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           +PL+++ + APL   +FL+ R+  +SA  A+ +F  + A++GLSL+S FLV+T  SI +T
Sbjct: 60  TPLKYVVMLAPLAFILFLSFRIEQISAATAQTLFWSFCAVMGLSLASVFLVFTGTSIART 119

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FFITAA FG+ SLYGYTTKRDL  +GSF++MG  G+ + SLVN+F+ SSA+   +S +G+
Sbjct: 120 FFITAAMFGATSLYGYTTKRDLSRMGSFLMMGLIGVVIASLVNIFLASSALHFAISLIGV 179

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           VIF  LTAYDTQ IKE Y++ +D   + + +V GAL LY++FI +F  LL F G R 
Sbjct: 180 VIFVGLTAYDTQSIKEQYAEHWDQETSGKLAVFGALSLYLNFINLFQLLLNFTGERE 236


>gi|294084981|ref|YP_003551741.1| integral membrane protein, interacts with FtsH [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664556|gb|ADE39657.1| Integral membrane protein, interacts with FtsH [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 239

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 107/251 (42%), Positives = 159/251 (63%), Gaps = 15/251 (5%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
            R +N+ +   + ID GLR+YM+ VYN M   L +TG  +F +     TV          
Sbjct: 4   NRFMNTAAAQSAQIDTGLRSYMLGVYNHMTTALLLTGFFAFAMKWAVMTVPA-------- 55

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
                   G L+Y +PL+W+ + APLG+  +L+ R++++SA  A+ MF +Y AL+GLSL+
Sbjct: 56  -------VGQLVYGTPLKWVVMLAPLGMVFWLSARMNAMSATKARNMFYIYGALMGLSLA 108

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
           S   VYT  S+ + FFITA +F  LSLYGY+TKR L  +GSFM++G FGL + S+VN+FM
Sbjct: 109 SILFVYTGASVARAFFITAGAFAGLSLYGYSTKRSLSAMGSFMVIGLFGLIIASVVNIFM 168

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIF 247
            SS ++  +S  G++IF+ LTA+DTQ+IK  Y        + ++S+ GALMLY+DFI +F
Sbjct: 169 ASSQLEFVISVAGVLIFAGLTAWDTQRIKAMYMAGDSSEESNKKSIFGALMLYLDFINMF 228

Query: 248 VHLLRFLGSRR 258
           + +LR  G+R 
Sbjct: 229 LFILRLFGNRE 239


>gi|298293923|ref|YP_003695862.1| hypothetical protein Snov_3973 [Starkeya novella DSM 506]
 gi|296930434|gb|ADH91243.1| protein of unknown function UPF0005 [Starkeya novella DSM 506]
          Length = 239

 Score =  205 bits (522), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 104/237 (43%), Positives = 152/237 (64%), Gaps = 19/237 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D+GLR +M+RVYN MALGL +TG+++F+V        P                   +++
Sbjct: 22  DEGLRRHMLRVYNYMALGLVLTGVVAFIVGTTPALYVP-------------------IFS 62

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           +PL+W+ +FAPL   +F + R+ S+S   A+ MF  + A++GLS++S FLV+T  SI +T
Sbjct: 63  TPLKWVVMFAPLAFVLFFSFRMQSMSGAGAQTMFWAFCAVMGLSMASIFLVFTGTSIART 122

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FFI A  FG+ SLYGYTTKRDL   GSF+IMG  G+ + SLVN+F+ S+ +   +S +G+
Sbjct: 123 FFIAATMFGATSLYGYTTKRDLSQFGSFLIMGLIGVVIASLVNIFLGSTMLQFIVSVVGI 182

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++F  LTA+DTQ IKE Y+D +D    ++ +V GA  LY++FI IF  LL F G R 
Sbjct: 183 LVFVGLTAWDTQSIKEQYADYFDAESQQKLAVFGAFSLYLNFINIFQLLLNFTGERE 239


>gi|262277853|ref|ZP_06055646.1| integral membrane protein [alpha proteobacterium HIMB114]
 gi|262224956|gb|EEY75415.1| integral membrane protein [alpha proteobacterium HIMB114]
          Length = 252

 Score =  205 bits (522), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 108/250 (43%), Positives = 166/250 (66%), Gaps = 6/250 (2%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
           RV +S +    ++ +GLR+YM++VYN MA G+ +TG ++  + +   +V  D A  I+  
Sbjct: 9   RVQSSATVANDSVHEGLRSYMLKVYNFMASGVLLTGFVA--LGLFKFSVVTDQAGNIVG- 65

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
              LT  G  +Y+S L W+    PLG+  +++  ++ +SA  A+ +F +++AL+G SLSS
Sbjct: 66  ---LTSLGNAIYSSALMWVIALTPLGIVFYMSFGINKMSAQRAQTVFWIFAALMGASLSS 122

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            FL YT  SI + FFITA +FG++SLYGYTTK+DL   GSF++MG  G+ + SLVN+F++
Sbjct: 123 IFLQYTGASISRVFFITAGTFGAMSLYGYTTKKDLTGWGSFLLMGLIGILIASLVNIFLK 182

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFV 248
           S A+   +S +G++IF  LTAYDTQKIK  Y +      + +++V+GAL LY+DFI +F+
Sbjct: 183 SPAVYFVVSVLGVLIFVGLTAYDTQKIKNMYFESDSTEVSSKKAVMGALTLYLDFINLFI 242

Query: 249 HLLRFLGSRR 258
            LLR  G RR
Sbjct: 243 MLLRLFGQRR 252


>gi|260459479|ref|ZP_05807734.1| protein of unknown function UPF0005 [Mesorhizobium opportunistum
           WSM2075]
 gi|259035033|gb|EEW36289.1| protein of unknown function UPF0005 [Mesorhizobium opportunistum
           WSM2075]
          Length = 238

 Score =  204 bits (520), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 158/248 (63%), Gaps = 19/248 (7%)

Query: 11  VNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGV 70
           V +G+  G+  D+GLR +M+RVYN M LGL VTG+++F+V+       P           
Sbjct: 10  VGTGAQTGAAFDEGLRQHMLRVYNYMGLGLVVTGLVAFMVSSTPALYVP----------- 58

Query: 71  MLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFF 130
                   +++SPL+W+ + APL   +  + ++ ++SA +A+MMF  + A++GLSL+S F
Sbjct: 59  --------IFSSPLKWVVMLAPLAFVMLFSFKMQTMSAASAQMMFWAFCAVMGLSLASVF 110

Query: 131 LVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSS 190
           LV+T  SI +TFFI A  FG+ SLYGYTT+RDL    SF+IMG  G+ + S+VN+F+ S+
Sbjct: 111 LVFTGTSIARTFFIAATMFGATSLYGYTTRRDLTQFSSFLIMGLIGVVIASIVNIFLGST 170

Query: 191 AIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHL 250
           A+   +S +G+ +F  LTA+DTQ IKE YS+ +D    ++ +V GA  LY++FI IF  L
Sbjct: 171 ALQFAISVIGIAVFIGLTAWDTQTIKEQYSENFDGESRQKLAVFGAFSLYLNFINIFQLL 230

Query: 251 LRFLGSRR 258
           L F G R 
Sbjct: 231 LNFTGERE 238


>gi|254485564|ref|ZP_05098769.1| integral membrane protein [Roseobacter sp. GAI101]
 gi|214042433|gb|EEB83071.1| integral membrane protein [Roseobacter sp. GAI101]
          Length = 258

 Score =  204 bits (519), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 107/261 (40%), Positives = 171/261 (65%), Gaps = 6/261 (2%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D++  +    + +   + ID+GLRA+M +VY  M++G+ +T   ++ ++ LA T DP 
Sbjct: 1   MADVKTIRSRAGTRA---AAIDEGLRAHMNKVYGTMSIGMLITFAAAWAISGLAVTNDPA 57

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
           AA   I     LT  G+ +Y SPL+W+ +FAPL     L   ++ +SA  A+ +F  ++A
Sbjct: 58  AAVAQIGADTYLTSLGSALYLSPLKWVVMFAPLAFVFGLGAAMNKISAATAQTLFYAFAA 117

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           ++G+S+SS FLV+T  SI+Q F IT+ SF  LSL+GYTTK+D+   GSF+IMG  GL + 
Sbjct: 118 VMGVSISSIFLVFTGYSIIQIFLITSISFAGLSLWGYTTKKDISGWGSFLIMGLIGLIVA 177

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGAL 237
           S+VN+F+ S A+   +SA+G++IF+ LTAYDTQ IK    A++   D  + ++  ++GAL
Sbjct: 178 SVVNIFLASPALVFAISAIGVLIFAGLTAYDTQNIKNTYLAHAQHGDQEWLQKSGIMGAL 237

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY++FI +F+ LL+  G+R 
Sbjct: 238 SLYLNFINMFMMLLQLFGNRE 258


>gi|83944524|ref|ZP_00956976.1| membrane protein, putative [Sulfitobacter sp. EE-36]
 gi|83955344|ref|ZP_00963999.1| membrane protein, putative [Sulfitobacter sp. NAS-14.1]
 gi|83840337|gb|EAP79511.1| membrane protein, putative [Sulfitobacter sp. NAS-14.1]
 gi|83844630|gb|EAP82515.1| membrane protein, putative [Sulfitobacter sp. EE-36]
          Length = 258

 Score =  204 bits (518), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 103/241 (42%), Positives = 162/241 (67%), Gaps = 3/241 (1%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           ID+GLR +M +VY  M++G+ +T   ++ ++ LA T DP  A   I     LT FG+ +Y
Sbjct: 18  IDEGLRTHMNKVYGTMSIGMLITFAAAWAISGLAVTTDPSGAVAQIGTDKYLTSFGSALY 77

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            SPL+W+ +FAPL     L   ++ +SA  A+ +F +++A++G+S+SS FLV+T  SI+Q
Sbjct: 78  MSPLKWVVMFAPLAFVFGLGAAMNKISAATAQTLFYVFAAVMGVSISSIFLVFTGYSIIQ 137

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            F IT+ +F  LSL+GYTTK+D+   GSF+IMG  GL + S+VN+F+ S A+   +SA+G
Sbjct: 138 IFLITSIAFAGLSLWGYTTKKDISGWGSFLIMGVIGLVVASIVNIFLASPALVFAISAIG 197

Query: 201 LVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           ++IF+ LTAYDTQ IK    A++   D  + ++  ++GAL LY++FI +F+ LL+  G+R
Sbjct: 198 VLIFAGLTAYDTQNIKNTYLAHAHHGDQEWLQKSGIMGALSLYLNFINMFMMLLQLFGNR 257

Query: 258 R 258
            
Sbjct: 258 E 258


>gi|85706841|ref|ZP_01037932.1| membrane protein, putative [Roseovarius sp. 217]
 gi|85668634|gb|EAQ23504.1| membrane protein, putative [Roseovarius sp. 217]
          Length = 259

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 166/245 (67%), Gaps = 6/245 (2%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + ID GLRA+M +VY  M++G+ +T + ++ +  LA T DP AA+  +  G ML+G GA 
Sbjct: 16  AQIDAGLRAHMNKVYGTMSVGMLITALAAWAIAGLAVTTDPSAAAAQLPNGTMLSGLGAA 75

Query: 79  MYTSPLRWIFIFAPLGVFIFLN--VRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK 136
           +Y SPL+W+ + APL  FIFL     L   SA A ++ F  ++ALIG+S+SS FLV+TS 
Sbjct: 76  LYLSPLKWVVMLAPL-AFIFLGWGALLRRGSAAAVQLGFFAFAALIGISMSSIFLVFTSF 134

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTM 196
           SI QTF +TA +F  LSLYGYTTK+D+   GSF+IMG  GL ++ ++N+F++S A+   +
Sbjct: 135 SIAQTFIVTAIAFAGLSLYGYTTKKDISGWGSFLIMGVIGLIVVMVINIFLQSPAVMFAI 194

Query: 197 SAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
           SA+GL+IF+ LTA+ TQ+IK    A++ + D  + ++ +  GAL LY+ F+ +F  LL F
Sbjct: 195 SAIGLLIFAGLTAFYTQEIKSTYVAHAAQGDQEWLDKAAYDGALNLYISFLNMFQFLLMF 254

Query: 254 LGSRR 258
           +G + 
Sbjct: 255 MGQQE 259


>gi|91762582|ref|ZP_01264547.1| integral membrane protein [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718384|gb|EAS85034.1| integral membrane protein [Candidatus Pelagibacter ubique HTCC1002]
          Length = 256

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 112/256 (43%), Positives = 171/256 (66%), Gaps = 6/256 (2%)

Query: 6   NYQRVVNS-GSGFGSTI--DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           N Q ++N       ST+  D+GLRA+M++VYN MA  + +TG+ S L   L+       +
Sbjct: 4   NKQNILNKVKEAQQSTVVMDEGLRAHMLKVYNYMASAILLTGVFSILFYNLSGGSSIQIS 63

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
           S  I+    L+  G  +Y SPL+W+ + APLG+  +++ R++ +SA +A+ +F +++AL+
Sbjct: 64  SAGISG---LSPVGYAIYGSPLKWLVMLAPLGIVFYMSARMNRMSASSAQTVFWVFAALM 120

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G+SLSS FL YT  SI + FFIT+ +FG++S+YGYTTKRDL  +GSF++MG FG+ + S+
Sbjct: 121 GISLSSIFLRYTGFSIARVFFITSGTFGAMSIYGYTTKRDLTKLGSFLMMGLFGIIIASV 180

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           VN+FM S  ++  +S +G++IF  LTAYDTQKIK  Y          +++V+GAL LY+D
Sbjct: 181 VNMFMGSERMEFIISILGVLIFVGLTAYDTQKIKNMYVSSDTGELMGKKAVMGALTLYLD 240

Query: 243 FIQIFVHLLRFLGSRR 258
           FI +F+ LLR  G RR
Sbjct: 241 FINLFIMLLRLFGQRR 256


>gi|149203700|ref|ZP_01880669.1| hypothetical protein RTM1035_06528 [Roseovarius sp. TM1035]
 gi|149142817|gb|EDM30859.1| hypothetical protein RTM1035_06528 [Roseovarius sp. TM1035]
          Length = 259

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 165/245 (67%), Gaps = 6/245 (2%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + ID GLRA+M +VY  M++G+ +T + ++ +  LA T DP AA+  +  G MLTG GA 
Sbjct: 16  AQIDAGLRAHMNKVYGTMSVGMLITALAAWAIAGLAVTTDPSAAAAQLPNGKMLTGLGAA 75

Query: 79  MYTSPLRWIFIFAPLGVFIFLN--VRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK 136
           +Y SPL+W+ + APL  FIFL     +   SA A ++ F  ++ALIG+S+SS FL++TS 
Sbjct: 76  LYLSPLKWVVMLAPL-AFIFLGWGALVRRASAAAVQLGFFAFAALIGISMSSIFLMFTSF 134

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTM 196
           SIVQTF +TA +F  LSL+GYTTK+D+   GSF+IMG  GL +  ++N+F++S A+   +
Sbjct: 135 SIVQTFIVTAIAFAGLSLFGYTTKKDISGWGSFLIMGVIGLVVAMVINIFLQSPAMMFAI 194

Query: 197 SAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
           SA+GL+IF+ LTA+ TQ+IK    A++   D  + ++ +  GAL LY+ F+ +F  LL F
Sbjct: 195 SAIGLLIFAGLTAFHTQEIKNTYVAHAAHGDQEWLDKSAYDGALSLYISFLNMFQFLLMF 254

Query: 254 LGSRR 258
           +G + 
Sbjct: 255 MGQQE 259


>gi|254474621|ref|ZP_05088007.1| integral membrane protein [Ruegeria sp. R11]
 gi|214028864|gb|EEB69699.1| integral membrane protein [Ruegeria sp. R11]
          Length = 258

 Score =  201 bits (512), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 161/243 (66%), Gaps = 3/243 (1%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + ID GLRA+M +VY  MA G  +T + ++ +  LA T DP AA+  +N    LT  G  
Sbjct: 16  AEIDAGLRAHMNKVYATMAAGTFITFLAAWAIAGLAVTSDPSAAAAQLNADTYLTSLGYA 75

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +Y SPL+W+ +FAPL     +    + +SA   +++F +++ ++G+S+SS FLV+T +SI
Sbjct: 76  LYASPLKWVIMFAPLAFVFGIGAAANRMSAAGVQLLFYVFATVMGISISSIFLVFTGESI 135

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           VQ F IT+ +F  LSL GYTTK+DL  +G+F+IMG  GL + S+VN+F+ SSA+   +S 
Sbjct: 136 VQVFLITSIAFTGLSLVGYTTKKDLSGMGAFLIMGLIGLIVASVVNIFLASSALAFAVSV 195

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           +G++IF+ LTAYDTQ+IK  Y       D  +  + +++GAL LY+DFI +F+ LL+ LG
Sbjct: 196 IGVLIFAGLTAYDTQRIKNDYLQMVHMGDQEWLAKSAIMGALSLYLDFINMFMMLLQLLG 255

Query: 256 SRR 258
           +R 
Sbjct: 256 NRE 258


>gi|312115039|ref|YP_004012635.1| hypothetical protein Rvan_2312 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220168|gb|ADP71536.1| protein of unknown function UPF0005 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 257

 Score =  201 bits (511), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 110/241 (45%), Positives = 161/241 (66%), Gaps = 8/241 (3%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           ID+GLRA+MIRVY+ M +GL VTGIM++ +   A  +  DA  I     V LT  G +++
Sbjct: 23  IDEGLRAHMIRVYSYMGIGLLVTGIMAYTIYSQAV-ITNDAGKI-----VGLTSLGTVIF 76

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S ++W+ +FAPL V    +  ++ +S   A+ +F L++AL+GLSLSS F+ YT  SI +
Sbjct: 77  KSWVKWLVMFAPLIVVFAFSATINRMSTATAQGVFWLFAALMGLSLSSIFIAYTGTSIAR 136

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            FFITAA+FG++S+YGYTTK DL   GSF+IMG  GL + S+VN F+ S+ +   +S + 
Sbjct: 137 IFFITAATFGAVSIYGYTTKADLTKFGSFLIMGVIGLVIASIVNAFLGSTGLQFAISVLA 196

Query: 201 LVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++IF+ LTAYDTQ+IK+ Y    +Y        +++GAL LY+DFI IFV L++  G RR
Sbjct: 197 VLIFTGLTAYDTQQIKDNYLAQAQYGGQSLGHAAILGALSLYLDFINIFVALMQLFGERR 256

Query: 259 D 259
           +
Sbjct: 257 E 257


>gi|319783419|ref|YP_004142895.1| hypothetical protein Mesci_3726 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169307|gb|ADV12845.1| protein of unknown function UPF0005 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 238

 Score =  201 bits (511), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 102/248 (41%), Positives = 156/248 (62%), Gaps = 19/248 (7%)

Query: 11  VNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGV 70
           V +G+  G+  D+GLR +M+RVYN M +GL VTG+++F+++       P           
Sbjct: 10  VAAGAQTGAVFDEGLRQHMLRVYNYMGVGLVVTGLVAFMISSTPALYVP----------- 58

Query: 71  MLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFF 130
                   +++SPL+W+ + APL   +  + ++ ++SA  A+ MF  + A++GLSL+S F
Sbjct: 59  --------IFSSPLKWVVMLAPLAFVMLFSFKMQTMSAANAQAMFWAFCAVMGLSLASVF 110

Query: 131 LVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSS 190
           LV+T  SI +TFFI A  FG+ SLYGYTTKRDL    SF+IMG  G+ + S+VN+F+ S+
Sbjct: 111 LVFTGTSIARTFFIAATMFGATSLYGYTTKRDLTQFSSFLIMGLIGVVIASIVNIFLGST 170

Query: 191 AIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHL 250
           A+   +S +G+ +F  LTA+DTQ IKE Y++ +D    ++ +V GA  LY++FI IF  L
Sbjct: 171 ALQFAISVIGIAVFIGLTAWDTQTIKEQYAENFDAESRQKLAVFGAFSLYLNFINIFQLL 230

Query: 251 LRFLGSRR 258
           L F G R 
Sbjct: 231 LNFTGERE 238


>gi|119384131|ref|YP_915187.1| hypothetical protein Pden_1390 [Paracoccus denitrificans PD1222]
 gi|119373898|gb|ABL69491.1| protein of unknown function UPF0005 [Paracoccus denitrificans
           PD1222]
          Length = 256

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 113/261 (43%), Positives = 171/261 (65%), Gaps = 11/261 (4%)

Query: 4   IRNYQRVVNSGSGFGST-IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           +++Y  +  +G+   S  +D+GLRAYM +VY LMA+G+ VT   ++ +  LA +  P   
Sbjct: 1   MQDYNSIRTAGTATRSAAVDEGLRAYMNKVYGLMAVGMLVTAGAAWGMAGLALSDTPTQW 60

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
           ++    G  LT FG  +Y SPL+W+ +FAPL +       L+ LS   A  +F  ++A++
Sbjct: 61  AL--GNGHYLTEFGKTLYLSPLKWVVMFAPLVMVFAFGAALNRLSVQGATTLFYAFAAVM 118

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G+S+S  F  YTS SI+QTF ITA +F  LSLYGYTTKRDL  +G+F++MG  GL +  +
Sbjct: 119 GISISWIFAAYTSFSIIQTFLITAIAFSGLSLYGYTTKRDLSGMGTFLMMGLIGLIVAMI 178

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY-----SDRYDVAYAERQSVIGAL 237
           VN+F++SSA+   +SA+G++IF+ LTAYDTQ IK  Y     SDR    +  + +++GAL
Sbjct: 179 VNIFLQSSAMQFAISAIGVLIFAGLTAYDTQNIKNTYLQLANSDR---DFLGKAAIMGAL 235

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY+DF+ +F+ LL+FLG+R 
Sbjct: 236 QLYLDFLNLFMFLLQFLGNRE 256


>gi|163740849|ref|ZP_02148242.1| hypothetical protein RG210_13451 [Phaeobacter gallaeciensis 2.10]
 gi|161385840|gb|EDQ10216.1| hypothetical protein RG210_13451 [Phaeobacter gallaeciensis 2.10]
          Length = 258

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 104/243 (42%), Positives = 163/243 (67%), Gaps = 3/243 (1%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + ID GLRA+M +VY  MA+G  +T + ++ ++ LA T DP  A+  ++    LT  G  
Sbjct: 16  AEIDAGLRAHMNKVYGTMAVGTFITFLAAWAISGLAVTTDPANAAAQLSADRYLTSIGYA 75

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +Y SPL+W+ +FAPL     ++   + +SA   +++F +++ ++GLS+SS FLV+T +SI
Sbjct: 76  LYASPLKWVIMFAPLAFVFGISAAANRMSAAGVQLLFYVFATVMGLSISSIFLVFTGESI 135

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           VQ F IT+ +F  LSL GYTTK+DL  +G+F+IMG  GL + S+VN+F+ SSA+   +S 
Sbjct: 136 VQVFLITSIAFAGLSLVGYTTKKDLSGMGAFLIMGLIGLIVASIVNMFLASSAMAFAISV 195

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           +G++IF+ LTAYDTQ+IK  Y       D  +  + +++GAL LY+DFI +F+ LL+ LG
Sbjct: 196 IGVLIFAGLTAYDTQRIKNDYLQHAHMGDQEWLAKSAIMGALSLYLDFINMFMMLLQLLG 255

Query: 256 SRR 258
           +R 
Sbjct: 256 NRE 258


>gi|163745936|ref|ZP_02153295.1| hypothetical protein OIHEL45_10128 [Oceanibulbus indolifex HEL-45]
 gi|161380681|gb|EDQ05091.1| hypothetical protein OIHEL45_10128 [Oceanibulbus indolifex HEL-45]
          Length = 258

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 106/261 (40%), Positives = 170/261 (65%), Gaps = 6/261 (2%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D+   +    S     S ID GLRA+M +VY  M++G+ +T   ++ ++ L+ T DP 
Sbjct: 1   MADVNTIR---TSAGSRASAIDAGLRAHMNKVYGTMSIGMLITFAAAWAISGLSVTTDPS 57

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
           AA   +++   LT  G  +Y SPL+W+ +FAPL      +  ++ +SA  A+++F  ++A
Sbjct: 58  AAVAQLSQDKYLTQLGYALYASPLKWVVMFAPLAFVFGFSAMINKMSAATAQVVFYAFAA 117

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           ++G+S+SS FLV+T  SI Q F IT+ +F  LSL+GYTTK+D+   GSF+IMG  GL + 
Sbjct: 118 VMGISISSIFLVFTGYSIAQIFLITSIAFAGLSLWGYTTKKDISGWGSFLIMGVIGLVVA 177

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGAL 237
           S+VN+F+ SSA+   +SA+G++IF+ LTAYDTQ+IK    A++   D  +  + +++GAL
Sbjct: 178 SIVNIFLASSALMFAISAIGVLIFAGLTAYDTQRIKTEYLAHAQHGDTEWLGKAAIMGAL 237

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY++FI +F+ LL   G+R 
Sbjct: 238 NLYLNFINMFMMLLSLFGNRE 258


>gi|13470643|ref|NP_102212.1| hypothetical protein mlr0409 [Mesorhizobium loti MAFF303099]
 gi|14021385|dbj|BAB47998.1| mlr0409 [Mesorhizobium loti MAFF303099]
          Length = 238

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 157/248 (63%), Gaps = 19/248 (7%)

Query: 11  VNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGV 70
           V +G+  G+  D+GLR +M+RVYN M LGL VTG+++FLV+       P           
Sbjct: 10  VGTGAQAGAVFDEGLRQHMLRVYNYMGLGLVVTGLVAFLVSSTPALYVP----------- 58

Query: 71  MLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFF 130
                   +++SPL+++ + APL   +  + R+ ++SA +A+ MF  + A++GLSL+S F
Sbjct: 59  --------IFSSPLKYVVMLAPLAFVLLFSFRMQTMSAASAQAMFWAFCAVMGLSLASVF 110

Query: 131 LVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSS 190
           LV+T  SI +TFFI A  FG+ SLYGYTT+RDL    SF+IMG  G+ + S+VN+F+ S+
Sbjct: 111 LVFTGTSIARTFFIAATMFGATSLYGYTTRRDLTQFSSFLIMGLIGVVIASIVNIFLGST 170

Query: 191 AIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHL 250
           A+   +S +G+ +F  LTA+DTQ IKE Y++ +D    ++ +V GA  LY++FI IF  L
Sbjct: 171 ALQFAISVIGIAVFIGLTAWDTQTIKEQYAENFDAESRQKLAVFGAFSLYLNFINIFQLL 230

Query: 251 LRFLGSRR 258
           L F G R 
Sbjct: 231 LNFTGERE 238


>gi|254463314|ref|ZP_05076730.1| integral membrane protein [Rhodobacterales bacterium HTCC2083]
 gi|206679903|gb|EDZ44390.1| integral membrane protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 258

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 106/250 (42%), Positives = 166/250 (66%), Gaps = 6/250 (2%)

Query: 15  SGFGST---IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVM 71
           SG GS    ID GLRA+M +VY  M++G+ +T + ++ +  LA T DP  A   I     
Sbjct: 9   SGVGSAAADIDAGLRAHMNKVYGTMSVGMFITFLAAWAIAGLAVTNDPSQAVAQIGADKY 68

Query: 72  LTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFL 131
           LT  G+ +Y SPL+W+ +FAPL     ++  ++ +SA  A+ +F +++A++G+S+SS FL
Sbjct: 69  LTSLGSALYLSPLKWVVMFAPLAFVFGMSAAINRMSAATAQTVFYIFAAVMGVSISSIFL 128

Query: 132 VYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSA 191
           V+T  SI+Q F IT+ +F  LSL+GYTTK+D+   GSF+IMG  GL + S+VN+++ S A
Sbjct: 129 VFTGYSIMQIFLITSIAFAGLSLWGYTTKKDISGWGSFLIMGVIGLIVASIVNIWLASPA 188

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMDFIQIFV 248
           I   +SA+G++IF+ LTAYDTQ IK    A++   D  +  + +++GAL LY++FI +F+
Sbjct: 189 IMFAISAIGVLIFAGLTAYDTQNIKNTYLAHAHHGDSEWLGKSAIMGALSLYLNFINMFM 248

Query: 249 HLLRFLGSRR 258
            LL+  G+R 
Sbjct: 249 MLLQLFGNRE 258


>gi|89071170|ref|ZP_01158363.1| membrane protein, putative [Oceanicola granulosus HTCC2516]
 gi|89043296|gb|EAR49521.1| membrane protein, putative [Oceanicola granulosus HTCC2516]
          Length = 256

 Score =  198 bits (504), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 108/256 (42%), Positives = 168/256 (65%), Gaps = 5/256 (1%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
            YQ V  +     + ID+GL+A+M +VY  M++G+ +T + ++ +N LA T   +A  I 
Sbjct: 3   QYQTVRTADGVRSAAIDEGLKAHMNKVYGTMSVGMLITALAAWAINGLAVTDVANAYQIG 62

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
            ++   LT FG  +Y SPL+W+ +F PL +       ++ LSA +A++ F  ++AL+GLS
Sbjct: 63  ADK--YLTDFGYAIYASPLKWVIMFLPLVMVFAFGAMINRLSAASAQLFFYTFAALMGLS 120

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LS  F+ +TS SIVQ F +TA +F  LSL+GYTTK+D+   GSF+IMG  GL + SLVN+
Sbjct: 121 LSWIFIAFTSYSIVQVFLVTAIAFAGLSLWGYTTKKDISGWGSFLIMGVIGLIVASLVNI 180

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMD 242
           F++S AI   +S +G++IF+ LTAYDTQ IK    A++   D  +  + +++GAL LY+D
Sbjct: 181 FLQSPAIMYAISIIGVLIFAGLTAYDTQNIKNTYIAHAAHGDQEWLGKAAIMGALNLYLD 240

Query: 243 FIQIFVHLLRFLGSRR 258
           FI +F+ LL+ +G+R 
Sbjct: 241 FINMFMFLLQLMGNRE 256


>gi|288956871|ref|YP_003447212.1| hypothetical protein AZL_000300 [Azospirillum sp. B510]
 gi|288909179|dbj|BAI70668.1| hypothetical protein AZL_000300 [Azospirillum sp. B510]
          Length = 256

 Score =  198 bits (503), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 106/239 (44%), Positives = 158/239 (66%), Gaps = 19/239 (7%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           +D+GLR +M+RVYN M  GL +TG+++ LV+               +  +M+  FG    
Sbjct: 36  LDEGLRQHMLRVYNYMGAGLILTGLVAALVSS--------------SPAIMMAIFG---- 77

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            SPL+W+ + APL   + L+  +  LS  +A+M+F  Y   +GLS+S+ FLV+T  SI  
Sbjct: 78  -SPLKWVVMLAPLAFVMVLSFGIQRLSFASAQMIFWAYCGAMGLSMSAIFLVFTGASIAL 136

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
           TFF+TAA+F ++SLYGYTTK DL  +GSF++MG  GL +  L N+F +S A+   +SA+G
Sbjct: 137 TFFVTAATFLAMSLYGYTTKADLSKMGSFLMMGVIGLVIAGLANIFFQSPALHFAISAIG 196

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           ++IF+ LTAYDTQ IKE+Y++ YD   A + +++GAL LY+DFI +F  LL+FLG R +
Sbjct: 197 VLIFTGLTAYDTQAIKESYAESYDHESAGKLALMGALTLYLDFINLFQFLLQFLGQRNN 255


>gi|294676428|ref|YP_003577043.1| hypothetical protein RCAP_rcc00871 [Rhodobacter capsulatus SB 1003]
 gi|294475248|gb|ADE84636.1| protein of unknown function UPF0005, transmembrane [Rhodobacter
           capsulatus SB 1003]
          Length = 238

 Score =  198 bits (503), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 110/255 (43%), Positives = 163/255 (63%), Gaps = 21/255 (8%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           NY  + ++ +G  S ID+GLR +M +VY LM++ + VTG ++F V++             
Sbjct: 3   NYNTMHSTAAGRASYIDEGLRTHMNKVYGLMSVAMIVTGAVAFGVSL------------- 49

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
            N  ++   FG     +PL+W+ +FAPL V    +  +H +    A+M+F  YSAL+GLS
Sbjct: 50  -NDQLLAAIFG-----TPLKWVVMFAPLVVVFAFSALIHKMQTSTAQMVFFGYSALMGLS 103

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LS  F VYT  SI QTF ITA +F +LSLYGYTTKR+L   GSF++MG  GL + SL+N+
Sbjct: 104 LSFIFKVYTGVSIAQTFLITAIAFAALSLYGYTTKRNLSAFGSFLMMGLIGLIVASLLNI 163

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDF 243
           F+ SSA+   +S +G+++F+ LTAYDTQ IK  Y    + D  +  + +++GAL LYMDF
Sbjct: 164 FIASSALQFAISVIGVLLFAGLTAYDTQNIKNTYLQLAQSDADFLGKAAILGALQLYMDF 223

Query: 244 IQIFVHLLRFLGSRR 258
           + +F+ LL+FLG+R 
Sbjct: 224 LNLFMFLLQFLGNRE 238


>gi|254561463|ref|YP_003068558.1| hypothetical protein METDI3050 [Methylobacterium extorquens DM4]
 gi|254268741|emb|CAX24702.1| conserved hypothetical protein; putative inner membrane protein
           [Methylobacterium extorquens DM4]
          Length = 255

 Score =  197 bits (502), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 112/239 (46%), Positives = 160/239 (66%), Gaps = 8/239 (3%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           +DQGLR++M+ VYN M +GLG++G+++  +N +A      A  +       LT FG  +Y
Sbjct: 24  VDQGLRSFMLGVYNNMVVGLGISGLVALALN-MAAVAQTGAGRLA------LTPFGQFLY 76

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
           TSP +W+ + APL      + R+  +SA +A+MMF  ++A++G S+S+  LV+T  S+V+
Sbjct: 77  TSPFKWVLMLAPLAFIFVFSFRMDRMSASSARMMFWAFAAVMGASMSTLLLVFTGASVVR 136

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            FFITAA+F  LSLYGYTTKR L  +GSF+IMG  G+ + SLVNLF+ SSA+   +S +G
Sbjct: 137 VFFITAATFAGLSLYGYTTKRSLSGMGSFLIMGLIGIIIASLVNLFLASSALQFAISVLG 196

Query: 201 LVIFSALTAYDTQKIKEAY-SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++IF+ LTA+DTQK+KE Y     D   A + SV GAL LY+DFI +F  LL  LG RR
Sbjct: 197 VLIFAGLTAFDTQKLKEMYLYSGLDAEGAAKMSVNGALTLYLDFINMFQFLLSLLGDRR 255


>gi|254466583|ref|ZP_05079994.1| integral membrane protein [Rhodobacterales bacterium Y4I]
 gi|206687491|gb|EDZ47973.1| integral membrane protein [Rhodobacterales bacterium Y4I]
          Length = 258

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 104/243 (42%), Positives = 159/243 (65%), Gaps = 3/243 (1%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + ID+GLRA+M +VY  MA G  +T + ++ V  LA T DP      ++    LT  G  
Sbjct: 16  AQIDEGLRAHMNKVYATMAAGTFITFLAAWAVAGLAVTTDPANGVAQLSADKYLTNIGYA 75

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +Y SPL+W+ +FAPL     +    + +SA   +++F +++ ++GLS+SS FLV+T +SI
Sbjct: 76  LYASPLKWVIMFAPLAFVFGIGAAANRMSAAGVQLLFYVFATVMGLSISSIFLVFTGESI 135

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           VQ F IT+ +F  LSL GYTTK+DL  +G+F+IMG  GL + S+VN+F+ SSA+   +S 
Sbjct: 136 VQVFLITSIAFAGLSLVGYTTKKDLSGMGAFLIMGLIGLIVASIVNIFLASSAMAFAISV 195

Query: 199 MGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           +G++IF+ LTAYDTQ+IK  Y   +   D  +  + +++GAL LY+DFI +F+ LL  LG
Sbjct: 196 IGVLIFAGLTAYDTQRIKNDYLQMAHAGDQEWLAKSAIMGALSLYLDFINMFMMLLNLLG 255

Query: 256 SRR 258
           +R 
Sbjct: 256 NRE 258


>gi|220924351|ref|YP_002499653.1| hypothetical protein Mnod_4482 [Methylobacterium nodulans ORS 2060]
 gi|219948958|gb|ACL59350.1| protein of unknown function UPF0005 [Methylobacterium nodulans ORS
           2060]
          Length = 236

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 104/237 (43%), Positives = 148/237 (62%), Gaps = 19/237 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D  LR +M+RVYN M LGL +TG+++F V        P                   ++ 
Sbjct: 19  DASLRQHMLRVYNYMGLGLALTGLVAFAVASTPAIAQP-------------------LFG 59

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           +PL+++ + APL   +FL+ R+  +SA  A+ +F  +  ++GLSL+S FLV+T  SI +T
Sbjct: 60  TPLKYVVMLAPLAFILFLSFRIEHISAATAQTLFWSFCGVMGLSLASIFLVFTGTSIART 119

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FFITAA FG+ SLYGYTTKRDL  +GSF++MG  GL + SLVN+F+ SSA+   +S +G+
Sbjct: 120 FFITAAMFGATSLYGYTTKRDLSQMGSFLMMGLIGLIIASLVNIFLASSALQFAISLIGV 179

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           VIF  LTAYDTQ IKE Y++ +      + +V GAL LY++FI +F  LL   G R 
Sbjct: 180 VIFVGLTAYDTQSIKEQYAEHWGQEANNKLAVFGALSLYLNFINLFQMLLNLTGERE 236


>gi|297180302|gb|ADI16520.1| integral membrane protein, interacts with ftsh [uncultured
           bacterium HF4000_009C18]
          Length = 251

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 113/240 (47%), Positives = 162/240 (67%), Gaps = 10/240 (4%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           ID+GLRAYM++VYN MA G+ +TG++S  +  L+     D + I       LT  G  +Y
Sbjct: 20  IDEGLRAYMLKVYNYMASGVLLTGVISLFLFKLSVVTAADGSII------GLTDLGNALY 73

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S L WI + APLGV  +++  +  +SA  A+  F +++AL+G SLSS FLVYT  SI +
Sbjct: 74  NSALMWIVMLAPLGVVFYISFGIRKMSAAKAQGAFWIFAALMGASLSSIFLVYTGASITR 133

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            FFITA +FG++S+YGYTTKRDL  +GSF++MG  G+ + S+VN+FM+SS +   +S +G
Sbjct: 134 VFFITAGTFGAMSIYGYTTKRDLTRLGSFLMMGLIGIIIASIVNIFMKSSMMYFVISIIG 193

Query: 201 LVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +++F  LTAYDTQKIK  Y  SD  +V    +++V+GAL LY+DFI +F+ LL   G RR
Sbjct: 194 VLVFVGLTAYDTQKIKNMYLVSDTGEV--MGKKAVMGALTLYLDFINLFLMLLMLFGQRR 251


>gi|259415915|ref|ZP_05739835.1| inner membrane protein YbhL [Silicibacter sp. TrichCH4B]
 gi|259347354|gb|EEW59131.1| inner membrane protein YbhL [Silicibacter sp. TrichCH4B]
          Length = 259

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 162/244 (66%), Gaps = 4/244 (1%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + ID GLRA+M +VY  M++G  +T + ++ +  L+ T DP  A   ++    LT FG  
Sbjct: 16  AEIDAGLRAHMNKVYGTMSVGTLITFLAAWAIAGLSVTSDPANAVAQLSSDSYLTNFGYA 75

Query: 79  MYTSPLRWIFIFAPLG-VFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           +Y SPL+W+ +FAPL  VF      ++ LSA   +++F  ++AL+GLS+SS F+ +T +S
Sbjct: 76  IYASPLKWVIMFAPLAFVFFGFGAAVNRLSAAGVQVVFYAFAALMGLSISSIFVTFTGES 135

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           I Q F +T+ +F  LSL GYTTK+DL  +GSF+IMG  GL + S+VN+F+ SSA+   +S
Sbjct: 136 IAQVFLVTSIAFAGLSLVGYTTKKDLSGMGSFLIMGLIGLIVASVVNIFLASSAMAFAIS 195

Query: 198 AMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
            +G++IF+ LTAYDTQ+IK  Y   +   D  +  + +V+GAL LY+DFI +F+ LL+ L
Sbjct: 196 VIGVLIFAGLTAYDTQRIKNDYLQMAHAGDQEWLGKAAVMGALSLYLDFINMFMMLLQLL 255

Query: 255 GSRR 258
           G+R 
Sbjct: 256 GNRE 259


>gi|297183712|gb|ADI19837.1| integral membrane protein, interacts with ftsh [uncultured alpha
           proteobacterium EB000_37G09]
          Length = 239

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/235 (42%), Positives = 158/235 (67%), Gaps = 15/235 (6%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GLR+YM+ VYN M   LG+TG  +F +  LA   +P                G +++T+P
Sbjct: 20  GLRSYMLGVYNHMTTALGITGFAAFGMK-LAVMANP--------------ALGQVLFTAP 64

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           + ++ +FAP G+ ++L++R++++SA  A+ +F +Y+ ++G+SL++    YT  S+ + FF
Sbjct: 65  MIYVLMFAPFGMVMWLSMRINTMSATKARSLFYIYAVMMGVSLTTVLFAYTGASVARAFF 124

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           ITA +F +LS+YGYTTKRDL  +G+F+I+G  GL L S+VN+F+ SS  +  +S +G+++
Sbjct: 125 ITAGAFAALSIYGYTTKRDLTALGAFLIVGLVGLILASVVNMFVASSQFEFLISIVGVLL 184

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F+ LTAYDTQKIK  YS R D   A R+S+ GAL LY+DFI +F+ +LR  G+R 
Sbjct: 185 FAGLTAYDTQKIKSMYSARDDKTTAARKSIFGALTLYLDFINMFLMMLRLFGNRE 239


>gi|99081754|ref|YP_613908.1| hypothetical protein TM1040_1913 [Ruegeria sp. TM1040]
 gi|99038034|gb|ABF64646.1| protein of unknown function UPF0005 [Ruegeria sp. TM1040]
          Length = 259

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 162/244 (66%), Gaps = 4/244 (1%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + ID GLRA+M +VY  M++G  +T + ++ +  L+ T DP  A   ++    LT FG  
Sbjct: 16  AEIDAGLRAHMNKVYGTMSVGTLITFLAAWAIAGLSVTSDPANAVAQLSSDSYLTNFGYA 75

Query: 79  MYTSPLRWIFIFAPLG-VFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           +Y SPL+W+ +FAPL  VF      ++ LSA   +++F  ++AL+GLS+SS F+ +T +S
Sbjct: 76  IYASPLKWVIMFAPLAFVFFGFGAAVNRLSAAGVQVVFYAFAALMGLSISSIFVTFTGES 135

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           I Q F +T+ +F  LSL GYTTK+DL  +GSF+IMG  GL + S+VN+F+ SSA+   +S
Sbjct: 136 IAQVFLVTSIAFAGLSLVGYTTKKDLSGMGSFLIMGLIGLIVASVVNIFLASSAMAFAIS 195

Query: 198 AMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
            +G++IF+ LTAYDTQ+IK  Y   +   D  +  + +++GAL LY+DFI +F+ LL+ L
Sbjct: 196 VIGVLIFAGLTAYDTQRIKNDYLQMAHAGDQEWLGKAAIMGALSLYLDFINMFMMLLQLL 255

Query: 255 GSRR 258
           G+R 
Sbjct: 256 GNRE 259


>gi|163737467|ref|ZP_02144884.1| hypothetical protein RGBS107_18088 [Phaeobacter gallaeciensis
           BS107]
 gi|161388993|gb|EDQ13345.1| hypothetical protein RGBS107_18088 [Phaeobacter gallaeciensis
           BS107]
          Length = 258

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 102/243 (41%), Positives = 162/243 (66%), Gaps = 3/243 (1%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + ID GLRA+M +VY  MA+G  +T + ++ ++ LA T DP  A+  ++    LT  G  
Sbjct: 16  AEIDAGLRAHMNKVYGTMAVGTFITFLAAWAISGLAVTTDPANAAAQLSADRYLTSIGYA 75

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +Y SPL+W+ +FAPL     ++   + +SA   +++F +++ ++GLS+SS FLV+T +SI
Sbjct: 76  LYASPLKWVIMFAPLAFVFGISAAANRMSAAGVQLLFYVFATVMGLSISSIFLVFTGESI 135

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           VQ F IT+ +F  LSL GYTTK+DL  +G+F+IMG  GL +L++ N+F+ SS +   +S 
Sbjct: 136 VQVFLITSIAFAGLSLVGYTTKKDLSGMGAFLIMGLIGLIVLAIANMFIASSVLANVISF 195

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           +G++IF+ LTAYDTQ+IK  Y       D  +  + +++GAL LY+DFI +F+ LL+ LG
Sbjct: 196 VGVLIFAGLTAYDTQRIKNEYLQHAHMGDQEWLGKAAIMGALSLYLDFINMFMMLLQLLG 255

Query: 256 SRR 258
           +R 
Sbjct: 256 NRE 258


>gi|114769357|ref|ZP_01446983.1| hypothetical protein OM2255_06485 [alpha proteobacterium HTCC2255]
 gi|114550274|gb|EAU53155.1| hypothetical protein OM2255_06485 [alpha proteobacterium HTCC2255]
          Length = 238

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 111/256 (43%), Positives = 159/256 (62%), Gaps = 23/256 (8%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +YQ +  +G+     ID+GLRA+M  VY +M+ G+  TGI+++L      T   DA    
Sbjct: 3   DYQTINRAGTT-ALEIDEGLRAHMSSVYGIMSAGMATTGIVAYL------TGQNDA---- 51

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                      A ++T  LRW  +FAPL +  FL   ++ LS   A++ F+ +SAL+GLS
Sbjct: 52  ---------LLATLFTGGLRWAVMFAPLIMVFFLGSMINRLSQTGARLAFITFSALMGLS 102

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           +S  F VYT  SI QTFF TA +FG LSLYGYTTKRD+   GSF+IMG  GL + S++N+
Sbjct: 103 ISWIFAVYTGISITQTFFTTAIAFGGLSLYGYTTKRDISGWGSFLIMGVIGLIVASILNI 162

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMD 242
           +M SSA+   +S +GL+IF+ LTAYDTQKIK  Y   +      +  + +++GAL LY+D
Sbjct: 163 WMASSAMTFAISVIGLLIFAGLTAYDTQKIKNTYIAMASNGQTDWLGKAAIMGALSLYLD 222

Query: 243 FIQIFVHLLRFLGSRR 258
           F+ +F+ LL F+G R 
Sbjct: 223 FLNMFMFLLHFMGGRE 238


>gi|209965747|ref|YP_002298662.1| integral membrane protein, putative [Rhodospirillum centenum SW]
 gi|209959213|gb|ACI99849.1| integral membrane protein, putative [Rhodospirillum centenum SW]
          Length = 240

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 102/257 (39%), Positives = 157/257 (61%), Gaps = 20/257 (7%)

Query: 4   IRNYQRVVNSGSGFG-STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           I  Y R   +G     +  D+GLR +M+RVYN M +GL +TG+++FL             
Sbjct: 3   IGPYNRYATAGRALDQAQFDEGLRQHMLRVYNYMTVGLVITGLVAFL--------GASTP 54

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
           +++          GA+ Y +PL+W+ + APL     L+   H +SA   + +F ++S L+
Sbjct: 55  AVV----------GAV-YGTPLQWVVMLAPLAFIFILSWNFHKMSAATLQTLFYVFSGLM 103

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GLSL   FLVYT  S+ + FFITA  F + SLYGYTTK+DL  +G FM+MG  G+ +  L
Sbjct: 104 GLSLMYIFLVYTGASVARVFFITAGMFAATSLYGYTTKKDLSSMGGFMVMGLIGIVIAGL 163

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           VN+F+ SSA+   +S +G+++F+ LTA+DTQ+IKE Y++ +      + +V+GAL LY++
Sbjct: 164 VNIFLASSALQFAISVIGVIVFTGLTAWDTQRIKEQYAEGWGAEANGKLAVMGALSLYLN 223

Query: 243 FIQIFVHLLRFLGSRRD 259
           FI +F  LL+ LG R +
Sbjct: 224 FINLFTMLLQLLGQRDE 240


>gi|254449846|ref|ZP_05063283.1| integral membrane protein [Octadecabacter antarcticus 238]
 gi|198264252|gb|EDY88522.1| integral membrane protein [Octadecabacter antarcticus 238]
          Length = 260

 Score =  189 bits (479), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 101/261 (38%), Positives = 167/261 (63%), Gaps = 6/261 (2%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D R  Q     G    + ID+GLRA+M +VY LM+ GL +T + ++ +  +  +  P 
Sbjct: 3   MADYRTPQMGATVGV-HTAEIDEGLRAHMNKVYGLMSFGLLMTFLAAWAIGTMTVSAVPT 61

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
             +I  N+   LT  GA +Y SPL+W+ +F PL +    +  ++ +SA AA+  F +++ 
Sbjct: 62  QYAIGSNQ--YLTDLGATLYLSPLKWVVMFLPLVLVFVFSAMINRMSAAAAQTFFYVFAT 119

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
            +G+S+S  F+ +T  SI Q F IT+ +FG LSL+GYTTKRD+   G F+IMG  GL + 
Sbjct: 120 AMGVSISWIFVAFTGASIAQVFLITSIAFGGLSLWGYTTKRDISGWGGFLIMGVIGLIVA 179

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGAL 237
           S+VN++++S  I   +S +GL+IF+ LTAYDTQ+IK    A+++  D  + ++ +++G+L
Sbjct: 180 SVVNIWLQSDVIGWAVSIIGLLIFAGLTAYDTQRIKTDYIAHAEHGDQEWMDKSAIMGSL 239

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY++FI +F+ LL+ +G+R 
Sbjct: 240 SLYINFINMFMFLLQLMGNRE 260


>gi|91205954|ref|YP_538309.1| integral membrane protein [Rickettsia bellii RML369-C]
 gi|157826685|ref|YP_001495749.1| integral membrane protein [Rickettsia bellii OSU 85-389]
 gi|91069498|gb|ABE05220.1| Integral membrane protein [Rickettsia bellii RML369-C]
 gi|157801989|gb|ABV78712.1| Integral membrane protein [Rickettsia bellii OSU 85-389]
          Length = 237

 Score =  188 bits (477), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 104/254 (40%), Positives = 160/254 (62%), Gaps = 19/254 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +Y + + + S    T D+GLR YM++VYN MAL L +TGI +    +   +V+P      
Sbjct: 3   DYTKTLTASSSKNKTFDEGLRKYMLKVYNYMALALLLTGIAA----VTTISVEP------ 52

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           +   +  TGFG L+         +FAPLG+ ++  +    ++   A+++F +Y+AL G+S
Sbjct: 53  LYNLMFQTGFGTLI---------MFAPLGIALYFFMGFGRMNLQTAQILFWVYAALTGMS 103

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L+   LVYT +SI +TFFI A+ FG++SLYGY+T RDL  +GSF  MG  GL + SLVN+
Sbjct: 104 LAYLALVYTGESIARTFFICASVFGAMSLYGYSTNRDLTSMGSFCAMGLIGLIIASLVNM 163

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F++SS +    S +G+V+F  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI 
Sbjct: 164 FLKSSGLSFATSLIGIVVFMGLIAWDTQKIKSMYYMAGNDETGQKLSIMAAFTLYLDFIN 223

Query: 246 IFVHLLRFLGSRRD 259
           +F++L+RFLG+RRD
Sbjct: 224 LFLYLMRFLGNRRD 237


>gi|148259460|ref|YP_001233587.1| hypothetical protein Acry_0443 [Acidiphilium cryptum JF-5]
 gi|146401141|gb|ABQ29668.1| protein of unknown function UPF0005 [Acidiphilium cryptum JF-5]
          Length = 256

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 107/268 (39%), Positives = 167/268 (62%), Gaps = 26/268 (9%)

Query: 2   SDIRNYQR-VVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSF------LVNILA 54
            D+R+Y+   V +G+G    +D+GLRAYM+RVYN MA GL +T I+S+      L+N   
Sbjct: 5   PDMRSYRSATVAAGAG---VLDEGLRAYMLRVYNWMASGLLLTAIVSYAISHTGLINAFY 61

Query: 55  TTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMM 114
             V     ++I   G+             L +I IFAPL   + ++  ++ LS   A+ +
Sbjct: 62  PLVATPGGAMIREPGI-------------LAYISIFAPLAFMLVMSFGVNKLSTTQAQAL 108

Query: 115 FLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGA 174
           F  +  L+G SL++ FLVYT +SI+ TFF+TA +F ++S+YGYTT+ DL   GSF++MG 
Sbjct: 109 FWAFCGLMGASLTNIFLVYTGQSILTTFFVTAGTFAAMSIYGYTTRTDLTKFGSFLVMGV 168

Query: 175 FGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD---RYDVAYAERQ 231
            GL +  +VN+F+ S A+   +SA+G+++F+ L AYDTQ+IK  Y     R+    A ++
Sbjct: 169 IGLLIAMVVNIFLHSPAMQFAISAIGVLVFTGLAAYDTQRIKADYVQYGYRFGAGMAAKR 228

Query: 232 SVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           SV  AL LY++FI +F+ LL+F+G+RR+
Sbjct: 229 SVYDALQLYLNFINLFLFLLQFMGNRRN 256


>gi|87199165|ref|YP_496422.1| hypothetical protein Saro_1143 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134846|gb|ABD25588.1| protein of unknown function UPF0005 [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 247

 Score =  187 bits (476), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 109/265 (41%), Positives = 160/265 (60%), Gaps = 32/265 (12%)

Query: 6   NYQRVVNSGSGFGST------------IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNIL 53
           N+     +G+GFG++             D GLR +M+ +YN MA G+ ++GI++ L    
Sbjct: 3   NWNDPRPTGTGFGASPSLSGVQGRSEVFDAGLRRHMLSIYNYMASGVLLSGIVALL---F 59

Query: 54  ATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKM 113
           AT+            G  L  FG     +PLRW+   APL   + ++  ++ LS +A + 
Sbjct: 60  ATS------------GAALAVFG-----TPLRWVVALAPLAFVMIMSFGVNRLSTFAMQA 102

Query: 114 MFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMG 173
           MF  +S  +GLSLS+ F +YT  SI  TFF TA +F  LSL+GYTTK+DL   GSF+IMG
Sbjct: 103 MFWGFSVAMGLSLSAIFFIYTGPSIAVTFFATAGAFAGLSLFGYTTKKDLSGFGSFLIMG 162

Query: 174 AFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSV 233
            FGL + SL+N+F++S  +   +S +G++IF+ LTAYDTQK+KE Y+      +A +  V
Sbjct: 163 VFGLLIASLINMFLQSPGLAWAVSFLGVLIFAGLTAYDTQKLKEQYAYVAGTDFAGKAVV 222

Query: 234 IGALMLYMDFIQIFVHLLRFLGSRR 258
           +GAL LY+DFI +F  LL+F+G RR
Sbjct: 223 LGALNLYLDFINMFQFLLQFMGDRR 247


>gi|163851691|ref|YP_001639734.1| hypothetical protein Mext_2268 [Methylobacterium extorquens PA1]
 gi|163663296|gb|ABY30663.1| protein of unknown function UPF0005 [Methylobacterium extorquens
           PA1]
          Length = 294

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 110/240 (45%), Positives = 158/240 (65%), Gaps = 7/240 (2%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN-RGVMLTGFGALM 79
           +DQGLR++M+ VYN M +GLG++G+++  +N+   T      +I+ N +GV L   G  +
Sbjct: 60  VDQGLRSFMLGVYNNMVVGLGISGLVALALNMAVQT-----GTIVANYKGVPLNQLGVFI 114

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIV 139
           Y S  ++I + APL        R+  +SA +A+  F  ++A++G SLSS  L +T  S+V
Sbjct: 115 YGSWFKYILMLAPLAFIFVFTFRMDRMSAASARTAFWAFAAVMGASLSSMLLAFTGASVV 174

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
           + FFITAA+F  LSLYGYTTKR L  +GSF+IMG  G+ + SLVN+F+ SSA+   +S +
Sbjct: 175 RVFFITAATFAGLSLYGYTTKRSLSGMGSFLIMGLIGIIIASLVNIFLASSALQFAISVI 234

Query: 200 GLVIFSALTAYDTQKIKEAY-SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           G++IF+ LTAYDTQK+KE Y    +D   A + SV GAL LY+DFI +F  LL  LG RR
Sbjct: 235 GVLIFAGLTAYDTQKLKEMYLYSGFDAEGAAKMSVNGALTLYLDFINMFQFLLSLLGDRR 294


>gi|254510914|ref|ZP_05122981.1| integral membrane protein [Rhodobacteraceae bacterium KLH11]
 gi|221534625|gb|EEE37613.1| integral membrane protein [Rhodobacteraceae bacterium KLH11]
          Length = 259

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/244 (40%), Positives = 160/244 (65%), Gaps = 4/244 (1%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + ID+GLRA+M +VY  M++G+ +T + ++ ++ LA T DP  A   I     LT  G  
Sbjct: 16  AEIDEGLRAHMNKVYGTMSVGMLITALAAWAISGLAVTSDPANAVAQIGVDRYLTSLGGA 75

Query: 79  MYTSPLRWIFIFAPLGVFIF-LNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           ++ SPL+W+ +FAPLG   F     +   SA A ++ F +++A++G+S+SS F++YT  S
Sbjct: 76  LFLSPLKWVIMFAPLGFLFFGWGALMRRGSAAAVQLGFFIFAAVMGVSMSSIFMIYTPYS 135

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           I QTF +T+ +F  LSLYGYTTKR+L  +G+F++MG  GL +  +VNLF++SSA+ + +S
Sbjct: 136 IAQTFLVTSIAFAGLSLYGYTTKRNLSGMGTFLMMGVIGLLVAMIVNLFLQSSAMMMAIS 195

Query: 198 AMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
            +GL+IF+ LTA+ TQ IK    A++   D  + ++ +  GAL LY+ F+ +F  LL F+
Sbjct: 196 VIGLLIFAGLTAFYTQDIKNTYVAHAAHGDQEWLDKAAFDGALSLYISFLNMFQFLLMFM 255

Query: 255 GSRR 258
           G + 
Sbjct: 256 GQQE 259


>gi|229586387|ref|YP_002844888.1| Integral membrane protein, interacts with FtsH [Rickettsia africae
           ESF-5]
 gi|228021437|gb|ACP53145.1| Integral membrane protein, interacts with FtsH [Rickettsia africae
           ESF-5]
          Length = 236

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 105/254 (41%), Positives = 158/254 (62%), Gaps = 20/254 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +Y + + + S    T D+GLR YM++VYN MAL L +TG+ +    +   +V+P      
Sbjct: 3   DYTKTLTAASK-NKTFDEGLRQYMLKVYNYMALALLLTGVAA----VTTISVEP------ 51

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           I   +  TGFG          I +FAPLG+ ++  +    ++   A+++F +Y+ L G+S
Sbjct: 52  IYNLMFQTGFGT---------IIMFAPLGIALYFFMGFGQMNLQTAQILFWVYAGLTGMS 102

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L+   L+YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNL
Sbjct: 103 LAYLALIYTGASIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNL 162

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F++SSA+    S +G+VIF  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI 
Sbjct: 163 FLKSSALSFATSLIGIVIFMGLIAWDTQKIKSMYYMAGNDKAGQKLSIMAAFTLYLDFIN 222

Query: 246 IFVHLLRFLGSRRD 259
           +F+HL+RFLG+RRD
Sbjct: 223 LFLHLMRFLGNRRD 236


>gi|326402686|ref|YP_004282767.1| hypothetical protein ACMV_05380 [Acidiphilium multivorum AIU301]
 gi|325049547|dbj|BAJ79885.1| hypothetical protein ACMV_05380 [Acidiphilium multivorum AIU301]
          Length = 256

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 106/268 (39%), Positives = 166/268 (61%), Gaps = 26/268 (9%)

Query: 2   SDIRNYQR-VVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSF------LVNILA 54
            D+R+Y+   V +G+G    +D+GLRAYM+RVYN MA GL +T I+S+      L+N   
Sbjct: 5   PDMRSYRSATVAAGAG---VLDEGLRAYMLRVYNWMASGLLLTAIVSYAISHTGLINAFY 61

Query: 55  TTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMM 114
             V     ++I    +             L +I IFAPL   + ++  ++ LS   A+ +
Sbjct: 62  PLVATPGGAMIREPSI-------------LAYISIFAPLAFMLVMSFGVNKLSTTQAQAL 108

Query: 115 FLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGA 174
           F  +  L+G SL++ FLVYT +SI+ TFF+TA +F ++S+YGYTT+ DL   GSF++MG 
Sbjct: 109 FWAFCGLMGASLTNIFLVYTGQSILTTFFVTAGTFAAMSIYGYTTRTDLTKFGSFLVMGV 168

Query: 175 FGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD---RYDVAYAERQ 231
            GL +  +VN+F+ S A+   +SA+G+++F+ L AYDTQ+IK  Y     R+    A ++
Sbjct: 169 IGLLIAMVVNIFLHSPAMQFAISAIGVLVFTGLAAYDTQRIKADYVQYGYRFGAGMAAKR 228

Query: 232 SVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           SV  AL LY++FI +F+ LL+F+G+RR+
Sbjct: 229 SVYDALQLYLNFINLFLFLLQFMGNRRN 256


>gi|116687298|ref|YP_840544.1| hypothetical protein Bcen2424_6925 [Burkholderia cenocepacia
           HI2424]
 gi|116653013|gb|ABK13651.1| protein of unknown function UPF0005 [Burkholderia cenocepacia
           HI2424]
          Length = 239

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 107/258 (41%), Positives = 156/258 (60%), Gaps = 21/258 (8%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA 61
           +D R   R   S    G   D GLR YM  +YN MA GL +TG +++             
Sbjct: 3   NDFRQGARAEESQRVLGGD-DVGLRQYMRHIYNYMAGGLALTGAVAYF-----------G 50

Query: 62  ASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
           AS         TGF   +  +PL W+ + APL + +FL+ R+  +S  AA++ F  Y+AL
Sbjct: 51  AS---------TGFYRSIAGTPLFWVVLLAPLALVMFLSFRIEHISFGAAQISFWAYAAL 101

Query: 122 IGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS 181
           +GLSLS  FLVYT +SI + FFI+AA+FG+ SLYGY+T+ DL   GSF+ MG  G+ +  
Sbjct: 102 VGLSLSGIFLVYTGESIARVFFISAATFGATSLYGYSTRADLSRFGSFLFMGLIGIIIAG 161

Query: 182 LVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYM 241
            VNLF+ SSA+   +S +G+++F+ L AYDTQ+IK  Y    +   A +++++GAL LY+
Sbjct: 162 FVNLFLVSSALQFVVSVIGVLVFTGLIAYDTQRIKRIYIAGEEGKIAGKKAIMGALALYL 221

Query: 242 DFIQIFVHLLRFLGSRRD 259
           DF+ +F+ L+R  GSRR 
Sbjct: 222 DFLNLFLMLMRLFGSRRS 239


>gi|254440667|ref|ZP_05054160.1| Uncharacterized protein family UPF0005, putative [Octadecabacter
           antarcticus 307]
 gi|198250745|gb|EDY75060.1| Uncharacterized protein family UPF0005, putative [Octadecabacter
           antarcticus 307]
          Length = 260

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 101/261 (38%), Positives = 165/261 (63%), Gaps = 6/261 (2%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D R  Q     G    + ID+GLRA+M +VY LM+ GL +T + ++ +  +  +  P 
Sbjct: 3   MADYRTPQMGATIGVR-AAEIDEGLRAHMNKVYGLMSFGLLMTFLAAWAIGTMTVSDVPT 61

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
             +I  N+   LT  GA +Y SPL+W+ +F PL +    +  ++ +SA AA+  F +++ 
Sbjct: 62  QYAIGSNQ--YLTDLGATLYLSPLKWVIMFLPLVLVFVFSAMINRMSAAAAQTFFYVFAT 119

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
            +G+S+S  F+ +T  SI Q F IT+ +F  LSL+GYTTKRD+   G F+IMG  GL + 
Sbjct: 120 AMGVSISWIFVAFTGASIAQVFLITSIAFAGLSLWGYTTKRDISGWGGFLIMGIIGLIVA 179

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGAL 237
           S+VN++++S  I   +S +GL+IF+ LTAYDTQ+IK    A++   D  + ++ +++G+L
Sbjct: 180 SIVNIWLQSDVIGWAVSIIGLLIFAGLTAYDTQRIKTDYIAHAAHGDQEWMDKSAIMGSL 239

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY++FI +F+ LL+ +GSR 
Sbjct: 240 SLYINFINMFMFLLQLMGSRE 260


>gi|157828063|ref|YP_001494305.1| hypothetical protein A1G_01075 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165932761|ref|YP_001649550.1| stabilizing membrane protein [Rickettsia rickettsii str. Iowa]
 gi|157800544|gb|ABV75797.1| hypothetical protein A1G_01075 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165907848|gb|ABY72144.1| stabilizing membrane protein [Rickettsia rickettsii str. Iowa]
          Length = 236

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 104/254 (40%), Positives = 158/254 (62%), Gaps = 20/254 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +Y + + + S    T D+GLR YM++VYN MAL L +TG+ +    +   +V+P      
Sbjct: 3   DYTKTLTAASK-NKTFDEGLRQYMLKVYNYMALALLLTGVAA----VTTISVEP------ 51

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           I   +  TGFG          I +FAPLG+ ++  +    ++   A+++F +Y+ L G+S
Sbjct: 52  IYNLMFQTGFGT---------IIMFAPLGIALYFFMGFGQMNLQTAQILFWVYAGLTGMS 102

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L+   L+YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNL
Sbjct: 103 LAYLALIYTGASIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNL 162

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F++SSA+    S +G+VIF  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI 
Sbjct: 163 FLKSSALSFATSLIGIVIFMGLIAWDTQKIKSMYYMAGNDEVGQKLSIMAAFTLYLDFIN 222

Query: 246 IFVHLLRFLGSRRD 259
           +F++L+RFLG+RRD
Sbjct: 223 LFLYLMRFLGNRRD 236


>gi|51473346|ref|YP_067103.1| hypothetical protein RT0136 [Rickettsia typhi str. Wilmington]
 gi|51459658|gb|AAU03621.1| conserved hypothetical protein (integral membrane protein)
           [Rickettsia typhi str. Wilmington]
          Length = 236

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/254 (41%), Positives = 159/254 (62%), Gaps = 20/254 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +Y + + + S    T D+GLR YM++VYN MAL L +TG+ +    I   +V+P      
Sbjct: 3   DYTKTLTTTSK-NKTFDEGLRRYMLKVYNYMALALLLTGVAA----ITTISVEP------ 51

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           I   +  TGFG          I +FAPLG+ ++  +    ++   A+++F +Y+ L G+S
Sbjct: 52  IYHLMFQTGFGT---------IIMFAPLGIALYFFMGFGRMNLQTAQILFWVYAGLTGMS 102

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LS   L+YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNL
Sbjct: 103 LSYLALIYTGTSIARTFFICSSVFGAMSLYGYSTNRDLTSMGSFFAMGLIGLIIASLVNL 162

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F++SS++    S +G+V+F  L A+DTQKIK  Y    + A  ++ S++ A  LY+DFI 
Sbjct: 163 FLKSSSLSFATSLIGIVVFMGLIAWDTQKIKSMYYIAGNDAAGQKLSIMAAFTLYLDFIN 222

Query: 246 IFVHLLRFLGSRRD 259
           +F++L+RFLG+RRD
Sbjct: 223 LFLNLMRFLGNRRD 236


>gi|304392622|ref|ZP_07374562.1| inner membrane protein YbhL [Ahrensia sp. R2A130]
 gi|303295252|gb|EFL89612.1| inner membrane protein YbhL [Ahrensia sp. R2A130]
          Length = 249

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 104/264 (39%), Positives = 163/264 (61%), Gaps = 21/264 (7%)

Query: 1   MSDIRNYQRV-----VNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILAT 55
           M+D R   R          +G     D+GLR+YM+ +YN MA  L VTG+ +  +   A 
Sbjct: 1   MADYREEYRTRTMPGAAPAAGTDVQYDEGLRSYMLGIYNYMATALAVTGLSAIGLATWAQ 60

Query: 56  TVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMF 115
           + +P  A+ +              Y SPL+W+ + APL   + ++  ++ LS  AA  +F
Sbjct: 61  S-NPAVANAV--------------YNSPLKWVLMLAPLAFVLVISFGINKLSKTAAMGVF 105

Query: 116 LLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAF 175
             ++A++G S+S  F+VY+  SI QTFF+T+A+F  LSLYGYTTKR L  +GSF++MG  
Sbjct: 106 YAFAAVMGASISWIFMVYSLGSITQTFFVTSAAFAGLSLYGYTTKRVLSGMGSFLMMGLI 165

Query: 176 GLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY-SDRYDVAYAERQSVI 234
           GL L  +VN+F++SSA+   +SA+G++IF+ LTAYDTQ++K  Y S  ++     + S++
Sbjct: 166 GLILAMVVNIFLQSSALGFAISAIGVLIFAGLTAYDTQRLKHMYDSVAHNGEMMAKASIM 225

Query: 235 GALMLYMDFIQIFVHLLRFLGSRR 258
           GAL LY++F+ +F+ LL F+G+R 
Sbjct: 226 GALSLYLNFVNMFMFLLSFMGNRE 249


>gi|157803334|ref|YP_001491883.1| aspartyl-tRNA synthetase [Rickettsia canadensis str. McKiel]
 gi|157784597|gb|ABV73098.1| aspartyl-tRNA synthetase [Rickettsia canadensis str. McKiel]
          Length = 236

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 101/241 (41%), Positives = 152/241 (63%), Gaps = 19/241 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
            T D+GLR YM++VYN MAL L +TG+ +    +   +V+P     I N          L
Sbjct: 15  KTFDEGLRKYMLKVYNYMALALLLTGVAA----LTTISVEP-----IYN----------L 55

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           M+ +    I +FAPLG+ ++  +    ++   A+++F +Y+ L G+SL+   L+YT  SI
Sbjct: 56  MFQTSFGTIIMFAPLGIALYFFMGFGRMNLQTAQILFWVYTTLTGMSLAYLALIYTGTSI 115

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNLF++SSA+    S 
Sbjct: 116 ARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNLFLKSSALSFATSL 175

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +G+V+F  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI +F+HL+RFLG+RR
Sbjct: 176 IGIVVFMGLIAWDTQKIKSMYYMAGNNEVGQKLSIMAAFTLYLDFINLFLHLVRFLGNRR 235

Query: 259 D 259
           D
Sbjct: 236 D 236


>gi|67459526|ref|YP_247150.1| integral membrane protein [Rickettsia felis URRWXCal2]
 gi|67005059|gb|AAY61985.1| Integral membrane protein [Rickettsia felis URRWXCal2]
          Length = 236

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 159/254 (62%), Gaps = 20/254 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +Y + + + S    T D+GLR YM++VYN MAL L +TG+ +    +   +V+P      
Sbjct: 3   DYTKTLTATSK-NKTFDEGLRKYMLKVYNYMALALLLTGVAA----VTTISVEP------ 51

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           I   +  TGFG +M         +FAPLG+ ++  +    ++   A+++F +Y+ L G+S
Sbjct: 52  IYNLMFQTGFGTIM---------MFAPLGIALYFFMGFGRMNLKTAQILFWVYAGLTGMS 102

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L+   L+YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNL
Sbjct: 103 LAYLALIYTGASIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNL 162

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F++SSA+    S +G+V+F  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI 
Sbjct: 163 FLKSSALSFATSLIGIVVFMGLIAWDTQKIKSMYYMAGNDEVGQKLSIMAAFTLYLDFIN 222

Query: 246 IFVHLLRFLGSRRD 259
           +F++L+RFLG+RRD
Sbjct: 223 LFLYLMRFLGNRRD 236


>gi|34580857|ref|ZP_00142337.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262242|gb|EAA25746.1| unknown [Rickettsia sibirica 246]
          Length = 236

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 104/254 (40%), Positives = 158/254 (62%), Gaps = 20/254 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +Y + + + S    T D+GLR YM++VYN MAL L +TG+ +    +   +V+P      
Sbjct: 3   DYTKTLTAASK-NKTFDEGLRQYMLKVYNYMALALLLTGVAA----VTTISVEP------ 51

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           I   +  TGFG          I +FAPLG+ ++  +    ++   A+++F +Y+ L G+S
Sbjct: 52  IYNLMFQTGFGT---------IIMFAPLGIALYFFMGFGQMNLPTAQILFWVYAGLTGMS 102

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L+   L+YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNL
Sbjct: 103 LAYLALIYTGASIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNL 162

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F++SSA+    S +G+VIF  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI 
Sbjct: 163 FLKSSALSFATSLIGIVIFMGLIAWDTQKIKSMYYMAGNDEVGQKLSIMAAFTLYLDFIN 222

Query: 246 IFVHLLRFLGSRRD 259
           +F++L+RFLG+RRD
Sbjct: 223 LFLYLMRFLGNRRD 236


>gi|157964214|ref|YP_001499038.1| integral membrane protein, interacts with FtsH [Rickettsia
           massiliae MTU5]
 gi|157843990|gb|ABV84491.1| Integral membrane protein, interacts with FtsH [Rickettsia
           massiliae MTU5]
          Length = 249

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 157/254 (61%), Gaps = 20/254 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +Y + + + S    T D+GLR YM++VYN MAL L +TG+ +    +   +V+P      
Sbjct: 16  DYTKTLTTASK-NKTFDEGLRKYMLKVYNYMALALLLTGVAA----VTTISVEP------ 64

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           I   +  TGFG          I +FAPLG+ ++  +    ++    +++F +Y+ L G+S
Sbjct: 65  IYNLMFQTGFGT---------IIMFAPLGIALYFFMGFGRMNLQTTQILFWVYAGLTGMS 115

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L+   L+YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNL
Sbjct: 116 LAYLALIYTGASIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNL 175

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F++SSA+    S +G+VIF  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI 
Sbjct: 176 FLKSSALSFATSLIGIVIFMGLIAWDTQKIKSMYYTAGNDEVGQKLSIMAAFTLYLDFIN 235

Query: 246 IFVHLLRFLGSRRD 259
           +F++L+RFLG+RRD
Sbjct: 236 LFLYLMRFLGNRRD 249


>gi|15892112|ref|NP_359826.1| hypothetical protein RC0189 [Rickettsia conorii str. Malish 7]
 gi|15619238|gb|AAL02727.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 236

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 104/254 (40%), Positives = 158/254 (62%), Gaps = 20/254 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +Y + + + S    T D+GLR YM++VYN MAL L +TG+ +    +   +V+P      
Sbjct: 3   DYTKTLTAASKH-KTFDEGLRQYMLKVYNYMALALLLTGVAA----VTTISVEP------ 51

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           I   +  TGFG          I +FAPLG+ ++  +    ++   A+++F +Y+ L G+S
Sbjct: 52  IYNLMFQTGFGT---------IIMFAPLGIALYFFMGFGQMNLPTAQILFWVYAGLTGMS 102

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L+   L+YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNL
Sbjct: 103 LAYLALIYTGASIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNL 162

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F++SSA+    S +G+VIF  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI 
Sbjct: 163 FLKSSALSFATSLIGIVIFMGLIAWDTQKIKSMYYMAGNDEVGQKLSIMAAFTLYLDFIN 222

Query: 246 IFVHLLRFLGSRRD 259
           +F++L+RFLG+RRD
Sbjct: 223 LFLYLMRFLGNRRD 236


>gi|238650366|ref|YP_002916218.1| stabilizing membrane protein [Rickettsia peacockii str. Rustic]
 gi|238624464|gb|ACR47170.1| stabilizing membrane protein [Rickettsia peacockii str. Rustic]
          Length = 236

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 104/254 (40%), Positives = 157/254 (61%), Gaps = 20/254 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +Y + + + S    T D+GLR YM++VYN MAL L +TG+ +    +    V+P      
Sbjct: 3   DYTKTLTATSK-NKTFDEGLRQYMLKVYNYMALALLLTGVAA----VTTIAVEP------ 51

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           I   +  TGFG          I +FAPLG+ ++  +    ++   A+++F +Y+ L G+S
Sbjct: 52  IYNLMFQTGFGT---------IIMFAPLGIALYFFMGFGQMNLQTAQILFWVYAGLTGMS 102

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L+   L+YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNL
Sbjct: 103 LAYLALIYTGASIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNL 162

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F++SSA+    S +G+VIF  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI 
Sbjct: 163 FLKSSALSFATSLIGIVIFMGLIAWDTQKIKSMYYMAGNDEVGQKLSIMAAFTLYLDFIN 222

Query: 246 IFVHLLRFLGSRRD 259
           +F++L+RFLG+RRD
Sbjct: 223 LFLYLMRFLGNRRD 236


>gi|157825328|ref|YP_001493048.1| integral membrane protein [Rickettsia akari str. Hartford]
 gi|157799286|gb|ABV74540.1| Integral membrane protein [Rickettsia akari str. Hartford]
          Length = 236

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 105/254 (41%), Positives = 157/254 (61%), Gaps = 20/254 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +Y + + + S    T D+GLR YM++VYN MAL L +TGI +    I   +V+P      
Sbjct: 3   DYTKTLTATSK-NKTFDEGLRKYMLKVYNYMALALLLTGITA----ITTISVEP------ 51

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           I   +  TGFG          + +FAPLG+ ++  +    ++   A+++F +Y+ L G+S
Sbjct: 52  IYNLMFQTGFGT---------VIMFAPLGIALYFFMGFGRMNLNTAQILFWVYAGLTGMS 102

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L+   LVYT  SI +TFFI ++ FG++SLYGY T RDL  +GSF  MG  GL + SLVNL
Sbjct: 103 LAYLALVYTGTSIARTFFICSSVFGAMSLYGYNTSRDLTSMGSFFAMGLMGLIIASLVNL 162

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F++SSAI    S +G+V+F  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI 
Sbjct: 163 FLKSSAISFATSLIGIVVFMGLIAWDTQKIKSMYYMAGNDEVGQKFSIMAAFTLYLDFIN 222

Query: 246 IFVHLLRFLGSRRD 259
           +F++L++FLG+RRD
Sbjct: 223 LFLYLMKFLGNRRD 236


>gi|15604023|ref|NP_220538.1| hypothetical protein RP147 [Rickettsia prowazekii str. Madrid E]
 gi|15214359|sp|Q9ZE15|Y147_RICPR RecName: Full=Uncharacterized protein RP147
 gi|3860714|emb|CAA14615.1| unknown [Rickettsia prowazekii]
 gi|292571742|gb|ADE29657.1| Integral membrane protein, interact swith FtsH [Rickettsia
           prowazekii Rp22]
          Length = 236

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 104/254 (40%), Positives = 158/254 (62%), Gaps = 20/254 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +Y + + + S    T D+GLR YM++VYN MAL L +TG+ +    I   +V+P      
Sbjct: 3   DYTKTLTTTSK-NKTFDEGLRRYMLKVYNYMALALLLTGVAA----ITTISVEP------ 51

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           I   +  TGFG          I +FAPLG+ ++  +    ++   A+++F +Y+ L G+S
Sbjct: 52  IYHLMFQTGFGT---------IIMFAPLGIALYFFMGFGRMNLQTAQILFWVYAGLTGMS 102

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LS   L+YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNL
Sbjct: 103 LSYLALIYTGTSIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNL 162

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F++SS++    S +G+V+F  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI 
Sbjct: 163 FLKSSSLSFATSLIGIVVFMGLIAWDTQKIKSMYYIAGNDEVGQKLSIMAAFTLYLDFIN 222

Query: 246 IFVHLLRFLGSRRD 259
           +F++L+RFLG+RRD
Sbjct: 223 LFLYLMRFLGNRRD 236


>gi|84686232|ref|ZP_01014127.1| hypothetical protein 1099457000256_RB2654_08512 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665759|gb|EAQ12234.1| hypothetical protein RB2654_08512 [Rhodobacterales bacterium
           HTCC2654]
          Length = 245

 Score =  181 bits (460), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 106/255 (41%), Positives = 162/255 (63%), Gaps = 17/255 (6%)

Query: 8   QRVVNSGSGF-GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           QR V +G G   + ID+GLRA+M ++Y LM++GL VT  +++       T +P  A  ++
Sbjct: 4   QRTVRAGVGARAAQIDEGLRAHMNKIYGLMSVGLLVTAGVAWAFG----TAEPLQA--LL 57

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
              V L+        + L WI +F PL +       ++ LSA  A++ F +++A++G+S+
Sbjct: 58  RDPVTLS-------PNILGWIVMFLPLVMVFAFGAAINRLSAAGAQLFFYVFAAVMGMSI 110

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           S  F+ +T  SI QTF ITA +F  LSL+GYTTK+D+   GSF+IMG  GL L S+VN+F
Sbjct: 111 SWIFMAFTGVSIAQTFLITAIAFAGLSLWGYTTKKDISGWGSFLIMGLIGLILASIVNIF 170

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDF 243
           + S AI   +SA+G++IF+ LTAYDTQK+K  Y   +   D  +  + +++GAL LY+DF
Sbjct: 171 LGSPAIHFAISALGVLIFAGLTAYDTQKLKNDYIQHAHAMDSEWLAKSAIMGALNLYLDF 230

Query: 244 IQIFVHLLRFLGSRR 258
           I +F+ LL+FLG+R 
Sbjct: 231 INLFMFLLQFLGNRE 245


>gi|146276723|ref|YP_001166882.1| hypothetical protein Rsph17025_0671 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554964|gb|ABP69577.1| protein of unknown function UPF0005 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 246

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 107/261 (40%), Positives = 160/261 (61%), Gaps = 25/261 (9%)

Query: 6   NYQRVVNSGSGF-GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLV----NILATTVDPD 60
            YQ V + G+G   + ID+GLRA+M +VY LM++G+ +TG +++ V     + +   DP 
Sbjct: 3   EYQTVRSVGAGARAARIDEGLRAHMNKVYGLMSVGMLLTGGVAWAVGTSEQLFSLLRDP- 61

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                             M  + L WI +FAPL +       L+ LS  AA++ F  Y+A
Sbjct: 62  ----------------VTMSPNILGWIVMFAPLVMVFAFGAVLNRLSQAAAQLFFYAYAA 105

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           ++GLSLS  F+ +T  SI QTF ITA +F SLSL+GYTTK+DL   G+F+IMG  GL + 
Sbjct: 106 VMGLSLSWIFVAFTGVSIAQTFLITAIAFASLSLFGYTTKKDLSGFGTFLIMGVVGLIVA 165

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGAL 237
            +VN+F+ SSA+   +S +G++IF+ LTAYDTQ IK  Y   +   D  +  + +++GAL
Sbjct: 166 MIVNIFLASSALAFAISVIGVLIFAGLTAYDTQNIKNTYLQHAHSGDAEWLGKAAIMGAL 225

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY+DFI +F+ LL+F+G+R 
Sbjct: 226 QLYLDFINLFMFLLQFMGNRE 246


>gi|77465107|ref|YP_354610.1| integral membrane protein [Rhodobacter sphaeroides 2.4.1]
 gi|126464559|ref|YP_001045672.1| hypothetical protein Rsph17029_3820 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221369108|ref|YP_002520204.1| integral membrane protein [Rhodobacter sphaeroides KD131]
 gi|332560704|ref|ZP_08415022.1| integral membrane protein [Rhodobacter sphaeroides WS8N]
 gi|77389525|gb|ABA80709.1| Predicted integral membrane protein [Rhodobacter sphaeroides 2.4.1]
 gi|126106370|gb|ABN78900.1| protein of unknown function UPF0005 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221162160|gb|ACM03131.1| integral membrane protein [Rhodobacter sphaeroides KD131]
 gi|332274502|gb|EGJ19818.1| integral membrane protein [Rhodobacter sphaeroides WS8N]
          Length = 237

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 150/237 (63%), Gaps = 19/237 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GLRA+M+R+YN M LGL +TG+++ LV        P                   +++
Sbjct: 20  DDGLRAHMLRIYNYMGLGLALTGLVAVLVAATPAIYVP-------------------IFS 60

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           +PL+W+ + APL   +FL+ R+ ++SA  A+M+F  +  ++GLSL+S FLV+T  SI + 
Sbjct: 61  TPLKWVVMLAPLAFVLFLSFRIEAISAGTAQMLFWAFCGVMGLSLASIFLVFTGTSIARA 120

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FF  AA F  +SLYGYTTKRDL   GSF++MG  G+ L S++NLF+ SSA+   +S +G+
Sbjct: 121 FFGAAAMFAGMSLYGYTTKRDLSQFGSFLMMGLIGVILASVINLFLGSSALQFAISIIGI 180

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++F  LTA+DTQ IK  Y++  D   +++ +V+GAL LY++FI IF  LL   G R 
Sbjct: 181 LVFVGLTAWDTQAIKLQYAEHQDSETSQKLAVMGALSLYLNFINIFQLLLSLTGERE 237


>gi|159045319|ref|YP_001534113.1| hypothetical protein Dshi_2779 [Dinoroseobacter shibae DFL 12]
 gi|157913079|gb|ABV94512.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 240

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 161/257 (62%), Gaps = 23/257 (8%)

Query: 6   NYQRVVNSGSGF-GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASI 64
            Y  +  +G+G   + ID+GLRA+  +VY LM++ + +TG +++ V              
Sbjct: 3   QYDTIRTAGAGVRTAQIDEGLRAHFNKVYGLMSVAMVLTGAVAWAVGT------------ 50

Query: 65  IINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGL 124
             N  ++     A ++ +P++W+ +FAPL +    +  ++ +SA AA++ F  ++A +GL
Sbjct: 51  --NEAML-----AAIFATPMKWVVMFAPLIMVFAFSAMINKMSAAAAQVFFYTFAAAMGL 103

Query: 125 SLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN 184
           S+S  F VYT  SI  TF +TA +F SLSL+GYTTK+DL   G F+ MG  GL + S++N
Sbjct: 104 SISFIFAVYTGVSIASTFLVTAIAFASLSLFGYTTKKDLSSWGRFLFMGVIGLIVASIIN 163

Query: 185 LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYM 241
           LF+ S AI   +S++G++IF+ALTAYDTQ+IK  Y +     D  +  + +++GAL LY+
Sbjct: 164 LFLGSPAIAFAVSSLGVLIFAALTAYDTQRIKTEYIEHAQYGDQEWLNKSAIMGALSLYI 223

Query: 242 DFIQIFVHLLRFLGSRR 258
           +FI +F+ LL+FLG+R 
Sbjct: 224 NFINLFMFLLQFLGNRE 240


>gi|88608506|ref|YP_505951.1| putative membrane proetin [Neorickettsia sennetsu str. Miyayama]
 gi|88600675|gb|ABD46143.1| putative membrane proetin [Neorickettsia sennetsu str. Miyayama]
          Length = 251

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 97/239 (40%), Positives = 149/239 (62%), Gaps = 21/239 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           ++GLR YM++V+N MA  LG+TG+ +F V                +   ML+    L+Y 
Sbjct: 32  NEGLRMYMVKVFNYMAAALGITGLTAFFVA---------------SSPAMLS----LLYQ 72

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           +PL+W+ +FAP+   I  + R+  +++  AK++F  +S L+GLSLS  F+ YT  SI + 
Sbjct: 73  TPLQWVVMFAPVVFVIVFSTRISGMTSERAKVLFWCFSVLMGLSLSWVFIAYTGASIARV 132

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FFI A  FG++++YG  T+ DL  +GSF+ MG  G+ + +LVN+F+ S AI   +SA+G+
Sbjct: 133 FFIAATMFGAMAIYGNNTRTDLTGMGSFLTMGVVGILIAALVNVFLASPAIYFAVSALGV 192

Query: 202 VIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           VIF+ LTAYD Q+I++ Y  S   D     + +V+GAL LY DFI IF+ LL  +G R+
Sbjct: 193 VIFTGLTAYDVQRIRDFYYFSVNADEETLSKIAVVGALTLYFDFINIFISLLNLMGERK 251


>gi|77462433|ref|YP_351937.1| hypothetical protein RSP_1889 [Rhodobacter sphaeroides 2.4.1]
 gi|126461310|ref|YP_001042424.1| hypothetical protein Rsph17029_0536 [Rhodobacter sphaeroides ATCC
           17029]
 gi|332560317|ref|ZP_08414639.1| hypothetical protein RSWS8N_14690 [Rhodobacter sphaeroides WS8N]
 gi|77386851|gb|ABA78036.1| conserved hypothetical membrane protein [Rhodobacter sphaeroides
           2.4.1]
 gi|126102974|gb|ABN75652.1| protein of unknown function UPF0005 [Rhodobacter sphaeroides ATCC
           17029]
 gi|332278029|gb|EGJ23344.1| hypothetical protein RSWS8N_14690 [Rhodobacter sphaeroides WS8N]
          Length = 246

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 107/261 (40%), Positives = 159/261 (60%), Gaps = 25/261 (9%)

Query: 6   NYQRVVNSGSGF-GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLV----NILATTVDPD 60
           +YQ V + G+G   + ID+GLRA+M +VY LM++G+ +TG +++       + +   DP 
Sbjct: 3   DYQTVRSVGAGARAARIDEGLRAHMNKVYGLMSVGMLLTGGVAWAFGTSEQLFSLLRDP- 61

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                             M  + L WI +FAPL +       L+ LS  AA++ F  Y+A
Sbjct: 62  ----------------VTMSPNILGWIVMFAPLIMVFAFGAVLNRLSQAAAQLFFYAYAA 105

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           ++GLSLS  F+ +T  SI QTF ITA +F SLSL+GYTTK+DL   G+F+IMG  GL + 
Sbjct: 106 VMGLSLSWIFVAFTGVSIAQTFLITAIAFASLSLFGYTTKKDLSGFGTFLIMGVVGLLVA 165

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGAL 237
            +VN+F+ SSA+   +S +G++IF+ LTAYDTQ IK  Y        AE   + +++GAL
Sbjct: 166 MVVNIFLASSALAFAISVIGVLIFAGLTAYDTQNIKNTYLQHAHTGDAEWLGKAAIMGAL 225

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY+DFI +F+ LL+F+G+R 
Sbjct: 226 QLYLDFINLFMFLLQFMGNRE 246


>gi|221638296|ref|YP_002524558.1| hypothetical protein RSKD131_0197 [Rhodobacter sphaeroides KD131]
 gi|221159077|gb|ACM00057.1| Hypothetical Protein RSKD131_0197 [Rhodobacter sphaeroides KD131]
          Length = 246

 Score =  177 bits (450), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 106/261 (40%), Positives = 160/261 (61%), Gaps = 25/261 (9%)

Query: 6   NYQRVVNSGSGF-GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLV----NILATTVDPD 60
           +YQ V + G+G   + ID+GLRA+M +VY LM++G+ +TG +++       + +   DP 
Sbjct: 3   DYQTVRSVGAGARAARIDEGLRAHMNKVYGLMSVGMLLTGGVAWAFGTSEQLFSLLRDP- 61

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                             M  + L WI +FAPL +       L+ LS  AA++ F  Y+A
Sbjct: 62  ----------------VTMSPNILGWIVMFAPLIMVFAFGAVLNRLSQAAAQLFFYAYAA 105

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           ++GLSLS  F+ +T  SI QTF ITA +F SLSL+GYTTK+DL   G+F+IMG  GL + 
Sbjct: 106 VMGLSLSWIFVAFTGVSIAQTFLITAIAFASLSLFGYTTKKDLSGFGTFLIMGVVGLLVA 165

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGAL 237
            +VN+F+ SSA+   +S +G++IF+ LTAYDTQ IK  Y   +   D  +  + +++GAL
Sbjct: 166 MVVNIFLASSALAFAISVIGVLIFAGLTAYDTQNIKNTYLQHAHTGDEEWLGKAAIMGAL 225

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY+DFI +F+ LL+F+G+R 
Sbjct: 226 QLYLDFINLFMFLLQFMGNRE 246


>gi|146279688|ref|YP_001169846.1| hypothetical protein Rsph17025_3673 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557929|gb|ABP72541.1| hypothetical protein Rsph17025_3673 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 236

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 152/237 (64%), Gaps = 19/237 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D+GLRA+M+R+YN M LGL +TG+++ +V        P                   +++
Sbjct: 19  DEGLRAHMLRIYNYMGLGLALTGLVAVVVAATPAIYVP-------------------IFS 59

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           +PL+W+ + APL   +FL+ R+ ++SA  A+M+F  +  ++GLSL+S FLV+T  SI + 
Sbjct: 60  TPLKWVVMLAPLAFVLFLSFRIEAISAGTAQMLFWAFCGVMGLSLASIFLVFTGTSIARA 119

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FF  AA F  +SLYGYTTKRDL   GSF++MG  G+ + S++NLF+ SSA+   +S +G+
Sbjct: 120 FFGAAAMFAGMSLYGYTTKRDLSQFGSFLMMGLIGVIIASVINLFLGSSALQFAISIIGI 179

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++F  LTA+DTQ IK  Y++ +D   +++ +V+GAL LY++FI IF  LL   G R 
Sbjct: 180 LVFVGLTAWDTQSIKLQYAEHHDSETSQKLAVMGALSLYLNFINIFQLLLSLTGERE 236


>gi|88607665|ref|YP_505848.1| hypothetical protein APH_1345 [Anaplasma phagocytophilum HZ]
 gi|88598728|gb|ABD44198.1| putative membrane protein [Anaplasma phagocytophilum HZ]
          Length = 233

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 96/237 (40%), Positives = 145/237 (61%), Gaps = 21/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GLR+Y++RVYN MAL LG+TG ++F+ ++                     G  A +Y +P
Sbjct: 16  GLRSYLVRVYNYMALALGITGAVAFIASLSG-------------------GLMAAIYGTP 56

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           L W+   AP+     ++ R+H +S     M+FL +SA++GLSLS  F+VYTS SI + FF
Sbjct: 57  LHWVVSLAPVITVFVMSARVHQMSYQTMMMVFLGFSAMMGLSLSYVFMVYTSHSIARVFF 116

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           I++A FG+++ YG TTKRDL    +F+ MG  GL + S+VNLFMRS  +   +S + +++
Sbjct: 117 ISSAMFGTMAWYGNTTKRDLSKFSTFLTMGVVGLIIASVVNLFMRSGPLYFAISVVAVLV 176

Query: 204 FSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F+ALTA + Q+IK+ Y   +  D     + S++GA  LY  +I IFVH+L  +G RR
Sbjct: 177 FTALTAVNAQEIKDMYYRFNDGDSNTVGKMSILGATSLYFSYINIFVHMLHLMGDRR 233


>gi|148553772|ref|YP_001261354.1| hypothetical protein Swit_0849 [Sphingomonas wittichii RW1]
 gi|148498962|gb|ABQ67216.1| protein of unknown function UPF0005 [Sphingomonas wittichii RW1]
          Length = 242

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 103/240 (42%), Positives = 154/240 (64%), Gaps = 20/240 (8%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D GLR+YM+ +YN MA G+ +TGI++ L                       +G  A 
Sbjct: 23  AAFDAGLRSYMLSIYNYMASGVLLTGIVALLFAE--------------------SGLAAQ 62

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           ++ +PLRW+ + APL   + L+  ++ LS  AA+ +F  ++A++GLS+SS FL YT  SI
Sbjct: 63  LFVTPLRWLIVLAPLAFIMVLSFGINKLSTTAAQGLFWAFAAVMGLSMSSLFLAYTGSSI 122

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
             TFF TA +F +LSL+GYTTK+DL   G+F+IMG  GL + SL+N+F +S A++L +SA
Sbjct: 123 AITFFATATAFAALSLWGYTTKKDLSGFGTFLIMGVVGLLVASLLNIFFKSPALNLAISA 182

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +G+++F+ LTAYDTQKIK  Y       +A +  V+GAL LY+DF+ +F  LL+F+G RR
Sbjct: 183 IGVLLFAGLTAYDTQKIKSMYFYVAGTDFAGKAVVMGALTLYLDFVNMFTFLLQFMGDRR 242


>gi|83949853|ref|ZP_00958586.1| hypothetical protein ISM_02125 [Roseovarius nubinhibens ISM]
 gi|83837752|gb|EAP77048.1| hypothetical protein ISM_02125 [Roseovarius nubinhibens ISM]
          Length = 239

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 156/243 (64%), Gaps = 22/243 (9%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + ID+GLRA+M +VY  M++G+    +++FL           AA  + N   M+     +
Sbjct: 16  AAIDEGLRAHMSKVYGTMSVGM----LLTFL-----------AAWAVGNNAAMME----V 56

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           ++T   R+I +FAPL +       ++ LSA AA++ F  ++AL+G+S+S  F+V+T  SI
Sbjct: 57  LFTGFTRYIVMFAPLIMVFAFGAVINRLSAAAAQLFFYAFAALMGVSISYIFVVFTDMSI 116

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            Q FF TAA+FG LSL+GYTTK+D+   GSF+IMG  GL + S+VN+F+ S  + + +SA
Sbjct: 117 AQVFFATAAAFGGLSLWGYTTKKDISGWGSFLIMGVIGLIVASIVNIFLGSGVVSMAISA 176

Query: 199 MGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           +G++IF+ LTAYDTQ IK    A++   D  +  + +++GAL LY++FI +F+ LL  LG
Sbjct: 177 IGVLIFAGLTAYDTQNIKNTYIAHAAHGDSEWLGKSAIMGALNLYLNFINMFMMLLNLLG 236

Query: 256 SRR 258
           SR 
Sbjct: 237 SRE 239


>gi|239946543|ref|ZP_04698298.1| aspartyl-tRNA synthetase [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239946598|ref|ZP_04698352.1| aspartyl-tRNA synthetase [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239920819|gb|EER20845.1| aspartyl-tRNA synthetase [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239920874|gb|EER20899.1| aspartyl-tRNA synthetase [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 236

 Score =  175 bits (444), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 142/237 (59%), Gaps = 19/237 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D+GLR +M++VYNLMA  L +TG                 A I I+     T    LM+ 
Sbjct: 16  DEGLRQFMLKVYNLMAAALLLTG---------------STAIITISW----TPLANLMFN 56

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + +  I  FAPL + ++       LS   A+++F +Y+ L+G+SLS  FL+YT+ SI +T
Sbjct: 57  TAVGSIIAFAPLAIALYFFFGFSKLSIQLAQILFWIYAVLVGMSLSYLFLIYTAVSIART 116

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FFI AA FG +SLYGY T +DL   GSF +MG  GL L SL+NLF++S A+    S +G+
Sbjct: 117 FFICAAVFGMMSLYGYNTNKDLTSWGSFFLMGLVGLLLTSLINLFLQSPAVYFASSFLGV 176

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +IF  L  +DTQKIK  Y    D   A++ S++ A  LY+DFI +F+HL+RFLG  +
Sbjct: 177 IIFIGLIVWDTQKIKSFYFTNTDNHLAQKMSIVAAFNLYLDFINLFLHLIRFLGGYK 233


>gi|94497519|ref|ZP_01304088.1| hypothetical protein SKA58_08389 [Sphingomonas sp. SKA58]
 gi|94422936|gb|EAT07968.1| hypothetical protein SKA58_08389 [Sphingomonas sp. SKA58]
          Length = 248

 Score =  175 bits (443), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 111/248 (44%), Positives = 158/248 (63%), Gaps = 18/248 (7%)

Query: 12  NSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVM 71
           N+ +  G   D GLR YM+ VYN MA G+ +TGI++ L           A  ++   G+ 
Sbjct: 19  NATAARGEAFDAGLRRYMLSVYNYMASGVLLTGIVALLF-----ASSGLAYQVLAGPGI- 72

Query: 72  LTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFL 131
                       L++I +FAPL   + L+  ++ LS   A+ ++ +Y+A++GLSLSS FL
Sbjct: 73  ------------LKYIIMFAPLAFVMVLSFGINRLSTATAQALYWVYAAVMGLSLSSIFL 120

Query: 132 VYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSA 191
           VYT  SI QTFF TAA+F  LSL+GYTTK+DL   G+F+IMG  GL + SL+NLF+RSSA
Sbjct: 121 VYTGTSIAQTFFATAAAFAGLSLWGYTTKKDLSGFGTFLIMGVVGLLVASLINLFLRSSA 180

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLL 251
           +DL +S +G+++F+ LTAYDTQKIK  Y+         +  ++GAL LY+DFI +F+ LL
Sbjct: 181 MDLVISFLGVLLFAGLTAYDTQKIKSIYAHVAGTDMMGKSVIMGALNLYLDFINMFLFLL 240

Query: 252 RFLGSRRD 259
           RF+G  RD
Sbjct: 241 RFMGGSRD 248


>gi|241072382|ref|XP_002408639.1| conserved hypothetical protein [Ixodes scapularis]
 gi|241683526|ref|XP_002411642.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215492535|gb|EEC02176.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215504405|gb|EEC13899.1| conserved hypothetical protein [Ixodes scapularis]
          Length = 239

 Score =  175 bits (443), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 142/237 (59%), Gaps = 19/237 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D+GLR +M++VYNLMA  L +TG                 A I I+     T    LM+ 
Sbjct: 19  DEGLRQFMLKVYNLMAAALLLTG---------------STAIITISW----TPLANLMFN 59

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + +  I  FAPL + ++       LS   A+++F +Y+ L+G+SLS  FL+YT+ SI +T
Sbjct: 60  TAVGSIIAFAPLAIALYFFFGFSKLSIQLAQILFWIYAVLVGMSLSYLFLIYTAVSIART 119

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FFI AA FG +SLYGY T +DL   GSF +MG  GL L SL+NLF++S A+    S +G+
Sbjct: 120 FFICAAVFGMMSLYGYNTNKDLTSWGSFFLMGLVGLLLTSLINLFLQSPAVYFASSFLGV 179

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +IF  L  +DTQKIK  Y    D   A++ S++ A  LY+DFI +F+HL+RFLG  +
Sbjct: 180 IIFIGLIVWDTQKIKSFYFTNTDNHLAQKMSIVAAFNLYLDFINLFLHLIRFLGGYK 236


>gi|83594887|ref|YP_428639.1| hypothetical protein Rru_A3558 [Rhodospirillum rubrum ATCC 11170]
 gi|83577801|gb|ABC24352.1| Protein of unknown function UPF0005 [Rhodospirillum rubrum ATCC
           11170]
          Length = 250

 Score =  175 bits (443), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 150/247 (60%), Gaps = 10/247 (4%)

Query: 12  NSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVM 71
            +G    + +D GLR YM+RVYN +A GL ++G+++     ++    P +A+        
Sbjct: 14  QAGVATDAQVDAGLRTYMLRVYNYLASGLALSGVIA-----MSVVYTPLSAAFY-----Q 63

Query: 72  LTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFL 131
           ++  G LM  + L  I +FAPLG+          +SA A++M +  + AL G+SLS+  L
Sbjct: 64  VSPEGQLMGLNMLGMIAVFAPLGLLFLAMFAAQKMSAAASQMFYWAFVALQGVSLSTLLL 123

Query: 132 VYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSA 191
           VYT +SIV+ FFITA +F +LSLYGYTTKRDL   G F+ MG  G+ L ++VN+F+ SS 
Sbjct: 124 VYTGESIVRVFFITAGTFAALSLYGYTTKRDLAGFGKFLFMGLIGMLLAAVVNIFLGSSM 183

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLL 251
           +   +SA+G+++FS L AYDTQ IKE Y D        + +V  AL LY++FI +   LL
Sbjct: 184 LQFVVSAVGVLVFSGLIAYDTQAIKERYYDGLGRDSETKMAVFSALALYLNFINLLQFLL 243

Query: 252 RFLGSRR 258
            FLG+R 
Sbjct: 244 YFLGNRE 250


>gi|260574587|ref|ZP_05842590.1| protein of unknown function UPF0005 [Rhodobacter sp. SW2]
 gi|259023004|gb|EEW26297.1| protein of unknown function UPF0005 [Rhodobacter sp. SW2]
          Length = 246

 Score =  174 bits (442), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 102/261 (39%), Positives = 161/261 (61%), Gaps = 25/261 (9%)

Query: 6   NYQRVVNSGSGF-GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLV----NILATTVDPD 60
            Y  + + G+G   + ID GLRA+M +VY LM++G+ +TG +++ V     +L+   +P+
Sbjct: 3   EYDTIRSVGAGARAAQIDAGLRAHMNKVYGLMSVGMLLTGGVAWAVGTSDTLLSILRNPE 62

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                             M  + L WI +FAPL +       ++ LS  AA++ F  Y+A
Sbjct: 63  T-----------------MQPNLLGWIVMFAPLIMVFAFGALINRLSVAAAQLFFYAYAA 105

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           ++GLSL+  F V+T  SI QTF +T+ +F  LSLYGYTTKR+L  +G+F++MG  GL + 
Sbjct: 106 VMGLSLAWIFAVFTGVSIAQTFLVTSIAFAGLSLYGYTTKRNLSAMGTFLMMGLIGLLVA 165

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGAL 237
            +VN+F+ SSA+   +S +G++IF+ALTAYDTQ IK  Y   +   D  +  + +++GAL
Sbjct: 166 MVVNIFVASSALAFAISVIGVLIFAALTAYDTQTIKNTYLQHAQAGDQEWLGKAAIMGAL 225

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY+DFI +F+ LL+F+G+R 
Sbjct: 226 QLYLDFINMFMFLLQFMGNRE 246


>gi|85373196|ref|YP_457258.1| integral membrane protein [Erythrobacter litoralis HTCC2594]
 gi|84786279|gb|ABC62461.1| integral membrane protein [Erythrobacter litoralis HTCC2594]
          Length = 248

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 147/244 (60%), Gaps = 26/244 (10%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +T D GLR YM+ +YN MA G+ +TGI++                       MLT    L
Sbjct: 28  TTFDAGLRKYMLSIYNYMASGILLTGIIA-----------------------MLTANSGL 64

Query: 79  MYT---SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTS 135
            Y+    P+ WI   +PL +   ++  ++  S    + M+  ++ L+GLSLS+ FLVYT 
Sbjct: 65  AYSFASGPMMWIVALSPLAIVFAMSFGMNKFSKGTLQAMYWGFAVLMGLSLSTIFLVYTG 124

Query: 136 KSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLT 195
            SI  TFF TA +F  LSL+GYTT++DL   GSF+IMG  GL + S++N+F++S A+   
Sbjct: 125 ASIAVTFFATAGAFAGLSLFGYTTQKDLSGWGSFLIMGVVGLIIASVINIFLQSEALMWA 184

Query: 196 MSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           +S +G++IF+ LTAYDTQK+K  YS        ++  ++GAL LY+DFI +F+ LLRF+G
Sbjct: 185 VSFLGVLIFAGLTAYDTQKLKNIYSSVRGTPMMDKVVIMGALNLYLDFINMFLFLLRFMG 244

Query: 256 SRRD 259
           + R+
Sbjct: 245 ATRE 248


>gi|56417258|ref|YP_154332.1| hypothetical protein AM1276 [Anaplasma marginale str. St. Maries]
 gi|222475622|ref|YP_002564039.1| hypothetical protein AMF_964 [Anaplasma marginale str. Florida]
 gi|254995427|ref|ZP_05277617.1| hypothetical protein AmarM_05848 [Anaplasma marginale str.
           Mississippi]
 gi|255003615|ref|ZP_05278579.1| hypothetical protein AmarPR_05318 [Anaplasma marginale str. Puerto
           Rico]
 gi|255004744|ref|ZP_05279545.1| hypothetical protein AmarV_05698 [Anaplasma marginale str.
           Virginia]
 gi|56388490|gb|AAV87077.1| hypothetical protein AM1276 [Anaplasma marginale str. St. Maries]
 gi|222419760|gb|ACM49783.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 233

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/244 (38%), Positives = 154/244 (63%), Gaps = 23/244 (9%)

Query: 18  GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
           G+    GLR+Y+++VYN MA  LG+TG+++ + +               + G+M     +
Sbjct: 10  GAYYCAGLRSYLVKVYNYMAAALGLTGVVALMTSF--------------SHGLM-----S 50

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           ++Y +PL W+   AP+ +  FL+ R+HS+S  A   +F  ++A +GLSLS  F+VYT+ S
Sbjct: 51  VLYGTPLHWVVSLAPIVMVFFLSSRVHSMSVQAVFAVFFGFAATMGLSLSYMFMVYTAHS 110

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           I + FFI++A FG ++ YG TTKRDL   G+F+IMG  G+ + S+VN+FM S  +   +S
Sbjct: 111 IARVFFISSAMFGVMAFYGNTTKRDLSKFGTFLIMGVVGILIASVVNIFMASGPLHFAIS 170

Query: 198 AMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
            + +V+F+A+TA+D Q+IK+ Y   +D  +V  + + +V+GA  LY ++I IF+ LL  +
Sbjct: 171 VVAVVVFTAMTAFDAQRIKDMYYRFNDGSEVT-SSKMAVMGATSLYFNYINIFLSLLHLM 229

Query: 255 GSRR 258
           G RR
Sbjct: 230 GDRR 233


>gi|294013313|ref|YP_003546773.1| putative integral membrane protein [Sphingobium japonicum UT26S]
 gi|292676643|dbj|BAI98161.1| putative integral membrane protein [Sphingobium japonicum UT26S]
          Length = 236

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 152/255 (59%), Gaps = 19/255 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + N  R+   G+   +  D GLRA+M+ V+  M +GL +TG++               A+
Sbjct: 1   MNNPVRMPGYGASQTAQTDAGLRAHMLGVFRNMGIGLVITGLV---------------AA 45

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
            I N  V+     A ++ +PL+W+ IFAPL    F + R+  ++   A+M F  +SA++G
Sbjct: 46  FIGNTPVL----AAAIFGTPLKWVAIFAPLAFVFFFSFRIEKMTTAGARMAFYAFSAVMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +SL+S FLV+T  SI Q FF  A  F +++L+GYTT RDL   GSF+IMG  G+ + SL+
Sbjct: 102 VSLASIFLVFTGGSIAQAFFSAAVMFLAMALWGYTTGRDLSKFGSFLIMGLIGILVASLI 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F+ SSA+ + +S +G+V+F+ LTA+D Q+IK  Y        A++  V+GAL LY++F
Sbjct: 162 NIFIGSSAMQMVISIIGVVVFTGLTAWDVQRIKSEYFAYAGHEVAQKMQVMGALSLYLNF 221

Query: 244 IQIFVHLLRFLGSRR 258
           + +F  LL   G R 
Sbjct: 222 VNLFQMLLSLTGERE 236


>gi|307295118|ref|ZP_07574960.1| protein of unknown function UPF0005 [Sphingobium chlorophenolicum
           L-1]
 gi|306879592|gb|EFN10810.1| protein of unknown function UPF0005 [Sphingobium chlorophenolicum
           L-1]
          Length = 269

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 153/257 (59%), Gaps = 19/257 (7%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA 61
           + + N  R+   G+   +  D GLRA+M+ V+  M +GL +TG++               
Sbjct: 32  NAVNNPVRMPGYGASQTAQTDAGLRAHMLGVFRNMGIGLVITGLV--------------- 76

Query: 62  ASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
           A+ I N  V+     A ++ +PL+W+ IFAPL    F + R+  ++   A+M F  +SA+
Sbjct: 77  AAFIGNTPVL----AAAIFGTPLKWVAIFAPLAFVFFFSFRMEKMTTAGARMAFYAFSAV 132

Query: 122 IGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS 181
           +G+SL+S FLV+T  SI Q FF  A  F +++L+GYTT RDL   GSF+IMG  G+ + S
Sbjct: 133 MGVSLASIFLVFTGGSIAQAFFSAAVMFLAMALWGYTTGRDLSKFGSFLIMGLIGILVAS 192

Query: 182 LVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYM 241
           L+N+F+ SSA+ + +S +G+V+F+ LTA+D Q+IK  Y        A++  V+GAL LY+
Sbjct: 193 LINIFIGSSAMQMVISIIGVVVFTGLTAWDVQRIKSEYFYYAGHEVAQKMQVMGALSLYL 252

Query: 242 DFIQIFVHLLRFLGSRR 258
           +F+ +F  LL   G R 
Sbjct: 253 NFVNLFQMLLSLTGERE 269


>gi|294011230|ref|YP_003544690.1| putative integral membrane protein [Sphingobium japonicum UT26S]
 gi|292674560|dbj|BAI96078.1| putative integral membrane protein [Sphingobium japonicum UT26S]
          Length = 245

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 157/242 (64%), Gaps = 18/242 (7%)

Query: 18  GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
           G   D GLR+YM+ VYN MA G+ +TG+++ L           A  I+   G+       
Sbjct: 22  GEAYDAGLRSYMLSVYNYMASGVLLTGVVAMLF-----ASSGLAYQILAGPGI------- 69

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
                 L+++ +FAPL   + ++  ++ LS +A + MF  Y+A++GLSLSS  LVYT  S
Sbjct: 70  ------LKYVIMFAPLLFVMTMSFGINRLSTFAMQAMFWAYAAVMGLSLSSILLVYTGTS 123

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           + QTFF TAA+F  LSL+GYTTKRDL   G+F+IMG  GL + SL+NLF+RSSA++L +S
Sbjct: 124 VAQTFFATAAAFAGLSLWGYTTKRDLSGFGTFLIMGVVGLLVASLINLFLRSSAMNLVIS 183

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            +G+++F+ LTAYDTQKIK  Y+         +  V+GAL LY+DFI +F+ LLRF+GS+
Sbjct: 184 FIGVLLFAGLTAYDTQKIKSIYAHVAGTDMMGKSVVMGALNLYLDFINMFLFLLRFMGSQ 243

Query: 258 RD 259
           RD
Sbjct: 244 RD 245


>gi|88657820|ref|YP_506844.1| hypothetical protein ECH_0009 [Ehrlichia chaffeensis str. Arkansas]
 gi|88599277|gb|ABD44746.1| putative membrane protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 233

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 92/244 (37%), Positives = 149/244 (61%), Gaps = 23/244 (9%)

Query: 18  GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
           G+    GLR Y+++VYN MA+ LG+TGI++F V        P   S++            
Sbjct: 10  GAYYSAGLRNYLVKVYNYMAMALGLTGIVAFFV-----ASSPAVISMV------------ 52

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
             Y +PL W+ +FAP+G+   ++ +L+ LS  A  M+F  ++AL+G+S+S  FLVYT+ S
Sbjct: 53  --YNTPLHWVIVFAPMGLVFLMSYKLNVLSFQAILMIFFSFAALVGVSISYVFLVYTAAS 110

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           I + FFI+++ FG ++ YG  TK+DL   G+F+ MG  G+ + SLVNLF+ S  +   +S
Sbjct: 111 IAKVFFISSSMFGVMAWYGNVTKKDLSQFGTFLFMGVIGIAIASLVNLFLGSGPLHFALS 170

Query: 198 AMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
            + +V+F+ +TAYD Q+IK+ Y   +D  D +   + +++GA  LY ++I IF+ LL   
Sbjct: 171 VVAVVVFTGMTAYDAQRIKDMYYKFNDGTDSS-VNKMAILGATTLYFNYINIFISLLNLQ 229

Query: 255 GSRR 258
           G R+
Sbjct: 230 GERK 233


>gi|94495839|ref|ZP_01302418.1| Predicted integral membrane protein [Sphingomonas sp. SKA58]
 gi|94424531|gb|EAT09553.1| Predicted integral membrane protein [Sphingomonas sp. SKA58]
          Length = 236

 Score =  171 bits (434), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 150/255 (58%), Gaps = 19/255 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + N  R+   G+      D GLRA+M+ V+  M LGL +TG+++ LV        P  A+
Sbjct: 1   MNNPVRMPGYGASRSVDTDAGLRAHMLGVFRNMGLGLVITGLVAALVG-----NTPALAA 55

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
            I              Y +PL+W+ IFAPL    F + R+  ++   A+  F  ++A++G
Sbjct: 56  AI--------------YGTPLKWVAIFAPLAFVFFFSFRIEKMTTAGARTAFYAFAAVMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +SL S FLV+T  SI Q FF  A  F +++L+GYTT+RDL  +GSF+IMG  G+ + SL+
Sbjct: 102 VSLGSVFLVFTGGSIAQAFFSAAVMFLAMALWGYTTQRDLTKMGSFLIMGLIGIIVASLI 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           NLF+ SSA+ + +S +G+V+F+ LTA+D Q+IK  Y        A++  V+GAL LY++F
Sbjct: 162 NLFIGSSAMAMVISIIGVVVFTGLTAWDVQRIKSEYFYYAGHEVAQKMQVMGALSLYLNF 221

Query: 244 IQIFVHLLRFLGSRR 258
           + +F  LL   G R 
Sbjct: 222 VNLFQMLLSLTGERE 236


>gi|103486304|ref|YP_615865.1| hypothetical protein Sala_0813 [Sphingopyxis alaskensis RB2256]
 gi|98976381|gb|ABF52532.1| protein of unknown function UPF0005 [Sphingopyxis alaskensis
           RB2256]
          Length = 242

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 108/262 (41%), Positives = 158/262 (60%), Gaps = 27/262 (10%)

Query: 4   IRNYQRVVNSGSGFGS-------TIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATT 56
           + N+     + SGFG+        +D GLR+YM+ VYN MA G+ +TGI++ L       
Sbjct: 1   MANWNDPNMAASGFGAGANAMDQAVDAGLRSYMLSVYNYMASGVLLTGIVALLA------ 54

Query: 57  VDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFL 116
                           +GF A +  SPL W+ + APL   + L+  ++ LS  AA+ +F 
Sbjct: 55  --------------FQSGFTASLIGSPLMWVVMLAPLAFVLVLSFGINKLSTPAAQAIFW 100

Query: 117 LYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFG 176
           +Y+A++GLS+S+ FL +T+ SI  TFF TAA+F  LSLYGYTTK+DL   G+F+IMG  G
Sbjct: 101 VYAAVMGLSMSTIFLAFTATSIATTFFATAAAFLGLSLYGYTTKKDLSGFGTFLIMGVVG 160

Query: 177 LFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGA 236
           + +  L+N F++SSA+   +S +G++IF+ LTAYDTQKIK  Y       +  +  V+GA
Sbjct: 161 ILVAMLINFFVQSSALATAISVIGVLIFAGLTAYDTQKIKSMYFYVRGTDFVGKSVVMGA 220

Query: 237 LMLYMDFIQIFVHLLRFLGSRR 258
           L LY+DF+ +F  LL  LGSR 
Sbjct: 221 LSLYLDFVNMFTFLLNLLGSRE 242


>gi|307294288|ref|ZP_07574132.1| protein of unknown function UPF0005 [Sphingobium chlorophenolicum
           L-1]
 gi|306880439|gb|EFN11656.1| protein of unknown function UPF0005 [Sphingobium chlorophenolicum
           L-1]
          Length = 245

 Score =  170 bits (430), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 109/242 (45%), Positives = 155/242 (64%), Gaps = 18/242 (7%)

Query: 18  GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
           G   D GLR+YM+ VYN MA G+ +TG+++ L           A  I+   G+       
Sbjct: 22  GEAYDAGLRSYMLSVYNYMASGVLLTGVVAMLF-----ASSGLAHQILAGPGI------- 69

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
                 L+++ +FAPL   + ++  ++ LS +A + MF  Y+A++GLSLSS  LVYT  S
Sbjct: 70  ------LKYVIMFAPLLFVMTMSFGINRLSTFAMQAMFWAYAAVMGLSLSSVLLVYTGTS 123

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           + QTFF TAA+F  LSL+GYTTKRDL   G+F+IMG  GL + SL+NLF RSSA+ + +S
Sbjct: 124 VAQTFFATAAAFAGLSLWGYTTKRDLSAFGTFLIMGVVGLLVASLINLFFRSSAMSMVIS 183

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            +G+++F+ LTAYDTQKIK  Y+         +  V+GAL LY+DFI +F+ LLRF+GS+
Sbjct: 184 FIGVLLFAGLTAYDTQKIKSIYAYVAGTDMMGKSVVMGALNLYLDFINMFLFLLRFMGSQ 243

Query: 258 RD 259
           RD
Sbjct: 244 RD 245


>gi|189183170|ref|YP_001936955.1| hypothetical protein OTT_0263 [Orientia tsutsugamushi str. Ikeda]
 gi|189179941|dbj|BAG39721.1| hypothetical protein OTT_0263 [Orientia tsutsugamushi str. Ikeda]
          Length = 246

 Score =  170 bits (430), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 157/254 (61%), Gaps = 11/254 (4%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +Y R  + G     +ID+GLRAYM+R+YNLMA+ L +T +        AT      A ++
Sbjct: 3   DYTRAYSGG--VHKSIDEGLRAYMLRIYNLMAMALFITAVAG-----TATFSLEPLARLM 55

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
            N     +  G ++  +P+  +   AP+G+ ++    +  L    A+ +F +Y+ L+G+S
Sbjct: 56  FN----FSPNGYVIGQTPIGLLVNVAPIGIALYFFWGIGRLDISTAQTLFWVYAVLVGMS 111

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LS+   +YT +S+V +FFITA++F ++S+YG+TT+RDL  +GS +IMG +G+ + SLVN+
Sbjct: 112 LSALGYIYTGESLVSSFFITASAFAAMSIYGHTTQRDLTSLGSLLIMGLWGIIISSLVNI 171

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F+ S AI    S +G+ IF  L A+DTQK+K  Y         ++ +V+GA  LY+DF+ 
Sbjct: 172 FLGSPAIHFATSVLGVGIFMGLIAWDTQKLKHIYYSSGGGELGQKLAVVGAFTLYLDFLN 231

Query: 246 IFVHLLRFLGSRRD 259
           +F+++LRF G+RR 
Sbjct: 232 LFLYVLRFFGNRRK 245


>gi|148240975|ref|YP_001220476.1| hypothetical protein BBta_p0129 [Bradyrhizobium sp. BTAi1]
 gi|146411351|gb|ABQ39804.1| putative membrane protein of unknown function with BL1 family,
           ybhL-like domain [Bradyrhizobium sp. BTAi1]
          Length = 241

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 101/243 (41%), Positives = 153/243 (62%), Gaps = 21/243 (8%)

Query: 18  GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
           G+ ID GLR +++ VYN M  GL +TG++++                    G   TG  A
Sbjct: 19  GAEIDAGLRQFLLSVYNYMGAGLVLTGVVAY--------------------GAAETGLYA 58

Query: 78  LMYTSPLR-WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK 136
            +  +PL  W+ + APL     L+ R+  +   AA+  F  Y+ L+GLSL+  FL+YT  
Sbjct: 59  SLVQTPLLFWVIVLAPLAPVFLLSFRIEKMGLGAAQTAFWTYAGLVGLSLAGIFLMYTGV 118

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTM 196
           SI +TFFITAA+F ++SLYGYTT+ DL   GSF+++G FG+ +  +VNLF+ SSA+ L +
Sbjct: 119 SIARTFFITAATFLAMSLYGYTTRADLARFGSFLMLGLFGIIIAGVVNLFLASSALQLAI 178

Query: 197 SAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           S +G+++F  LTAYDTQ+IKE Y    + A A +++++GAL LY+DF+ +F+ LL+  G+
Sbjct: 179 SVIGVIVFVGLTAYDTQRIKEIYLASDNSAVAGKKAIMGALALYLDFLNLFILLLQLTGN 238

Query: 257 RRD 259
           RR 
Sbjct: 239 RRQ 241


>gi|269958352|ref|YP_003328139.1| putative BAX inhibitor (BI)-1 like protein [Anaplasma centrale str.
           Israel]
 gi|269848181|gb|ACZ48825.1| putative BAX inhibitor (BI)-1 like protein [Anaplasma centrale str.
           Israel]
          Length = 233

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 153/238 (64%), Gaps = 23/238 (9%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GLR+Y+++VYN MA  LG+TG+++ + +               + G+M     +++Y +P
Sbjct: 16  GLRSYLVKVYNYMAAALGLTGVVALMTSF--------------SHGLM-----SVLYGTP 56

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           L W+   AP+ +  FL+ ++HS+S  A   +F  ++A++GLSLS  F+VYT+ SI + FF
Sbjct: 57  LHWVVSLAPIVMVFFLSSKVHSMSMQAVFAVFFGFAAMMGLSLSYMFMVYTAHSIARVFF 116

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           I++A FG ++ YG TTKRDL   G+F+IMG  G+ + S+VN+FM S  +   +S + +V+
Sbjct: 117 ISSAMFGVMAFYGNTTKRDLSKFGTFLIMGVVGILIASVVNIFMASGPLYFAISLVAVVV 176

Query: 204 FSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F+A+TA+D Q+IK+ Y   +D  +V  + + +V+GA  LY ++I IF+ LL  +G R+
Sbjct: 177 FTAMTAFDAQRIKDMYYRFNDGSEVT-SSKMAVMGATSLYFNYINIFLSLLHLMGDRK 233


>gi|209542443|ref|YP_002274672.1| hypothetical protein Gdia_0260 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530120|gb|ACI50057.1| protein of unknown function UPF0005 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 259

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 163/267 (61%), Gaps = 26/267 (9%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA- 61
           D R   R   +G+  G+ IDQGLRAYM+RVYN MA GL +TG +++LV   A T    A 
Sbjct: 6   DFRTMTRPAGAGTDAGA-IDQGLRAYMLRVYNWMASGLVLTGTVAYLV---ANTSLRAAF 61

Query: 62  -ASIIINRGVML--TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
            A+++   GV +  TG G L          + APLG  + +++ ++ LS  A + +F L+
Sbjct: 62  FAAVMTPSGVAVRPTGLGMLA---------MIAPLGFVLVMSLGVNRLSRQAVQALFWLF 112

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
            A++G SLSS  L +T  S+V+ FF+TA +F ++S++GY T+ DL   GSF++MG FGL 
Sbjct: 113 CAVMGASLSSILLTFTGVSVVRVFFVTAGTFSAMSIWGYVTRTDLTRFGSFLLMGLFGLV 172

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE------RQS 232
           +  LVN+F+ SSA+ +  S +G+ IF  L A+DTQ+IK  Y      AY E      ++S
Sbjct: 173 IAGLVNMFLHSSALYMLYSVVGVFIFVGLAAFDTQRIKMTYQ---QFAYYEGPEGAAKRS 229

Query: 233 VIGALMLYMDFIQIFVHLLRFLGSRRD 259
           V  AL LY++FI +F  LL+F+G R +
Sbjct: 230 VYDALTLYLNFINLFQFLLQFMGVRSN 256


>gi|110679285|ref|YP_682292.1| hypothetical protein RD1_2002 [Roseobacter denitrificans OCh 114]
 gi|109455401|gb|ABG31606.1| membrane protein, putative [Roseobacter denitrificans OCh 114]
          Length = 245

 Score =  169 bits (428), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 100/265 (37%), Positives = 158/265 (59%), Gaps = 27/265 (10%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLV----NILATT 56
           M+D+   +    S +   + ID+GLRA+M +VY  M++G+ +T  +++ V     ++A  
Sbjct: 1   MADVNTIRTAAGSRA---AQIDEGLRAHMNKVYATMSVGMLITFAVAWAVGTAPQLMAVF 57

Query: 57  VDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFL 116
            DP   S  I                 L WI +FAPLG+    +  ++ LSA AA++ F 
Sbjct: 58  RDPVTLSPNI-----------------LGWIIMFAPLGMVFAFSAMINKLSAAAAQLFFY 100

Query: 117 LYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFG 176
            ++ ++GLS+S  F+ +T  SI Q F IT+ +F  LSL+GYTTK+D+   GSF+IMG  G
Sbjct: 101 SFAGVMGLSISWIFVAFTGMSIAQIFLITSIAFAGLSLWGYTTKKDISGWGSFLIMGVIG 160

Query: 177 LFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSV 233
           L + S+VN+F+ S AI   +SA+G++IF+ LTAYDTQ IK    A++   D  + ++  +
Sbjct: 161 LVVASIVNIFLGSPAIMFAISALGVLIFAGLTAYDTQNIKNTYLAHAHHGDSEWLQKSGI 220

Query: 234 IGALMLYMDFIQIFVHLLRFLGSRR 258
           +GAL LY++FI +F+ LL   G+R 
Sbjct: 221 MGALSLYLNFINMFMMLLSLFGNRE 245


>gi|296115133|ref|ZP_06833774.1| hypothetical protein GXY_05111 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978234|gb|EFG84971.1| hypothetical protein GXY_05111 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 259

 Score =  169 bits (428), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 102/263 (38%), Positives = 157/263 (59%), Gaps = 16/263 (6%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLV--NILATTVDP 59
            D R + R   +G+   S+ID GLRAYM+RVYN M  GL +TG++++L+  N    T+  
Sbjct: 5   PDSRTFARPTANGAA--SSIDMGLRAYMLRVYNWMTSGLVLTGLVAYLIAHNAALQTLFY 62

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                     V  TG G L          + APLG  + ++  ++ LS  A + +F L+ 
Sbjct: 63  QVVETPAGNAVRPTGLGMLA---------MIAPLGFVLVMSFGVNRLSLQAVQGLFWLFC 113

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
            ++G SL++ FLV+T  SI + FFITAA+F ++S++GYTT+ DL   GSF++MG FGL +
Sbjct: 114 GVMGCSLANIFLVFTGVSITRVFFITAATFATMSIWGYTTRSDLTRFGSFLMMGLFGLVI 173

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIK---EAYSDRYDVAYAERQSVIGA 236
             LVN+F+ S A+    S +G+++F  LT +DTQ+IK   + Y+       A R+SV  A
Sbjct: 174 AGLVNMFLHSPAVYFLYSVVGVLLFVGLTMFDTQRIKFTYQQYAAYEGPEMAARRSVYDA 233

Query: 237 LMLYMDFIQIFVHLLRFLGSRRD 259
           L LY++FI +F  +L+F+G R +
Sbjct: 234 LALYLNFINLFQFMLQFMGVRSN 256


>gi|149914415|ref|ZP_01902946.1| hypothetical protein RAZWK3B_20481 [Roseobacter sp. AzwK-3b]
 gi|149811934|gb|EDM71767.1| hypothetical protein RAZWK3B_20481 [Roseobacter sp. AzwK-3b]
          Length = 239

 Score =  169 bits (428), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 96/256 (37%), Positives = 151/256 (58%), Gaps = 22/256 (8%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
            ++ +  +     + ID GLRA+M +VY  M++G+ +T   ++ V   A   +       
Sbjct: 3   QFETIRTAAGARTAQIDAGLRAHMNKVYGTMSVGMLLTFAAAWAVGTNAALFET------ 56

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                        ++T   RWI +FAPL +    +  ++ LSA AA++ F  ++A++G+S
Sbjct: 57  -------------LFTGITRWIVMFAPLIMVFAFSAMINKLSAAAAQLFFYTFAAVMGVS 103

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           +S  F+V+T  SI Q F ITA +F  LSL+GYTTK+D+   GSF+IMG  GL + S+VN+
Sbjct: 104 ISYIFVVFTDYSIAQVFLITAVAFAGLSLWGYTTKKDISGWGSFLIMGVIGLVVASIVNI 163

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMD 242
           F+ S AI   +SA+G++IF+ LTAYDTQ IK    A++   D  +  + +++GAL LY+D
Sbjct: 164 FLGSPAIMFAISAIGVLIFAGLTAYDTQDIKNEYLAHAHHGDSEWMGKSAIMGALRLYLD 223

Query: 243 FIQIFVHLLRFLGSRR 258
           FI +F+ LL   G R 
Sbjct: 224 FINMFIMLLSLFGQRE 239


>gi|148284516|ref|YP_001248606.1| hypothetical protein OTBS_0921 [Orientia tsutsugamushi str.
           Boryong]
 gi|146739955|emb|CAM79987.1| hypothetical protein OTBS_0921 [Orientia tsutsugamushi str.
           Boryong]
          Length = 246

 Score =  169 bits (427), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 157/254 (61%), Gaps = 11/254 (4%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +Y R  + G     +ID+GLRAYM+R+YNLMA+ L +T +        AT      A ++
Sbjct: 3   DYTRAYSGG--VHKSIDEGLRAYMLRIYNLMAMALFITAVAG-----TATFSLEPLARLM 55

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
            N     +  G ++  +P+  +   AP+G+ ++    +  L    A+ +F +Y+ L+G+S
Sbjct: 56  FN----FSPNGYVIGQTPIGLLVNVAPIGIALYFFWGIGRLDISTAQTLFWVYAVLVGMS 111

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LS+   +YT +S+V +FFITA++F ++S+YG+TT+RDL  +G+ ++MG +G+ + SLVN+
Sbjct: 112 LSALGYIYTGESLVSSFFITASAFAAMSIYGHTTQRDLTSLGALLLMGLWGIIISSLVNI 171

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F+ S AI    S +G+ IF  L A+DTQK+K  Y         ++ +V+GA  LY+DFI 
Sbjct: 172 FLGSPAIHFATSVLGVGIFMGLIAWDTQKLKHIYYSSGGGELGQKLAVVGAFTLYLDFIN 231

Query: 246 IFVHLLRFLGSRRD 259
           +F+++LRF G+RR 
Sbjct: 232 LFLYVLRFFGNRRK 245


>gi|114327040|ref|YP_744197.1| secY stabilizing membrane protein [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315214|gb|ABI61274.1| secY stabilizing membrane protein [Granulibacter bethesdensis
           CGDNIH1]
          Length = 267

 Score =  168 bits (426), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 160/249 (64%), Gaps = 15/249 (6%)

Query: 14  GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR--GVM 71
           G+   +++D GLRAYM+RV+N MA G+ +TGI+++ +          A + ++N     +
Sbjct: 25  GAADTASMDAGLRAYMLRVFNWMASGVALTGIVAYAI----------AHTSLMNAFYHPV 74

Query: 72  LTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFL 131
           +T  G  +  + L +I + +PL   + L+  ++ LS    + +F L    +G SL++ FL
Sbjct: 75  MTEQGVSIQPTALAFISMISPLAFVLVLSFGINRLSLGTVQALFWLLCVAMGASLTNIFL 134

Query: 132 VYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSA 191
           VYT+ SIVQTFF++AA+F ++SLYGYTT+ DL   GSF++MG  G+ + S+VN+F+ S  
Sbjct: 135 VYTNASIVQTFFVSAATFAAMSLYGYTTRSDLTRFGSFLMMGLIGIVIASVVNMFVHSGM 194

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKEAYSD---RYDVAYAERQSVIGALMLYMDFIQIFV 248
           +   +S +G+++F+ LTAYDTQ+IK  Y+    +    +A R+SV  AL LY++FI +F+
Sbjct: 195 MGFVISVIGVLVFTGLTAYDTQRIKVDYAQFATQGGSDFAARRSVFDALQLYLNFINLFM 254

Query: 249 HLLRFLGSR 257
            LLR LG+R
Sbjct: 255 MLLRLLGNR 263


>gi|163733428|ref|ZP_02140871.1| hypothetical protein RLO149_17293 [Roseobacter litoralis Och 149]
 gi|161393216|gb|EDQ17542.1| hypothetical protein RLO149_17293 [Roseobacter litoralis Och 149]
          Length = 245

 Score =  168 bits (426), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 157/265 (59%), Gaps = 27/265 (10%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLV----NILATT 56
           M+D+   +    S +   + ID GLRA+M +VY  M++G+ +T  +++ V     ++A  
Sbjct: 1   MADVNTIRTAAGSRA---AQIDAGLRAHMNKVYATMSIGMLITFAVAWAVGTAPQLMAVF 57

Query: 57  VDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFL 116
            DP   S  I                 L WI +FAPLG+    +  ++ +SA AA++ F 
Sbjct: 58  RDPVTLSPNI-----------------LGWIIMFAPLGMVFAFSAMINKMSAAAAQLFFY 100

Query: 117 LYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFG 176
            ++ ++GLS+S  F+ +T  SI Q F IT+ +F  LSL+GYTTK+D+   GSF+IMG  G
Sbjct: 101 AFAGVMGLSISWIFVAFTGMSIAQIFLITSIAFAGLSLWGYTTKKDISAWGSFLIMGVIG 160

Query: 177 LFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSV 233
           L + S+VN+F+ S AI   +SA+G++IF+ LTAYDTQ IK    A++   D  + ++  +
Sbjct: 161 LVVASIVNIFLGSPAIMFAISALGVLIFAGLTAYDTQNIKNTYLAHAHHGDSEWLQKSGI 220

Query: 234 IGALMLYMDFIQIFVHLLRFLGSRR 258
           +GAL LY++FI +F+ LL   G+R 
Sbjct: 221 MGALSLYLNFINMFMMLLSLFGNRE 245


>gi|197103249|ref|YP_002128627.1| integral membrane protein, interacts with FtsH [Phenylobacterium
           zucineum HLK1]
 gi|196480525|gb|ACG80052.1| integral membrane protein, interacts with FtsH [Phenylobacterium
           zucineum HLK1]
          Length = 251

 Score =  167 bits (424), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 102/240 (42%), Positives = 144/240 (60%), Gaps = 10/240 (4%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           +D GLR++MI VYN +ALGL V+  ++FL     ++V P     I +   M+   G L  
Sbjct: 21  VDAGLRSFMIGVYNKVALGLVVSAALAFLT----SSVPP-----IRDLMFMVNADGRLAG 71

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            +PL WI  FAPLG+ +     + + ++ AA  ++    ALIG S     L+YT  SI  
Sbjct: 72  MTPLGWIVAFAPLGIMLVSGFAMKNPTSGAASALYWTIVALIGASFGVVGLMYTGTSIAS 131

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
           TF ITA +FG LSL+GYTTK+DL   GSF+I+G  GL + SLVN+F+RS A+   +S +G
Sbjct: 132 TFLITATAFGGLSLFGYTTKKDLSGFGSFLIVGVIGLVIASLVNIFLRSEAVQFAVSVIG 191

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAER-QSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           + +F+ L AYDTQ++K  Y +    A A    +  GAL LY++FI +F  LL   G RRD
Sbjct: 192 VFVFAGLIAYDTQRLKLTYYELGGDASARGVATSYGALSLYINFINLFQFLLSLFGQRRD 251


>gi|85707776|ref|ZP_01038842.1| integral membrane protein [Erythrobacter sp. NAP1]
 gi|85689310|gb|EAQ29313.1| integral membrane protein [Erythrobacter sp. NAP1]
          Length = 252

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 105/270 (38%), Positives = 161/270 (59%), Gaps = 30/270 (11%)

Query: 1   MSDIRNYQRVVNSGSGFGS------------TIDQGLRAYMIRVYNLMALGLGVTGIMSF 48
           M+D ++ QR      GFGS            + D+GLR+YM+ +YN MA G+ +TGI++ 
Sbjct: 1   MADWKDTQRTTQ---GFGSVPRAGGDVASRASYDEGLRSYMLSIYNYMASGVLLTGIVAI 57

Query: 49  LVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSA 108
           L +      +   A + +N G             PL WI   APLG  + ++  LH +S 
Sbjct: 58  LFSWGGN--ESAVAWLYMNGG-------------PLLWIIKLAPLGFILAMSFGLHKMSQ 102

Query: 109 YAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGS 168
              +++F  ++ ++G+S+S+ FLVYT +SI  TFF TAA+F  LSL+GYTTK+DL   GS
Sbjct: 103 TTLQIVFWAFATVMGMSMSTIFLVYTGESIATTFFATAAAFAGLSLFGYTTKKDLSGFGS 162

Query: 169 FMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYA 228
           F+IMG  GL +  +VN F++S A+   +S +G++IF+ LTAYDTQ++K  Y       + 
Sbjct: 163 FLIMGVIGLIVAMIVNWFLQSEAMAFVISGLGVLIFAGLTAYDTQRLKNDYQYLRGTEFM 222

Query: 229 ERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            +  ++GA  LY+DF+ +F+ LL+FLGSR 
Sbjct: 223 GKAVIMGATSLYLDFVNMFMFLLQFLGSRE 252


>gi|241761686|ref|ZP_04759773.1| protein of unknown function UPF0005 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260752250|ref|YP_003225143.1| hypothetical protein Za10_0005 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|283856454|ref|YP_163087.2| hypothetical protein ZMO1352 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373994|gb|EER63527.1| protein of unknown function UPF0005 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258551613|gb|ACV74559.1| protein of unknown function UPF0005 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|283775458|gb|AAV89976.2| protein of unknown function UPF0005 [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 242

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 107/240 (44%), Positives = 149/240 (62%), Gaps = 20/240 (8%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           S  D GLR+YM+ VYN MA G+ +TGI+++LV                      +  GA 
Sbjct: 23  SERDAGLRSYMLSVYNYMAGGVLLTGIVAYLVA--------------------HSALGAA 62

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +  SPLRW+ I APL     L+  ++       K +F  Y+A++GLS++  F VYT  SI
Sbjct: 63  IIFSPLRWLVILAPLAFVFALSAGVNRFKLSTLKTLFWSYAAVMGLSMAVIFFVYTGTSI 122

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            QTFF TAA+F  LS++GY TK+DL  IGSF+IM  FGL + SL+N+F+ SS++   +SA
Sbjct: 123 AQTFFATAAAFAGLSVFGYLTKKDLSGIGSFLIMAVFGLIVASLLNMFIHSSSLQFGISA 182

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +G++IF+ LTAYDTQ+IK  Y       YA + +V+GAL LY+DFI +F  LL F+G RR
Sbjct: 183 LGVLIFAGLTAYDTQQIKSMYFMTSGGEYAGKMAVMGALSLYLDFINMFSFLLNFMGDRR 242


>gi|42520766|ref|NP_966681.1| hypothetical protein WD0950 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410506|gb|AAS14615.1| membrane protein, putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 240

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 158/250 (63%), Gaps = 29/250 (11%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MS +RN Q + + G  + +    GLR+Y+ +VYN MAL LGVTG+++FL           
Sbjct: 1   MSYMRNEQDIRSQGVYYSA----GLRSYLTKVYNYMALALGVTGLVAFLT---------- 46

Query: 61  AASIIINRGVMLTGFGALMYTSP-LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                     + +G   ++Y++P L  + + +P+ +  +++ R+  LSA +A  +F  +S
Sbjct: 47  ----------VFSGLFQVIYSNPVLSLVVMLSPVALVFYMSYRIQHLSAQSAVTIFFSFS 96

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
            L+GLSLS  F+VYT+++I + FFIT+  FGS++LYG TTKRDL  +GSF+IMG +GL +
Sbjct: 97  VLMGLSLSYVFIVYTAENIARAFFITSIMFGSMALYGNTTKRDLTSMGSFLIMGVWGLII 156

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGA 236
            S+VNLF+ SS +   +S + +++F+ +TAYD Q+IK+ Y   +D  +VA   + +++GA
Sbjct: 157 ASIVNLFLGSSPLHFAISFISVIVFTLMTAYDAQRIKDVYYKHNDGSEVA-TTKLAILGA 215

Query: 237 LMLYMDFIQI 246
             LY DFI I
Sbjct: 216 TNLYFDFINI 225


>gi|225631080|ref|ZP_03787813.1| hypothetical protein WUni_002590 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225591225|gb|EEH12374.1| hypothetical protein WUni_002590 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 240

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 158/250 (63%), Gaps = 29/250 (11%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MS +RN Q + + G  + +    GLR+Y+ +VYN MAL LGVTG+++FL           
Sbjct: 1   MSYMRNEQDIRSQGVYYSA----GLRSYLTKVYNYMALALGVTGLVAFLT---------- 46

Query: 61  AASIIINRGVMLTGFGALMYTSP-LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                     + +G   ++Y++P L  + + +P+ +  +++ R+  LSA +A  +F  +S
Sbjct: 47  ----------VFSGLFQVIYSNPVLSLVVMLSPVALVFYMSYRIQHLSAQSAVAIFFSFS 96

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
            L+GLSLS  F+VYT+++I + FFIT+  FGS++LYG TTKRDL  +GSF+IMG +GL +
Sbjct: 97  VLMGLSLSYVFIVYTAENIARAFFITSIMFGSMALYGNTTKRDLTSMGSFLIMGVWGLII 156

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGA 236
            S+VNLF+ SS +   +S + +++F+ +TAYD Q+IK+ Y   +D  +VA   + +++GA
Sbjct: 157 ASIVNLFLGSSPLHFAISFISVIVFTLMTAYDAQRIKDVYYKHNDGSEVA-TTKLAILGA 215

Query: 237 LMLYMDFIQI 246
             LY DFI I
Sbjct: 216 TNLYFDFINI 225


>gi|304395760|ref|ZP_07377643.1| protein of unknown function UPF0005 [Pantoea sp. aB]
 gi|304357054|gb|EFM21418.1| protein of unknown function UPF0005 [Pantoea sp. aB]
          Length = 235

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 104/239 (43%), Positives = 141/239 (58%), Gaps = 20/239 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
            +GL+AYM +VY  M  GL +T  +S+     A         +  NR   +T FG     
Sbjct: 15  SRGLQAYMAQVYGWMTCGLLLTAFVSWY----AARTPAVMEMVFANR---ITFFG----- 62

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                  I A L +  FL+  +H LS   A  +F+LYSAL GL+++S FLVYT  SI  T
Sbjct: 63  ------LIIAQLALVFFLSGMVHRLSGAVATGLFMLYSALTGLTMASIFLVYTYSSIAST 116

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FF+TA  FG++S YGYTTKRDL   GS + MG  G+ L SLVN +++S A+   ++ +G+
Sbjct: 117 FFVTAGMFGAMSFYGYTTKRDLSRFGSLLFMGLIGIVLASLVNFWLKSPALMWAITYIGV 176

Query: 202 VIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           V+F  LTAYDTQK+K      D  D     R S++GAL LY+DFI +F+ LLR LG+RR
Sbjct: 177 VLFVGLTAYDTQKLKNIGEQIDARDTENLRRYSIMGALTLYLDFINLFLMLLRILGNRR 235


>gi|5354188|gb|AAD42397.1|AF157493_5 conserved hypothetical integral membrane protein [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 234

 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 107/240 (44%), Positives = 149/240 (62%), Gaps = 20/240 (8%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           S  D GLR+YM+ VYN MA G+ +TGI+++LV                      +  GA 
Sbjct: 15  SERDAGLRSYMLSVYNYMAGGVLLTGIVAYLVA--------------------HSALGAA 54

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +  SPLRW+ I APL     L+  ++       K +F  Y+A++GLS++  F VYT  SI
Sbjct: 55  IIFSPLRWLVILAPLAFVFALSAGVNRFKLSTLKTLFWSYAAVMGLSMAVIFFVYTGTSI 114

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            QTFF TAA+F  LS++GY TK+DL  IGSF+IM  FGL + SL+N+F+ SS++   +SA
Sbjct: 115 AQTFFATAAAFAGLSVFGYLTKKDLSGIGSFLIMAVFGLIVASLLNMFIHSSSLQFGISA 174

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +G++IF+ LTAYDTQ+IK  Y       YA + +V+GAL LY+DFI +F  LL F+G RR
Sbjct: 175 LGVLIFAGLTAYDTQQIKSMYFMTSGGEYAGKMAVMGALSLYLDFINMFSFLLNFMGDRR 234


>gi|73667550|ref|YP_303566.1| hypothetical protein Ecaj_0937 [Ehrlichia canis str. Jake]
 gi|72394691|gb|AAZ68968.1| protein of unknown function UPF0005 [Ehrlichia canis str. Jake]
          Length = 234

 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 148/238 (62%), Gaps = 23/238 (9%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GLR Y+++VYN MA+ LG+TGI++F V          ++S +++           +Y +P
Sbjct: 17  GLRNYLVKVYNYMAMALGLTGIVAFFV---------SSSSALMSA----------IYNTP 57

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           L W+ +FAP+G+   ++ +L+  S      +F  ++AL+G+S+S  FLVYTS SI + FF
Sbjct: 58  LHWVVMFAPIGLVFLMSYKLNVFSFQTVLTVFFSFAALMGVSISYIFLVYTSASIAKVFF 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           I+++ FG ++ YG  TK+DL   G+F+ MG  G+ L SLVNLF+ S  +   +S + +V+
Sbjct: 118 ISSSMFGIMAWYGNVTKKDLSQFGTFLFMGLVGIVLASLVNLFLHSGPLHFAISIVAVVL 177

Query: 204 FSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F+ +TAYD Q+IK+ Y   +D  DV+   + +++GA  LY +++ IF+ LL   G RR
Sbjct: 178 FTGMTAYDAQRIKDVYYKFNDGTDVS-VNKMAILGATTLYFNYVNIFLSLLNLQGERR 234


>gi|126739244|ref|ZP_01754938.1| hypothetical protein RSK20926_22629 [Roseobacter sp. SK209-2-6]
 gi|126719861|gb|EBA16569.1| hypothetical protein RSK20926_22629 [Roseobacter sp. SK209-2-6]
          Length = 257

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 155/244 (63%), Gaps = 6/244 (2%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + ID+GLRA+M +VY  M++GL +T + ++ +  L+ T  P+   I    G  LT  G  
Sbjct: 16  AEIDEGLRAHMNKVYGTMSVGLLITALAAWAIAGLSITSTPNEYQI--GAGRYLTDLGYT 73

Query: 79  MYTSPLRWIFIFAPLG-VFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           +Y SP++++ + APL  +F      +   SA   ++ FL ++A++G+S+ + F++YT  S
Sbjct: 74  LYVSPVKFVLMLAPLAFIFFGWGALMRRGSAAVVQLGFLAFAAVMGISMGTVFMIYTPYS 133

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           I QTF +TA +F  LSL+GYTTK+DL  +G+F++MG  GL +  +VN+F++S  + + +S
Sbjct: 134 IAQTFLVTAIAFAGLSLWGYTTKKDLSGMGTFLMMGVIGLIVAMIVNMFLQSGVMMMAIS 193

Query: 198 AMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
           A+G++IF+ LTA+ TQ IK  Y   + + D  + ++ +  GAL LY+ F+ +F  LL F+
Sbjct: 194 AIGVLIFAGLTAFYTQDIKNTYVAMATQGDKEWLDKAAYDGALSLYISFLNMFQFLLMFM 253

Query: 255 GSRR 258
           G + 
Sbjct: 254 GQQE 257


>gi|315607413|ref|ZP_07882411.1| protein of hypothetical function UPF0005 [Prevotella buccae ATCC
           33574]
 gi|315250913|gb|EFU30904.1| protein of hypothetical function UPF0005 [Prevotella buccae ATCC
           33574]
          Length = 244

 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 94/255 (36%), Positives = 152/255 (59%), Gaps = 23/255 (9%)

Query: 9   RVVNSGSGFGSTIDQGLR----AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASI 64
           +V+N+  G   T  + L     A M +VY  MAL L +TGI ++ V        P   + 
Sbjct: 8   KVINAAEGRTDTRSKELNLAFPALMRKVYTWMALALAITGITAYGV-----ATSPALLTA 62

Query: 65  IINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGL 124
           I    ++  G              I A LG+  +   RL  LS   A ++F+L+S + G 
Sbjct: 63  IFTNKLLFYGL-------------IIAELGIVFYTTARLAKLSLSTATLLFILFSVINGA 109

Query: 125 SLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN 184
           +L+S F++YT  SI  TFF+TA +FG+++  GYTTKRDL  +G  ++M   GL + ++VN
Sbjct: 110 TLASVFVIYTMSSIATTFFVTAGTFGAMAFIGYTTKRDLTKMGGILMMALIGLIIAAVVN 169

Query: 185 LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAY-AERQSVIGALMLYMDF 243
           +F+ +S  DL +S +G++IF+ LTA+D+Q IK    ++YD++  A++ +++G+L LY+DF
Sbjct: 170 MFLHNSTFDLIVSGLGVLIFTGLTAWDSQAIKRMLQEQYDMSEGAQKVALLGSLSLYLDF 229

Query: 244 IQIFVHLLRFLGSRR 258
           I +F++LLRFLG R+
Sbjct: 230 INMFLYLLRFLGDRK 244


>gi|51245524|ref|YP_065408.1| hypothetical protein DP1672 [Desulfotalea psychrophila LSv54]
 gi|50876561|emb|CAG36401.1| conserved hypothetical membrane protein, probably cold-shock
           inducible [Desulfotalea psychrophila LSv54]
          Length = 240

 Score =  165 bits (418), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 100/236 (42%), Positives = 147/236 (62%), Gaps = 25/236 (10%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++ +V+N MALGLG+TG+++F            AA          +G  A +  SPL  +
Sbjct: 26  FLAKVFNWMALGLGLTGLVAFF-----------AAG---------SGITAAIVASPLFMM 65

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
            I A LG+  FL+ R+  + A  A  +FL YS L GL+LS+ FL YTS SI  TFFITA 
Sbjct: 66  LIIAELGMVFFLSARIDKIQASTASGLFLGYSFLNGLTLSAIFLAYTSTSIAATFFITAG 125

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
            FG++++YG  TKRDL   GSF+ MG  G+ + S+VN+F++S+ +   +S +G+ IF+AL
Sbjct: 126 MFGAMAVYGLITKRDLSGFGSFLFMGLVGIIIASVVNIFLKSTGLYWVISLLGVFIFTAL 185

Query: 208 TAYDTQKIK----EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           TAYD QKIK    +    + +VA  ++ +++GAL LY+DFI +F+ LLRF G  R+
Sbjct: 186 TAYDVQKIKTMGEKGILSQGEVAI-KKGAIMGALTLYLDFINLFLMLLRFFGGSRN 240


>gi|99034725|ref|ZP_01314657.1| hypothetical protein Wendoof_01000528 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 247

 Score =  165 bits (417), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 97/250 (38%), Positives = 157/250 (62%), Gaps = 29/250 (11%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MS +RN Q + + G  + +    GLR+Y+ +VYN MAL LGVTG+++FL           
Sbjct: 8   MSYMRNEQDIRSQGVYYSA----GLRSYLTKVYNYMALALGVTGLVAFLT---------- 53

Query: 61  AASIIINRGVMLTGFGALMYTSP-LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                     + +G   ++Y++P L  + + +P+ +  +++ R+  LSA +A  +F  +S
Sbjct: 54  ----------VFSGLFQVIYSNPVLSLVVMLSPVALVFYMSYRIQHLSAQSAVTIFFSFS 103

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
            L+GLSLS  F+VYT+++I + FFIT+  F S++LYG TTKRDL  +GSF+IMG +GL +
Sbjct: 104 VLMGLSLSYVFIVYTAENIARAFFITSIMFSSMALYGNTTKRDLTSMGSFLIMGVWGLII 163

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGA 236
            S+VNLF+ SS +   +S + +++F+ +TAYD Q+IK+ Y   +D  +VA   + +++GA
Sbjct: 164 ASIVNLFLGSSPLHFAISFISVIVFTLMTAYDAQRIKDVYYKHNDGSEVA-TTKLAILGA 222

Query: 237 LMLYMDFIQI 246
             LY DFI I
Sbjct: 223 TNLYFDFINI 232


>gi|84515297|ref|ZP_01002659.1| hypothetical protein SKA53_01526 [Loktanella vestfoldensis SKA53]
 gi|84510580|gb|EAQ07035.1| hypothetical protein SKA53_01526 [Loktanella vestfoldensis SKA53]
          Length = 263

 Score =  165 bits (417), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 95/263 (36%), Positives = 157/263 (59%), Gaps = 24/263 (9%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVN----ILATTVD 58
           ++  Y  +  +G    + ID+GLRA+M +VY  M++G+ +T  +++ V     +L    D
Sbjct: 18  NMAQYDTIRTAGGVRTAAIDEGLRAHMSKVYGTMSVGMLITFAVAWAVGTAPALLGVFRD 77

Query: 59  PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
           P    I +   +             L WI +FAPLG+       ++  SA AA+  F  +
Sbjct: 78  P----ITLQPNI-------------LGWIVMFAPLGMIFGFGAMINRFSAAAAQTFFYAF 120

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
           +A++GLS++  F+ +T  SI Q F IT+ +F SLSLYGYTTK+DL   G+F++MG  G+ 
Sbjct: 121 AAVMGLSIAWIFVAFTGMSIAQIFLITSIAFASLSLYGYTTKKDLSAWGTFLMMGVIGIV 180

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIG 235
           +  ++NLF++S AI   +S +G++IF+ LTAYDTQ+IK    A++   D  +  + +++G
Sbjct: 181 VAMIINLFLQSPAIMFAISILGVLIFAGLTAYDTQRIKTEYVAHAAHGDAEWLGKSAIMG 240

Query: 236 ALMLYMDFIQIFVHLLRFLGSRR 258
           AL LY++FI +F+ LL+  G+R 
Sbjct: 241 ALSLYLNFINMFMFLLQLFGNRE 263


>gi|308186124|ref|YP_003930255.1| hypothetical protein Pvag_0604 [Pantoea vagans C9-1]
 gi|308056634|gb|ADO08806.1| Uncharacterized protein [Pantoea vagans C9-1]
          Length = 235

 Score =  164 bits (416), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 102/239 (42%), Positives = 140/239 (58%), Gaps = 20/239 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
            +GL+AYM +VY  M  GL +T  +S+     A         +  NR   +T FG     
Sbjct: 15  SRGLQAYMAQVYGWMTCGLLLTAFVSWF----AARTPAVMELVFANR---ITFFG----- 62

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                  I A L +  FL+  +H LS   A  +F+LYSAL G++++S FLVYT  SI  T
Sbjct: 63  ------LIIAQLALVFFLSGMVHRLSGAVATGLFMLYSALTGITMASIFLVYTYSSIAST 116

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FF+TA  FG++S YGYTTKRDL   GS + M   G+ L SLVN +++S A+   ++ +G+
Sbjct: 117 FFVTAGMFGAMSFYGYTTKRDLSRFGSLLFMALIGIVLASLVNFWLKSPALMWAITYIGV 176

Query: 202 VIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           V+F  LTAYDTQK+K      D  D     R S++GAL LY+DFI +F+ LLR LG+RR
Sbjct: 177 VVFVGLTAYDTQKLKNIGEQIDARDTENLRRYSIMGALTLYLDFINLFLMLLRILGNRR 235


>gi|317492555|ref|ZP_07950982.1| hypothetical protein HMPREF0864_01746 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919305|gb|EFV40637.1| hypothetical protein HMPREF0864_01746 [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 236

 Score =  164 bits (416), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 150/249 (60%), Gaps = 25/249 (10%)

Query: 16  GFGSTIDQ---GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
           G GS +++   GL+ YM +VY  M  GL +T I+++     A T  P   + I +  +  
Sbjct: 7   GNGSIVERANTGLQTYMAQVYGWMTCGLLLTSIVAWYA---AHT--PAVLNFIFSSKI-- 59

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
           T FG            +   LG+   L+  +H LSA AA  +F+LYSAL GL+L+S F+V
Sbjct: 60  TFFG-----------LVIVQLGLVFVLSGMVHKLSAAAATSLFMLYSALTGLTLASIFIV 108

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT  SI  TF +TA  FG++SLYGYTTKRDL  IGS M MG  G+ L SLVN++++S A+
Sbjct: 109 YTYSSIASTFVVTAGMFGAMSLYGYTTKRDLSGIGSMMFMGLIGIILASLVNIWLKSPAL 168

Query: 193 DLTMSAMGLVIFSALTAYDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
              ++  G++IF  LTAYDTQK+K   E  S   D     + S++GAL LY+DFI +F+ 
Sbjct: 169 TWVITYAGVIIFVGLTAYDTQKLKAMGEQLSPD-DKDNFRKYSILGALTLYLDFINLFLM 227

Query: 250 LLRFLGSRR 258
           LLR  G+RR
Sbjct: 228 LLRIFGNRR 236


>gi|58697095|ref|ZP_00372540.1| integral membrane protein [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58698909|ref|ZP_00373773.1| membrane protein [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225630620|ref|YP_002727411.1| hypothetical protein WRi_008910 [Wolbachia sp. wRi]
 gi|58534574|gb|EAL58709.1| membrane protein [Wolbachia endosymbiont of Drosophila ananassae]
 gi|58536619|gb|EAL59942.1| integral membrane protein [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|225592601|gb|ACN95620.1| hypothetical protein WRi_008910 [Wolbachia sp. wRi]
          Length = 240

 Score =  164 bits (416), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 97/250 (38%), Positives = 157/250 (62%), Gaps = 29/250 (11%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MS +RN Q + + G  + +    GLR+Y+ +VYN MAL LGVTG+++FL           
Sbjct: 1   MSYMRNEQDIRSQGVYYSA----GLRSYLTKVYNYMALALGVTGLVAFLT---------- 46

Query: 61  AASIIINRGVMLTGFGALMYTSP-LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                     + +G   ++Y++P L  + + +P+ +  +++ R+  LSA +A  +F  +S
Sbjct: 47  ----------VFSGLFQVIYSNPVLSLVVMLSPVALVFYMSYRIQHLSAQSAVTIFFSFS 96

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
            L+GLSLS  F+VYT+++I + FFIT+  FGS++LYG TTKRDL  +GSF+IMG  G+ +
Sbjct: 97  VLMGLSLSYIFIVYTAENIARAFFITSIMFGSMALYGNTTKRDLTSMGSFLIMGVLGIII 156

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGA 236
            S+VNLF+ SS +   +S + +++F+ +TAYD Q+IK+ Y   +D  +VA   + +++GA
Sbjct: 157 ASIVNLFLGSSPLYFAISFISVIVFTLMTAYDAQRIKDVYYKHNDGSEVA-TTKLAILGA 215

Query: 237 LMLYMDFIQI 246
             LY DFI I
Sbjct: 216 TNLYFDFINI 225


>gi|288925150|ref|ZP_06419085.1| membrane protein [Prevotella buccae D17]
 gi|288337915|gb|EFC76266.1| membrane protein [Prevotella buccae D17]
          Length = 236

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 152/254 (59%), Gaps = 23/254 (9%)

Query: 10  VVNSGSGFGSTIDQGLR----AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           ++N+  G   T  + L     A M +VY  MAL L +TGI ++ V        P   + I
Sbjct: 1   MINAAEGRTDTRSKELNLAFPALMRKVYTWMALALAITGITAYGV-----ATSPALLTAI 55

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
               ++  G              I A LG+  +   RL  LS   A ++F+L+S + G++
Sbjct: 56  FTNKLLFYGL-------------IIAELGIVFYTTARLAKLSLSTATLLFILFSVINGVT 102

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L+S F++YT  SI  TFF+TA +FG+++  GYTTKRDL  +G  ++M   GL + ++VN+
Sbjct: 103 LASVFMIYTMSSIATTFFVTAGTFGAMAFIGYTTKRDLTKMGGILMMALIGLIIAAVVNM 162

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAY-AERQSVIGALMLYMDFI 244
           F+ +S  DL +S +G++IF+ LTA+D+Q IK    ++YD++  A++ +++G+L LY+DFI
Sbjct: 163 FLHNSTFDLIVSGLGVLIFTGLTAWDSQAIKRMLQEQYDMSEGAQKVALLGSLSLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F++LLRFLG R+
Sbjct: 223 NMFLYLLRFLGDRK 236


>gi|290474032|ref|YP_003466906.1| putative transport protein [Xenorhabdus bovienii SS-2004]
 gi|289173339|emb|CBJ80116.1| putative transport protein [Xenorhabdus bovienii SS-2004]
          Length = 236

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 106/254 (41%), Positives = 152/254 (59%), Gaps = 23/254 (9%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           YQR  +SGS        G++ YM +VY  M  GL +T   +F+   +A +  P+  + I 
Sbjct: 4   YQR--SSGS-IVQKAGSGVQTYMAQVYGWMTCGLLLT---AFVAGYVANS--PEILNAIF 55

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           +  ++  G              I A L +   L+  +H +S   A  +F+LYS L GL+L
Sbjct: 56  SSSIVFYGL-------------IIAQLALVFVLSGLVHKMSGALATGLFMLYSMLTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+VYTS SI  TF I+AA FG+LS+YGYTTKR L  +GSF+ MG  G+ L SL+N++
Sbjct: 103 SSIFVVYTSGSIASTFVISAAMFGALSVYGYTTKRSLSGLGSFLFMGLIGIVLASLINIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFI 244
           ++S A+   ++ +G+++F+ LTAYDTQK+KE  A  D  D     R S+ GAL LY+DFI
Sbjct: 163 LKSPALMWAITYIGVLVFAGLTAYDTQKLKEMGAELDVNDKENLRRYSITGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR LG RR
Sbjct: 223 NLFLMLLRILGDRR 236


>gi|326388928|ref|ZP_08210510.1| hypothetical protein Y88_3672 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206528|gb|EGD57363.1| hypothetical protein Y88_3672 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 210

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 139/230 (60%), Gaps = 20/230 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M+ +YN MA G+ ++GI++                     G   +G    +  +PLRW+ 
Sbjct: 1   MLSIYNYMASGVLLSGIVAL--------------------GFATSGLAEAVLMTPLRWLI 40

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
             +PL   + ++  ++ LS  A + +F  +S  +GLSLSS F VYT  SI  TFF TA +
Sbjct: 41  ALSPLAFTMVMSFGVNRLSTGAMRGLFWAFSVAMGLSLSSIFFVYTGPSIAVTFFATAGA 100

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           F  LSL+GYTT+++L  +G+F++MG FG+ + SLVNLF+ S  +   +S +G+ IF+ LT
Sbjct: 101 FAGLSLFGYTTQKNLSGMGTFLLMGLFGILIASLVNLFLHSPGLSWGISFLGVFIFAGLT 160

Query: 209 AYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+KE Y+       A +  V+GAL LY+DFI +F+ LLRF+G RR
Sbjct: 161 AYDTQKLKEQYAYVAGTDMAGKVVVLGALELYLDFINMFMMLLRFMGDRR 210


>gi|291616780|ref|YP_003519522.1| YbhL [Pantoea ananatis LMG 20103]
 gi|291151810|gb|ADD76394.1| YbhL [Pantoea ananatis LMG 20103]
          Length = 242

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 139/239 (58%), Gaps = 20/239 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
            +GL+AYM +VY  M  GL +T  +S+     A         +  NR   +T FG     
Sbjct: 22  SRGLQAYMAQVYGWMTCGLLLTAFVSWF----AARTPAVMELVFANR---ITFFG----- 69

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                  I   L +  FL+  +H LS   A  +F+LYSAL GL+++S FLVYT  SI  T
Sbjct: 70  ------LIIVQLALVFFLSGMVHRLSGAVATGLFMLYSALTGLTMASIFLVYTYSSIAST 123

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FF+TA  FG++S YGYTTKRDL  +GS + M   G+ L SLVN +++S A+   ++ +G+
Sbjct: 124 FFVTAGMFGAMSFYGYTTKRDLSRLGSLLFMALIGILLASLVNFWLKSPALMWAITYIGV 183

Query: 202 VIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           V+F  LTAYDTQK+K      D  D     R S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 184 VVFVGLTAYDTQKLKNIGEQIDARDTENLRRYSIMGALTLYLDFINLFLMLLRIFGNRR 242


>gi|327393206|dbj|BAK10628.1| inner membrane protein YbhL [Pantoea ananatis AJ13355]
          Length = 235

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 139/239 (58%), Gaps = 20/239 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
            +GL+AYM +VY  M  GL +T  +S+     A         +  NR   +T FG     
Sbjct: 15  SRGLQAYMAQVYGWMTCGLLLTAFVSWF----AARTPAVMELVFANR---ITFFG----- 62

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                  I   L +  FL+  +H LS   A  +F+LYSAL GL+++S FLVYT  SI  T
Sbjct: 63  ------LIIVQLALVFFLSGMVHRLSGAVATGLFMLYSALTGLTMASIFLVYTYSSIAST 116

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FF+TA  FG++S YGYTTKRDL  +GS + M   G+ L SLVN +++S A+   ++ +G+
Sbjct: 117 FFVTAGMFGAMSFYGYTTKRDLSRLGSLLFMALIGILLASLVNFWLKSPALMWAITYIGV 176

Query: 202 VIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           V+F  LTAYDTQK+K      D  D     R S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VVFVGLTAYDTQKLKNIGEQIDARDTENLRRYSIMGALTLYLDFINLFLMLLRIFGNRR 235


>gi|189500375|ref|YP_001959845.1| hypothetical protein Cphamn1_1437 [Chlorobium phaeobacteroides BS1]
 gi|189495816|gb|ACE04364.1| protein of unknown function UPF0005 [Chlorobium phaeobacteroides
           BS1]
          Length = 219

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 142/229 (62%), Gaps = 18/229 (7%)

Query: 31  RVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIF 90
           +VY  MALGL +T  + F      T       ++I + G +L G              + 
Sbjct: 8   QVYTWMALGLALTATVGFY-----TAESQMLRNLIFSNGFVLIGL-------------VV 49

Query: 91  APLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFG 150
           A LG+ + L+  ++ LS  AA  +F+LYS L GL+LS+ FLVYT  SI  TFFIT+ +F 
Sbjct: 50  AQLGIVLALSAGINRLSGSAATGLFILYSGLTGLTLSAVFLVYTYSSIASTFFITSGTFA 109

Query: 151 SLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAY 210
           ++S++G+TTKRDL  IGS   M   G+ L S+VN+FM++S ++L +S +G+++F+ALTAY
Sbjct: 110 AMSVFGHTTKRDLTKIGSIAFMALIGIILASVVNMFMQNSMLELGISVIGVLLFTALTAY 169

Query: 211 DTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           D Q+IKE  +   D     + SV+GAL LY++FI +F+ LLRFLG  RD
Sbjct: 170 DAQRIKEMAAMVTDGESEAKVSVMGALSLYLNFINLFLMLLRFLGVARD 218


>gi|197284511|ref|YP_002150383.1| hypothetical protein PMI0614 [Proteus mirabilis HI4320]
 gi|227356691|ref|ZP_03841077.1| protein of hypothetical function UPF0005 [Proteus mirabilis ATCC
           29906]
 gi|194681998|emb|CAR41461.1| putative membrane protein [Proteus mirabilis HI4320]
 gi|227163199|gb|EEI48130.1| protein of hypothetical function UPF0005 [Proteus mirabilis ATCC
           29906]
          Length = 236

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 97/238 (40%), Positives = 147/238 (61%), Gaps = 22/238 (9%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ +M +VY  M +GL +T  ++  V   AT ++                   +++T+ 
Sbjct: 18  GLQTFMAQVYGWMTVGLLLTAFVALYVASSATLIE-------------------MIFTNK 58

Query: 84  LRWI-FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
           + +   I A L +   L+  +H +S   A  +F+LYSAL G+++SS  +VYT  S+  TF
Sbjct: 59  IFFFGLIIAQLALVFILSGMVHKMSGALATTLFMLYSALTGVTISSVLIVYTYSSVASTF 118

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
           FI AA FG+LS+YGYTTKR L  +GSF+ MG  G+ + S+VN+FM+SS + + +S  G++
Sbjct: 119 FICAAMFGALSVYGYTTKRSLTGMGSFLFMGLIGIIIASIVNIFMQSSMMSMVISYAGVL 178

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           IF+ LTAYDTQK+K+  S+  + D     R S++GAL LY+DFI +F+ LLR LG RR
Sbjct: 179 IFAGLTAYDTQKLKDMGSEINQEDKENMRRYSIMGALTLYLDFINLFLMLLRILGDRR 236


>gi|253990405|ref|YP_003041761.1| inner membrane protein ybhl [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781855|emb|CAQ85018.1| inner membrane protein ybhl [Photorhabdus asymbiotica]
          Length = 236

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 149/247 (60%), Gaps = 25/247 (10%)

Query: 18  GSTIDQ---GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           GS I Q   GL+AYM +VY  M  GL +T  +++ V+               N+ V+L  
Sbjct: 9   GSIIQQAGTGLQAYMAQVYGWMTCGLLLTAFVAWYVSQ--------------NQAVVLYI 54

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           F      S L +  I A  G+   L+  ++ + A  A  +F+LYSAL GL+LSS F+VYT
Sbjct: 55  FS----NSILFYGLIIAQFGLVFVLSGMINRMGASLATGLFMLYSALTGLTLSSIFVVYT 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
           + SI  TF +TA  FG+LS YGYTTKR L  +GSF+ MG  G+ L SL+N +++S A+  
Sbjct: 111 TGSIASTFVVTAGMFGALSFYGYTTKRSLSGLGSFLFMGLSGIILASLINFWLKSEALMW 170

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLL 251
            ++ +G+VIF+ LTAYDTQK+KE   D  DV   E   + S++GAL LY+DFI +F+ LL
Sbjct: 171 AVTYIGVVIFAGLTAYDTQKLKEMGED-LDVNDKENLRKFSIVGALTLYLDFINMFLMLL 229

Query: 252 RFLGSRR 258
           R  G RR
Sbjct: 230 RIFGDRR 236


>gi|197103181|ref|YP_002128559.1| hypothetical protein PHZ_p0041 [Phenylobacterium zucineum HLK1]
 gi|196480457|gb|ACG79984.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 251

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 106/265 (40%), Positives = 152/265 (57%), Gaps = 20/265 (7%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MSD +  +      +     ID GLR++MI VYN +ALGL V+  +++L     ++V P 
Sbjct: 1   MSDFQRARHATILSTRADMAIDAGLRSFMIGVYNKVALGLLVSAALAYLT----SSVPP- 55

Query: 61  AASIIINRGVML--TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
                  R +M   +  G L   +P+ WI   APLG+ +     + + ++ AA  ++   
Sbjct: 56  ------VRDLMFVTSADGHLAGMTPIGWIVAIAPLGILLVSGFAMRNPTSGAASALYWTI 109

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
            ALIG SL    LVYT  SIV  F ITA +FG+LSL+GY TK+DL   GSF+I+G  GL 
Sbjct: 110 VALIGASLGVVGLVYTGASIVSMFLITATAFGALSLFGYVTKKDLTGFGSFLIVGVVGLV 169

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVI---- 234
           + SLVNLF+RS  +   +S +G+ +F+ L AYDTQ++K AY   Y++  AE    +    
Sbjct: 170 IASLVNLFLRSELMQFMISVIGVFVFAGLIAYDTQRLKIAY---YELGGAEAARSVATSY 226

Query: 235 GALMLYMDFIQIFVHLLRFLGSRRD 259
           GAL LY++FI +F  LL   G RRD
Sbjct: 227 GALNLYINFINLFQFLLSLFGQRRD 251


>gi|323976829|gb|EGB71917.1| inner membrane protein ybhL [Escherichia coli TW10509]
          Length = 234

 Score =  162 bits (411), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 99/237 (41%), Positives = 142/237 (59%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++     A  ++     +  NR V L G         
Sbjct: 16  GLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMEL----LFTNR-VFLIGL-------- 62

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF 
Sbjct: 63  -----IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++SLYGYTTKRDLG  G+ + M   G+ L SLVN +++S A+   ++ +G+++
Sbjct: 118 VTAGMFGAMSLYGYTTKRDLGGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIV 177

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 FVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|226330873|ref|ZP_03806391.1| hypothetical protein PROPEN_04794 [Proteus penneri ATCC 35198]
 gi|225201668|gb|EEG84022.1| hypothetical protein PROPEN_04794 [Proteus penneri ATCC 35198]
          Length = 236

 Score =  162 bits (411), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 144/237 (60%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ +M +VY  M +GL +T  ++  V            S+I +  ++  G         
Sbjct: 18  GLQTFMAQVYGWMTVGLLLTAFVALYV-----ASSEALLSMIFSSKIVFFGL-------- 64

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A LG+   L+  +H +S   A  +F+LYS L G+++SS  LVYT+ SI  TFF
Sbjct: 65  -----IIAQLGLVFVLSGMVHKMSGAMATSLFMLYSVLTGVTISSVLLVYTASSIASTFF 119

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           I AA FG+LS+YGYTTKR L  +GSF+ MG  G+ + S+VN+FM+SS + + +S  G++I
Sbjct: 120 ICAAMFGALSIYGYTTKRSLTGMGSFLFMGLIGIIIASIVNIFMQSSMMSMVISYAGVLI 179

Query: 204 FSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F+ LTAYDTQK+K+  ++  + D     R S++GAL LY+DFI +F+ LLR LG RR
Sbjct: 180 FAGLTAYDTQKLKDMGNEINQEDKENMRRYSIMGALTLYLDFINLFLMLLRILGDRR 236


>gi|300722427|ref|YP_003711715.1| putative transport protein [Xenorhabdus nematophila ATCC 19061]
 gi|297628932|emb|CBJ89515.1| putative transport protein [Xenorhabdus nematophila ATCC 19061]
          Length = 236

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 104/255 (40%), Positives = 153/255 (60%), Gaps = 25/255 (9%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           YQR  ++GS    T   G++ YM +VY  M  GL +T  +++ V   A T  P+  S+I 
Sbjct: 4   YQR--SNGSIVQKT-GSGIQTYMAQVYGWMTCGLLLTAFVAWYV---ANT--PEILSVIF 55

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           +  ++  G              I A L +   L+  +H +S   A  +F+LYS L GL+L
Sbjct: 56  SSSMVFYGL-------------IIAQLALVFVLSGLVHKMSGALATSLFMLYSLLTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+ YTS SI  TF ++A  FG+LS+YGY+TKR L  +GSF+ MG  G+ L SL+N++
Sbjct: 103 SSIFVAYTSSSIASTFVVSAGMFGALSVYGYSTKRSLSGMGSFLFMGLIGIVLASLINIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDF 243
           ++S A+   ++ +G+++F+ LTAYDTQK+KE   +  DV   E   R S+ GAL LY+DF
Sbjct: 163 LKSPALMWAITYIGVLVFAGLTAYDTQKLKEM-GEELDVNDKENMRRYSITGALTLYLDF 221

Query: 244 IQIFVHLLRFLGSRR 258
           I +F+ LLR LG RR
Sbjct: 222 INLFLMLLRILGDRR 236


>gi|37525454|ref|NP_928798.1| hypothetical protein plu1503 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36784882|emb|CAE13796.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 236

 Score =  162 bits (409), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 105/247 (42%), Positives = 148/247 (59%), Gaps = 25/247 (10%)

Query: 18  GSTIDQ---GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           GS I Q   GL+ YM +VY  M  GL +T  +++ V+               N+ V+L  
Sbjct: 9   GSIIQQAGTGLQTYMAQVYGWMTCGLLLTAFVAWYVSQ--------------NQNVVLYI 54

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           F      S L +  I A  G+   L+  ++ + A  A  +F+LYSAL GL+LSS F++YT
Sbjct: 55  FS----NSILFYGLIIAQFGLVFVLSGMINRIGASLATGLFMLYSALTGLTLSSIFVIYT 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             S+  TF +TA  FG+LS YGYTTKR L  +GSF+ MG  G+ L SL+NL+++S A+  
Sbjct: 111 IGSVASTFVVTAGMFGALSFYGYTTKRSLSGLGSFLFMGLIGIILASLINLWLKSEALTW 170

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLL 251
            ++ +G+VIF+ LTAYDTQK+KE   D  DV   E   + S++GAL LY+DFI +F+ LL
Sbjct: 171 AVTYIGVVIFAGLTAYDTQKLKEMGED-LDVNDKENLRKFSIVGALTLYLDFINMFLMLL 229

Query: 252 RFLGSRR 258
           R  G RR
Sbjct: 230 RIFGDRR 236


>gi|190571220|ref|YP_001975578.1| hypothetical protein WPa_0820 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018620|ref|ZP_03334428.1| putative membrane protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357492|emb|CAQ54928.1| Putative membrane protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995571|gb|EEB56211.1| putative membrane protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 240

 Score =  162 bits (409), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 94/248 (37%), Positives = 157/248 (63%), Gaps = 29/248 (11%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MS ++N Q + + G  + +    GLR+Y+ +VYN MAL LGVTG+++FL           
Sbjct: 1   MSYMKNEQDIRSQGVYYSA----GLRSYLTKVYNYMALALGVTGLVAFLT---------- 46

Query: 61  AASIIINRGVMLTGFGALMYTSP-LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                     + +G   ++Y++P L  + + +P+ +  +++ RL  LSA +   +F L+S
Sbjct: 47  ----------VFSGLFQVIYSNPVLSLVVMLSPVALVFYMSFRLQHLSAQSTLTVFFLFS 96

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
            L+G+SLS  F++YT+++I + FFIT+  FGS++LYG TTK+DL  +GSF+IMG +GL +
Sbjct: 97  VLMGISLSHIFIIYTAENIARAFFITSIMFGSMALYGNTTKKDLTSMGSFLIMGIWGLII 156

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEA---YSDRYDVAYAERQSVIGA 236
            S+VNLF+ SS +   +S + +++F+ +TAYD Q+IK+    Y+D  +VA   + +++GA
Sbjct: 157 ASIVNLFLGSSPLYFAISFVSVIVFTLMTAYDAQRIKDVYYRYNDGSEVA-TTKLAILGA 215

Query: 237 LMLYMDFI 244
             LY DFI
Sbjct: 216 TNLYFDFI 223


>gi|126735097|ref|ZP_01750843.1| hypothetical protein RCCS2_14509 [Roseobacter sp. CCS2]
 gi|126715652|gb|EBA12517.1| hypothetical protein RCCS2_14509 [Roseobacter sp. CCS2]
          Length = 245

 Score =  161 bits (408), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 147/247 (59%), Gaps = 24/247 (9%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVN----ILATTVDPDAASIIINRGVMLTG 74
           + ID+GLRA+M +VY  M++G+ +T  +++ V     +L    DP   S           
Sbjct: 16  AEIDEGLRAHMNKVYGTMSVGMLITFAVAWAVGTSPALLGVFRDPVTLS----------- 64

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
                  + L WI +FAPL +       ++  SA AA+  F  ++A++GLS++  F+ +T
Sbjct: 65  ------PNILGWIVMFAPLAMVFGFGAMINRFSAAAAQTFFYAFAAVMGLSMAWIFVAFT 118

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI   F IT+ +F  LSLYGYTTK+D+   G+F+IMG  GL +  +VN+F++S AI  
Sbjct: 119 GLSIANVFLITSIAFAGLSLYGYTTKKDISGWGTFLIMGVIGLIVAMVVNIFLQSPAIMF 178

Query: 195 TMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLL 251
            +S +G++IF+ LTAYDTQKIK    A++   D  +  + +++GAL LY+DFI +F+ LL
Sbjct: 179 AISILGVLIFAGLTAYDTQKIKNDYIAHAAHGDQEWLAKSAIMGALNLYLDFINMFMFLL 238

Query: 252 RFLGSRR 258
           +  GSR 
Sbjct: 239 QLFGSRE 245


>gi|317047404|ref|YP_004115052.1| hypothetical protein Pat9b_1174 [Pantoea sp. At-9b]
 gi|316949021|gb|ADU68496.1| protein of unknown function UPF0005 [Pantoea sp. At-9b]
          Length = 235

 Score =  161 bits (408), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 104/238 (43%), Positives = 139/238 (58%), Gaps = 22/238 (9%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M  GL +T  +S+     A         +  NR   +T FG       
Sbjct: 17  GLQTYMAQVYGWMTCGLLLTAFVSWF----AARTPAVMELVFANR---ITFFG------- 62

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L V   L+  +H LS   A  +F+LYSAL GL+L+S FLVYT  SI  TFF
Sbjct: 63  ----LIIAQLAVVFVLSGMVHRLSGALATALFMLYSALTGLTLASIFLVYTYSSIASTFF 118

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++S YGYTTKRDL   GS + M   G+ L SLVN +++S A+   ++ +G+V+
Sbjct: 119 VTAGMFGAMSFYGYTTKRDLSRFGSLLFMALIGILLASLVNFWLKSPALMWAITYIGVVV 178

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K A  +  DV   E   R S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 179 FVGLTAYDTQKLK-AIGETVDVNDKENLRRLSIMGALTLYLDFINLFLMLLRIFGNRR 235


>gi|310816680|ref|YP_003964644.1| hypothetical protein EIO_2248 [Ketogulonicigenium vulgare Y25]
 gi|308755415|gb|ADO43344.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 209

 Score =  161 bits (407), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 130/189 (68%), Gaps = 1/189 (0%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           IDQGL+A+M +VY  M++G+ +T + ++ V+ LA T DP+AA+  +     LT FG  +Y
Sbjct: 18  IDQGLKAHMNKVYGTMSIGMVITALAAWAVSGLAVTTDPNAAAAQMGS-RYLTDFGYALY 76

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            SPL+W+ +  P+G+       ++ +SA  A++ F +Y+A +GLSLSS FL+YT  SIVQ
Sbjct: 77  ASPLKWVIMLLPIGMVFAFGALINRVSAAGAQLFFYVYAAAMGLSLSSIFLIYTGTSIVQ 136

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            F ITA +F +LSLYGYTTKRD+   G+F+IMG  GL +  +VN+F+ S  + + +S +G
Sbjct: 137 VFLITAIAFAALSLYGYTTKRDISGWGTFLIMGLVGLLVAMIVNIFIGSGPLAMAISVLG 196

Query: 201 LVIFSALTA 209
           +++F+ LTA
Sbjct: 197 VLLFAGLTA 205


>gi|330993472|ref|ZP_08317407.1| hypothetical protein SXCC_03371 [Gluconacetobacter sp. SXCC-1]
 gi|329759502|gb|EGG76011.1| hypothetical protein SXCC_03371 [Gluconacetobacter sp. SXCC-1]
          Length = 259

 Score =  161 bits (407), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 153/243 (62%), Gaps = 10/243 (4%)

Query: 20  TIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALM 79
           ++D GLRAYM+RVYN MA GL +TG++++L+   A T        +  + V L   G  +
Sbjct: 21  SVDMGLRAYMLRVYNWMASGLVLTGLVAYLI---ANT----GLQALFYQHVPLPMGGVAL 73

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIV 139
             + L  + + APLG  + ++  ++ LS    + +F L+  ++G S+S+ F+V+T  S+ 
Sbjct: 74  RPTALSMLAMIAPLGFVLVMSFGVNRLSTQTVQTLFWLFCGVMGASMSNIFMVFTGVSVT 133

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
           + FFITAA+F ++S++GYTT+ DL   GSF++MG FGL +  LVN+F+ S  +    SA+
Sbjct: 134 RVFFITAATFCTMSIWGYTTRTDLSRFGSFLMMGLFGLVIAGLVNMFLHSPGLYFVYSAV 193

Query: 200 GLVIFSALTAYDTQKIKEAYSD--RYDVA-YAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           G+++F  LT +DTQ+IK  Y     Y+ A  A ++SV  AL LY++FI +F  LL+F+G 
Sbjct: 194 GVLLFVGLTMFDTQRIKATYQQFAYYEGADQAAKRSVYDALNLYLNFINLFQFLLQFMGV 253

Query: 257 RRD 259
           R +
Sbjct: 254 RSN 256


>gi|242280577|ref|YP_002992706.1| hypothetical protein Desal_3116 [Desulfovibrio salexigens DSM 2638]
 gi|242123471|gb|ACS81167.1| protein of unknown function UPF0005 [Desulfovibrio salexigens DSM
           2638]
          Length = 243

 Score =  161 bits (407), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 91/236 (38%), Positives = 146/236 (61%), Gaps = 11/236 (4%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           L A+M  +Y+ M+ GL  T  ++++     T   P   ++++ +          M    L
Sbjct: 17  LNAFMRGIYSWMSAGLLATAAVAWV-----TLSTPAVLNLVLAQNPETGAIAPTM----L 67

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
            W+     +G+  +L++R+  LS+ AA  +F+ YSAL GL+LS+  + YT+ SI QTF +
Sbjct: 68  FWVAAIGEIGLVFYLSMRISKLSSGAATGLFMAYSALNGLTLSTILIAYTAASIFQTFLV 127

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TA  FG++SLYG TT++DL  +G+FM+MG FG+ +  +VN FM+SSA+   +S +G+ IF
Sbjct: 128 TAGMFGAMSLYGLTTRKDLTGMGAFMMMGLFGILIAMVVNFFMQSSALTFAISVLGVFIF 187

Query: 205 SALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           + LTAYD+QK+K+   Y    D     R +++GAL LY+DFI +F+ LLR +G+R 
Sbjct: 188 AGLTAYDSQKLKDMGEYIPADDATAVRRGTILGALTLYLDFINMFIFLLRLMGNRE 243


>gi|194333989|ref|YP_002015849.1| hypothetical protein Paes_1173 [Prosthecochloris aestuarii DSM 271]
 gi|194311807|gb|ACF46202.1| protein of unknown function UPF0005 [Prosthecochloris aestuarii DSM
           271]
          Length = 240

 Score =  161 bits (407), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 146/230 (63%), Gaps = 20/230 (8%)

Query: 31  RVYNLMALGLGVTGIMSFLVNILATTVDPDA-ASIIINRGVMLTGFGALMYTSPLRWIFI 89
           +VY  M+LGL +T  + +       T   +A  +II + G++L G              +
Sbjct: 29  QVYTWMSLGLALTATVGYY------TAGTEALRNIIFSNGMVLIGL-------------V 69

Query: 90  FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASF 149
            A LG+   L+  ++ LSA AA  +F+LY+AL GL+ S+ FLVYTS SI  TFF+TA +F
Sbjct: 70  VAQLGIVFALSAAINRLSAAAATGLFILYAALTGLTFSAIFLVYTSVSIASTFFVTAGTF 129

Query: 150 GSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTA 209
            +++++G+TTKRDL  +GS   M   G+ L ++VN+F+++S ++L +SA+G+++F+ALTA
Sbjct: 130 AAMTVFGHTTKRDLTKLGSIAFMALIGIILATVVNMFLQNSLLELIVSAVGVLLFTALTA 189

Query: 210 YDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           YD Q+IK+  +         + +V+GAL LY+DFI +F+ LLRFLG  RD
Sbjct: 190 YDAQRIKDMAATVSGGESEAKVAVMGALALYLDFINLFLMLLRFLGVSRD 239


>gi|260432960|ref|ZP_05786931.1| integral membrane protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416788|gb|EEX10047.1| integral membrane protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 245

 Score =  161 bits (407), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 150/245 (61%), Gaps = 20/245 (8%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + ID+GLRA+M +VY  M++G+ +T  +++     A    P           +L+ F   
Sbjct: 16  AEIDEGLRAHMNKVYGTMSVGMLITFAVAW-----AVGTSPQ----------LLSVFRDP 60

Query: 79  MYTSP--LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK 136
           +  SP  L WI +FAPL +       ++ LSA  A++ F  ++A++GLS+S  F+ +T  
Sbjct: 61  VTLSPNILGWIVMFAPLAMVFGFGAAINRLSAAGAQLFFYAFAAVMGLSMSWIFVAFTGI 120

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTM 196
           SI Q F +T+ +F  LSLYGY TK+DL  +G+F++MG  GL +  ++N+F++S AI   +
Sbjct: 121 SIAQVFLVTSIAFAGLSLYGYVTKKDLSGMGTFLMMGVIGLIVAMVINIFLQSPAIMFAV 180

Query: 197 SAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
           S +G++IF+ LTAYDTQ IK  Y   +   D  +  + +++GAL LY+DFI +F+ LL+ 
Sbjct: 181 SIIGVLIFAGLTAYDTQNIKTTYIQHAAHGDQEWLGKSAIMGALNLYLDFINMFMFLLQL 240

Query: 254 LGSRR 258
           LG+R 
Sbjct: 241 LGNRE 245


>gi|333006904|gb|EGK26400.1| hypothetical protein SFVA6_1204 [Shigella flexneri VA-6]
          Length = 234

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 142/237 (59%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++     A  ++     +  NR V L G         
Sbjct: 16  GLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMEL----LFTNR-VFLIGL-------- 62

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF 
Sbjct: 63  -----IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++SLYGYTTKRDL  +G+ + M   G+ L SLVN +++S A+   ++ +G+++
Sbjct: 118 VTAGMFGAMSLYGYTTKRDLSGLGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIV 177

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 FVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|284920635|emb|CBG33697.1| putative membrane protein [Escherichia coli 042]
          Length = 234

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 142/237 (59%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++     A  ++     +  NR V L G         
Sbjct: 16  GLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMEL----LFTNR-VFLIGL-------- 62

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L + I L+  +  LSA A  M+F+LYSAL GL+LSS F+VYT+ SI  TF 
Sbjct: 63  -----IIAQLALVIVLSAMIQKLSAGATTMLFMLYSALTGLTLSSIFIVYTAASIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++SLYGYTTKRDL   G+ + M   G+ + SLVN +++S A+   ++ +G+++
Sbjct: 118 VTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVIASLVNFWLKSEALMWAVTYIGVIV 177

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 FVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|296532709|ref|ZP_06895397.1| secY stabilizing membrane protein [Roseomonas cervicalis ATCC
           49957]
 gi|296266962|gb|EFH12899.1| secY stabilizing membrane protein [Roseomonas cervicalis ATCC
           49957]
          Length = 262

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 97/247 (39%), Positives = 153/247 (61%), Gaps = 26/247 (10%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLV-----NILATTVDPDAASIIINRGVMLTGFGAL 78
           GLR+YM+RVYN MA GL VT I+++++     + L  TV       ++ +  +L GF A+
Sbjct: 30  GLRSYMLRVYNWMASGLLVTAIVAYVIANTGLSELFYTVGRSPRGFVVTQPTIL-GFAAM 88

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +           APL   + L+  ++ +S   A+ +F L+   +G S+++ F+VY   S+
Sbjct: 89  L-----------APLAFVLVLSFGINRMSKTTAQGLFWLFCTAMGASMANIFVVYVGASV 137

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
             TFF+TA+ F ++SLYGYTTKRDL  +G+FM+MG  G+ + SLVN+F+ S  +   +S 
Sbjct: 138 ASTFFVTASMFAAISLYGYTTKRDLTKLGAFMMMGLIGIIIASLVNMFVGSGMMAFVISV 197

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAE------RQSVIGALMLYMDFIQIFVHLLR 252
           +G+V+F  LTAYDTQ+IK   +D  + AYAE      ++SV  AL LY++FI +F  +L+
Sbjct: 198 IGVVVFVGLTAYDTQRIK---ADYVEFAYAEGTDEAAKRSVFDALGLYLNFINLFQLMLQ 254

Query: 253 FLGSRRD 259
           F+G R+ 
Sbjct: 255 FMGVRQQ 261


>gi|254796448|ref|YP_003081284.1| membrane protein [Neorickettsia risticii str. Illinois]
 gi|254589698|gb|ACT69060.1| membrane protein [Neorickettsia risticii str. Illinois]
          Length = 206

 Score =  160 bits (406), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 89/225 (39%), Positives = 137/225 (60%), Gaps = 21/225 (9%)

Query: 36  MALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGV 95
           MA  LG+TG+ +F V                +   ML+    L+Y +PL+W+ +FAP+  
Sbjct: 1   MAAALGITGLTAFFVA---------------SSPAMLS----LLYQTPLQWVVMFAPIVF 41

Query: 96  FIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLY 155
            +  + R+ S+++  A+ +F  +S L+GLSLS  F+ YT  S+ + FFI A  FG++++Y
Sbjct: 42  VVVFSTRILSMTSEKARGLFWCFSVLMGLSLSWVFIAYTGASVARVFFIAATMFGTMAIY 101

Query: 156 GYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKI 215
           G  T+ DL  +GSF+ MG  G+ + +LVN+F+ S AI   +SA+G+VIF+ LTAYD Q+I
Sbjct: 102 GNNTRTDLTAMGSFLTMGVVGILIAALVNIFLASPAIYFAVSALGVVIFTGLTAYDVQRI 161

Query: 216 KEAY--SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++ Y  S   D     + +V+GAL LY DFI IFV LL  +G R+
Sbjct: 162 RDLYYFSVNADEEALSKIAVVGALTLYFDFINIFVSLLNLMGERK 206


>gi|30062271|ref|NP_836442.1| hypothetical protein S0777 [Shigella flexneri 2a str. 2457T]
 gi|56479729|ref|NP_706664.2| hypothetical protein SF0736 [Shigella flexneri 2a str. 301]
 gi|30040516|gb|AAP16248.1| hypothetical protein S0777 [Shigella flexneri 2a str. 2457T]
 gi|56383280|gb|AAN42371.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|313650316|gb|EFS14728.1| hypothetical protein SF2457T_1322 [Shigella flexneri 2a str. 2457T]
 gi|332760463|gb|EGJ90752.1| hypothetical protein SF274771_0892 [Shigella flexneri 2747-71]
 gi|332763276|gb|EGJ93518.1| hypothetical protein SFK671_0853 [Shigella flexneri K-671]
 gi|333021200|gb|EGK40456.1| hypothetical protein SFK304_0970 [Shigella flexneri K-304]
          Length = 234

 Score =  160 bits (406), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 141/237 (59%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++     A  ++     +  NR V L G         
Sbjct: 16  GLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMEL----LFTNR-VFLIGL-------- 62

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF 
Sbjct: 63  -----IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++
Sbjct: 118 VTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIV 177

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 FVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|170680930|ref|YP_001742889.1| hypothetical protein EcSMS35_0809 [Escherichia coli SMS-3-5]
 gi|218699158|ref|YP_002406787.1| hypothetical protein ECIAI39_0762 [Escherichia coli IAI39]
 gi|170518648|gb|ACB16826.1| putative membrane protein [Escherichia coli SMS-3-5]
 gi|218369144|emb|CAR16899.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli IAI39]
          Length = 234

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/238 (39%), Positives = 145/238 (60%), Gaps = 22/238 (9%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++           ++A+++            L++T+ 
Sbjct: 16  GLQTYMAQVYGWMTVGLLLTAFVAWYA--------ANSAAVM-----------ELLFTNR 56

Query: 84  LRWI-FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
           +  I  + A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 57  IFLIGLVIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 117 VVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 176

Query: 203 IFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|332342118|gb|AEE55452.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 234

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 145/238 (60%), Gaps = 22/238 (9%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++           ++A+++            L++T+ 
Sbjct: 16  GLQTYMAQVYGWMTVGLLLTAFVAWYA--------ANSAAVM-----------ELLFTNR 56

Query: 84  LRWI-FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
           +  I  I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 57  VFLIGLIIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 117 VVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 176

Query: 203 IFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|198276085|ref|ZP_03208616.1| hypothetical protein BACPLE_02272 [Bacteroides plebeius DSM 17135]
 gi|198270897|gb|EDY95167.1| hypothetical protein BACPLE_02272 [Bacteroides plebeius DSM 17135]
          Length = 233

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 127/183 (69%), Gaps = 2/183 (1%)

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           +M  S + W  + A +G+ ++L+ R+H +S   A ++F+ YS L G+++S  FL+YT  S
Sbjct: 51  IMQNSIMFWGLLIAEVGLVMYLSARIHKISFTTATLLFIAYSVLNGVTMSVLFLIYTLSS 110

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           I  TFF+TA +FG  +LYGY TK+DL  IGS  +MG  GL + SLVN+F+ +S +D+ +S
Sbjct: 111 IATTFFVTAGTFGVTALYGYVTKKDLTRIGSLCLMGVIGLIIASLVNMFLHNSMMDMIIS 170

Query: 198 AMGLVIFSALTAYDTQKIKEAYS-DRYDV-AYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
            +G+++F  LTAYD+QKIK+  S D  +V    ++ +++GAL LY+DFI +F++LLR LG
Sbjct: 171 YIGVLLFVGLTAYDSQKIKQLLSHDDIEVNETTQKIALMGALTLYLDFINLFIYLLRILG 230

Query: 256 SRR 258
            R+
Sbjct: 231 DRK 233


>gi|16128754|ref|NP_415307.1| inner membrane protein, UPF0005 family [Escherichia coli str. K-12
           substr. MG1655]
 gi|74311330|ref|YP_309749.1| hypothetical protein SSON_0765 [Shigella sonnei Ss046]
 gi|82543233|ref|YP_407180.1| hypothetical protein SBO_0673 [Shigella boydii Sb227]
 gi|89107637|ref|AP_001417.1| predicted inner membrane protein [Escherichia coli str. K-12
           substr. W3110]
 gi|91209817|ref|YP_539803.1| hypothetical protein UTI89_C0786 [Escherichia coli UTI89]
 gi|110640990|ref|YP_668718.1| hypothetical protein ECP_0800 [Escherichia coli 536]
 gi|110804787|ref|YP_688307.1| hypothetical protein SFV_0769 [Shigella flexneri 5 str. 8401]
 gi|117622968|ref|YP_851881.1| hypothetical protein APECO1_1304 [Escherichia coli APEC O1]
 gi|157158723|ref|YP_001461974.1| hypothetical protein EcE24377A_0849 [Escherichia coli E24377A]
 gi|157160261|ref|YP_001457579.1| hypothetical protein EcHS_A0840 [Escherichia coli HS]
 gi|170020858|ref|YP_001725812.1| hypothetical protein EcolC_2857 [Escherichia coli ATCC 8739]
 gi|170080445|ref|YP_001729765.1| inner membrane protein [Escherichia coli str. K-12 substr. DH10B]
 gi|187733215|ref|YP_001881028.1| hypothetical protein SbBS512_E2566 [Shigella boydii CDC 3083-94]
 gi|188493130|ref|ZP_03000400.1| putative membrane protein [Escherichia coli 53638]
 gi|191169282|ref|ZP_03031032.1| putative membrane protein [Escherichia coli B7A]
 gi|191174497|ref|ZP_03035996.1| putative membrane protein [Escherichia coli F11]
 gi|193064456|ref|ZP_03045537.1| putative membrane protein [Escherichia coli E22]
 gi|193069370|ref|ZP_03050325.1| putative membrane protein [Escherichia coli E110019]
 gi|194428198|ref|ZP_03060741.1| putative membrane protein [Escherichia coli B171]
 gi|194438436|ref|ZP_03070526.1| putative membrane protein [Escherichia coli 101-1]
 gi|209918031|ref|YP_002292115.1| hypothetical protein ECSE_0840 [Escherichia coli SE11]
 gi|215485874|ref|YP_002328305.1| predicted inner membrane protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218553369|ref|YP_002386282.1| hypothetical protein ECIAI1_0821 [Escherichia coli IAI1]
 gi|218557691|ref|YP_002390604.1| hypothetical protein ECS88_0803 [Escherichia coli S88]
 gi|218688572|ref|YP_002396784.1| hypothetical protein ECED1_0751 [Escherichia coli ED1a]
 gi|218694259|ref|YP_002401926.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli 55989]
 gi|218704164|ref|YP_002411683.1| hypothetical protein ECUMN_0929 [Escherichia coli UMN026]
 gi|238900045|ref|YP_002925841.1| putative inner membrane protein [Escherichia coli BW2952]
 gi|253774211|ref|YP_003037042.1| hypothetical protein ECBD_2837 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160863|ref|YP_003043971.1| putative inner membrane protein [Escherichia coli B str. REL606]
 gi|256021144|ref|ZP_05435009.1| predicted inner membrane protein [Shigella sp. D9]
 gi|256023618|ref|ZP_05437483.1| predicted inner membrane protein [Escherichia sp. 4_1_40B]
 gi|260843028|ref|YP_003220806.1| putative inner membrane protein [Escherichia coli O103:H2 str.
           12009]
 gi|260854077|ref|YP_003227968.1| putative inner membrane protein [Escherichia coli O26:H11 str.
           11368]
 gi|260866953|ref|YP_003233355.1| putative inner membrane protein [Escherichia coli O111:H- str.
           11128]
 gi|293404087|ref|ZP_06648081.1| inner membrane protein ybhL [Escherichia coli FVEC1412]
 gi|293409164|ref|ZP_06652740.1| conserved hypothetical protein [Escherichia coli B354]
 gi|298379868|ref|ZP_06989473.1| inner membrane protein ybhL [Escherichia coli FVEC1302]
 gi|306812812|ref|ZP_07447005.1| putative inner membrane protein [Escherichia coli NC101]
 gi|307137410|ref|ZP_07496766.1| putative inner membrane protein [Escherichia coli H736]
 gi|307313804|ref|ZP_07593421.1| protein of unknown function UPF0005 [Escherichia coli W]
 gi|331641299|ref|ZP_08342434.1| inner membrane protein YbhL [Escherichia coli H736]
 gi|331656803|ref|ZP_08357765.1| inner membrane protein YbhL [Escherichia coli TA206]
 gi|331662141|ref|ZP_08363064.1| inner membrane protein YbhL [Escherichia coli TA143]
 gi|331667149|ref|ZP_08368014.1| inner membrane protein YbhL [Escherichia coli TA271]
 gi|331676520|ref|ZP_08377216.1| inner membrane protein YbhL [Escherichia coli H591]
 gi|331682293|ref|ZP_08382912.1| inner membrane protein YbhL [Escherichia coli H299]
 gi|332282371|ref|ZP_08394784.1| inner membrane protein [Shigella sp. D9]
 gi|84027847|sp|P0AAC4|YBHL_ECOLI RecName: Full=Inner membrane protein YbhL
 gi|85700282|sp|P0AAC5|YBHL_ECOL6 RecName: Full=Inner membrane protein YbhL
 gi|1787004|gb|AAC73873.1| inner membrane protein, UPF0005 family [Escherichia coli str. K-12
           substr. MG1655]
 gi|4062342|dbj|BAA35444.1| predicted inner membrane protein [Escherichia coli str. K12 substr.
           W3110]
 gi|73854807|gb|AAZ87514.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81244644|gb|ABB65352.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|91071391|gb|ABE06272.1| hypothetical protein UTI89_C0786 [Escherichia coli UTI89]
 gi|110342582|gb|ABG68819.1| putative membrane protein [Escherichia coli 536]
 gi|110614335|gb|ABF03002.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|115512092|gb|ABJ00167.1| conserved hypothetical protein YbhL [Escherichia coli APEC O1]
 gi|157065941|gb|ABV05196.1| putative membrane protein [Escherichia coli HS]
 gi|157080753|gb|ABV20461.1| putative membrane protein [Escherichia coli E24377A]
 gi|169755786|gb|ACA78485.1| protein of unknown function UPF0005 [Escherichia coli ATCC 8739]
 gi|169888280|gb|ACB01987.1| predicted inner membrane protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|187430207|gb|ACD09481.1| putative membrane protein [Shigella boydii CDC 3083-94]
 gi|188488329|gb|EDU63432.1| putative membrane protein [Escherichia coli 53638]
 gi|190900671|gb|EDV60470.1| putative membrane protein [Escherichia coli B7A]
 gi|190905210|gb|EDV64850.1| putative membrane protein [Escherichia coli F11]
 gi|192928918|gb|EDV82531.1| putative membrane protein [Escherichia coli E22]
 gi|192957323|gb|EDV87771.1| putative membrane protein [Escherichia coli E110019]
 gi|194413758|gb|EDX30037.1| putative membrane protein [Escherichia coli B171]
 gi|194422660|gb|EDX38657.1| putative membrane protein [Escherichia coli 101-1]
 gi|209911290|dbj|BAG76364.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215263946|emb|CAS08286.1| predicted inner membrane protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218350991|emb|CAU96695.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli 55989]
 gi|218360137|emb|CAQ97686.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli IAI1]
 gi|218364460|emb|CAR02142.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli S88]
 gi|218426136|emb|CAR06956.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli ED1a]
 gi|218431261|emb|CAR12138.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli UMN026]
 gi|222032517|emb|CAP75256.1| Inner membrane protein ybhL [Escherichia coli LF82]
 gi|238862537|gb|ACR64535.1| predicted inner membrane protein [Escherichia coli BW2952]
 gi|242376578|emb|CAQ31287.1| predicted inner membrane protein [Escherichia coli BL21(DE3)]
 gi|253325255|gb|ACT29857.1| protein of unknown function UPF0005 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972764|gb|ACT38435.1| predicted inner membrane protein [Escherichia coli B str. REL606]
 gi|253976984|gb|ACT42654.1| predicted inner membrane protein [Escherichia coli BL21(DE3)]
 gi|257752726|dbj|BAI24228.1| predicted inner membrane protein [Escherichia coli O26:H11 str.
           11368]
 gi|257758175|dbj|BAI29672.1| predicted inner membrane protein [Escherichia coli O103:H2 str.
           12009]
 gi|257763309|dbj|BAI34804.1| predicted inner membrane protein [Escherichia coli O111:H- str.
           11128]
 gi|260450067|gb|ACX40489.1| protein of unknown function UPF0005 [Escherichia coli DH1]
 gi|281177922|dbj|BAI54252.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|291428673|gb|EFF01698.1| inner membrane protein ybhL [Escherichia coli FVEC1412]
 gi|291469632|gb|EFF12116.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294489671|gb|ADE88427.1| putative membrane protein [Escherichia coli IHE3034]
 gi|298279566|gb|EFI21074.1| inner membrane protein ybhL [Escherichia coli FVEC1302]
 gi|305853575|gb|EFM54014.1| putative inner membrane protein [Escherichia coli NC101]
 gi|306906444|gb|EFN36958.1| protein of unknown function UPF0005 [Escherichia coli W]
 gi|307552631|gb|ADN45406.1| inner membrane protein [Escherichia coli ABU 83972]
 gi|307627804|gb|ADN72108.1| putative inner membrane protein [Escherichia coli UM146]
 gi|309701062|emb|CBJ00360.1| putative membrane protein [Escherichia coli ETEC H10407]
 gi|312945304|gb|ADR26131.1| putative inner membrane protein [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315060022|gb|ADT74349.1| predicted inner membrane protein [Escherichia coli W]
 gi|315135436|dbj|BAJ42595.1| YbhL protein [Escherichia coli DH1]
 gi|320183275|gb|EFW58130.1| Putative membrane protein [Shigella flexneri CDC 796-83]
 gi|320198975|gb|EFW73572.1| Putative membrane protein [Escherichia coli EC4100B]
 gi|323155693|gb|EFZ41864.1| hypothetical protein ECEPECA14_2410 [Escherichia coli EPECa14]
 gi|323175596|gb|EFZ61191.1| hypothetical protein ECOK1180_5881 [Escherichia coli 1180]
 gi|323938141|gb|EGB34401.1| inner membrane protein ybhL [Escherichia coli E1520]
 gi|323942659|gb|EGB38824.1| inner membrane protein ybhL [Escherichia coli E482]
 gi|323947057|gb|EGB43070.1| inner membrane protein ybhL [Escherichia coli H120]
 gi|323953551|gb|EGB49417.1| inner membrane protein ybhL [Escherichia coli H252]
 gi|323958075|gb|EGB53784.1| inner membrane protein ybhL [Escherichia coli H263]
 gi|323963033|gb|EGB58604.1| inner membrane protein ybhL [Escherichia coli H489]
 gi|323971951|gb|EGB67172.1| inner membrane protein ybhL [Escherichia coli TA007]
 gi|324116209|gb|EGC10131.1| inner membrane protein ybhL [Escherichia coli E1167]
 gi|330910531|gb|EGH39041.1| putative membrane protein [Escherichia coli AA86]
 gi|331038097|gb|EGI10317.1| inner membrane protein YbhL [Escherichia coli H736]
 gi|331055051|gb|EGI27060.1| inner membrane protein YbhL [Escherichia coli TA206]
 gi|331060563|gb|EGI32527.1| inner membrane protein YbhL [Escherichia coli TA143]
 gi|331065505|gb|EGI37398.1| inner membrane protein YbhL [Escherichia coli TA271]
 gi|331075209|gb|EGI46507.1| inner membrane protein YbhL [Escherichia coli H591]
 gi|331079924|gb|EGI51103.1| inner membrane protein YbhL [Escherichia coli H299]
 gi|332104723|gb|EGJ08069.1| inner membrane protein [Shigella sp. D9]
 gi|333020437|gb|EGK39700.1| hypothetical protein SFK227_0951 [Shigella flexneri K-227]
          Length = 234

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 141/237 (59%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++     A  ++     +  NR V L G         
Sbjct: 16  GLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMEL----LFTNR-VFLIGL-------- 62

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF 
Sbjct: 63  -----IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++
Sbjct: 118 VTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIV 177

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 FVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|158521735|ref|YP_001529605.1| hypothetical protein Dole_1724 [Desulfococcus oleovorans Hxd3]
 gi|158510561|gb|ABW67528.1| protein of unknown function UPF0005 [Desulfococcus oleovorans Hxd3]
          Length = 235

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 139/231 (60%), Gaps = 21/231 (9%)

Query: 32  VYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFA 91
           VYN MA+GL +TG +++ V                N  ++   FG       L +  I A
Sbjct: 23  VYNWMAVGLALTGFLAYYVAH--------------NETMLRIVFG----NQALFFGLIIA 64

Query: 92  PLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGS 151
            LG+  +L+ R+  + A  A  +F++Y+ L G++LS  F+ YT+ SI  TFF+ AA+FG 
Sbjct: 65  ELGLVFYLSARIQKIEATTATALFIIYAMLNGVTLSFIFIAYTAASIASTFFVCAATFGV 124

Query: 152 LSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYD 211
            S+YG  TK+DL  +G FM MG  G+ + S+VN+F+RS A+++ +S +G+ +F  LTAYD
Sbjct: 125 CSIYGMVTKKDLTSVGQFMFMGLIGIIIASVVNIFLRSPAMNMIISYIGVFVFVGLTAYD 184

Query: 212 TQKIKE---AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           TQK+K       +  D A A + +++GAL LY+DFI +F+ LLR LG+ RD
Sbjct: 185 TQKLKHMALTQPEGLDPAVARKGAIMGALTLYLDFINMFLFLLRILGASRD 235


>gi|261341371|ref|ZP_05969229.1| putative membrane protein [Enterobacter cancerogenus ATCC 35316]
 gi|288316682|gb|EFC55620.1| putative membrane protein [Enterobacter cancerogenus ATCC 35316]
          Length = 235

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 143/237 (60%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T   +F+    A T  P+    I +  +  T FG       
Sbjct: 17  GLQTYMAQVYGWMTVGLLLT---AFIAWYAANT--PELMMFIFSSKI--TFFG------- 62

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L +   L+  +H LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF 
Sbjct: 63  ----LIIAQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTFV 118

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +    FG++SLYGYTTKRDL  +GS + MG  G+ L SLVNL+++S A+   ++ +G+V+
Sbjct: 119 VAGGMFGAMSLYGYTTKRDLSGLGSMLFMGLIGIVLASLVNLWLKSEALMWAVTYIGVVV 178

Query: 204 FSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K   +  D  D     + S++GAL LY+DFI +F+ LLR LG+RR
Sbjct: 179 FVGLTAYDTQKLKNIGNQIDVRDGTTLRKYSILGALTLYLDFINLFLMLLRILGNRR 235


>gi|325300371|ref|YP_004260288.1| hypothetical protein Bacsa_3289 [Bacteroides salanitronis DSM
           18170]
 gi|324319924|gb|ADY37815.1| protein of unknown function UPF0005 [Bacteroides salanitronis DSM
           18170]
          Length = 235

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/239 (39%), Positives = 147/239 (61%), Gaps = 21/239 (8%)

Query: 23  QGLRAYMIR-VYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + ++A ++R VY  M L L +TG++S  V          A S         T    ++  
Sbjct: 15  KTVQATLMRNVYTWMTLALVITGLVSLYV----------AKS--------YTLLSMIVQN 56

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
             L W  + A +G+ I+L+ R+H ++   A ++F+ YS L G++L+  F+VYT  SI  T
Sbjct: 57  QMLFWGLLIAEIGLVIYLSARIHRIAFSTATLLFIAYSILNGITLAFIFMVYTMSSIATT 116

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FF+TA +FG ++LYGY TKRDL  IG+  IM   GL + SLVNLF+ +S +DL +S +G+
Sbjct: 117 FFVTAGTFGVMALYGYVTKRDLTRIGNICIMALIGLIIASLVNLFLHNSMMDLIISGIGV 176

Query: 202 VIFSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +IF+ LTAYD+QKIK   +  D       ++ +++GA+ LY+DFI +F++LLRFLG R+
Sbjct: 177 LIFTGLTAYDSQKIKHLLTGEDMEVNDTTQKIALMGAMTLYLDFINLFLYLLRFLGDRK 235


>gi|293414066|ref|ZP_06656715.1| ybhL protein [Escherichia coli B185]
 gi|293433047|ref|ZP_06661475.1| ybhL protein [Escherichia coli B088]
 gi|331651789|ref|ZP_08352808.1| inner membrane protein YbhL [Escherichia coli M718]
 gi|331672297|ref|ZP_08373088.1| inner membrane protein YbhL [Escherichia coli TA280]
 gi|254966706|gb|ACT97342.1| putative amikacin resistance protein [mixed culture bacterium
           AM_gF1DD01_12]
 gi|291323866|gb|EFE63288.1| ybhL protein [Escherichia coli B088]
 gi|291434124|gb|EFF07097.1| ybhL protein [Escherichia coli B185]
 gi|323379419|gb|ADX51687.1| protein of unknown function UPF0005 [Escherichia coli KO11]
 gi|331050067|gb|EGI22125.1| inner membrane protein YbhL [Escherichia coli M718]
 gi|331070492|gb|EGI41856.1| inner membrane protein YbhL [Escherichia coli TA280]
          Length = 261

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 96/237 (40%), Positives = 140/237 (59%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++     A  ++     ++    V L G         
Sbjct: 43  GLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVME-----LLFTNRVFLIGL-------- 89

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF 
Sbjct: 90  -----IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFV 144

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++
Sbjct: 145 VTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIV 204

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 205 FVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 261


>gi|26246758|ref|NP_752798.1| hypothetical protein c0868 [Escherichia coli CFT073]
 gi|26107157|gb|AAN79341.1|AE016757_245 Hypothetical protein ybhL [Escherichia coli CFT073]
          Length = 261

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 96/237 (40%), Positives = 140/237 (59%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++     A  ++     ++    V L G         
Sbjct: 43  GLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVME-----LLFTNRVFLIGL-------- 89

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF 
Sbjct: 90  -----IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFV 144

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++
Sbjct: 145 VTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIV 204

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 205 FVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 261


>gi|58579608|ref|YP_197820.1| hypothetical protein ERWE_CDS_09440 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58617662|ref|YP_196861.1| hypothetical protein ERGA_CDS_09350 [Ehrlichia ruminantium str.
           Gardel]
 gi|58417274|emb|CAI28387.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel]
 gi|58418234|emb|CAI27438.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 234

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 87/238 (36%), Positives = 149/238 (62%), Gaps = 23/238 (9%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GLR Y+++VYN MA+ LG+TG+++F V+         ++S  IN          ++Y +P
Sbjct: 17  GLRNYLMKVYNYMAMALGLTGLVAFFVS---------SSSYAIN----------IIYNTP 57

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           L W+ +F+P+ +   ++ +L + S     ++F  ++AL+G S+SS FL+YT+ SI + FF
Sbjct: 58  LHWVIMFSPIVLVFLMSYKLSTFSFQTVLVVFFSFAALMGASISSIFLIYTAASITKVFF 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           I+++ FG+++ YG  TK+DL    SF+IMG  G+ + SLVNLF+ +  +D  +S + +++
Sbjct: 118 ISSSMFGAMAWYGNVTKKDLSQFQSFLIMGIIGVIIASLVNLFLHNGPLDFAISFIAVIL 177

Query: 204 FSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F+ +TA D Q+IK+ Y   +D   V+   + +V+GA  LY ++I IF+ LL   G RR
Sbjct: 178 FTGMTACDAQRIKDMYYRFNDGNSVS-LNKMAVLGATTLYFNYINIFLSLLNLQGERR 234


>gi|224369658|ref|YP_002603822.1| putative cold-shock inducible membrane protein [Desulfobacterium
           autotrophicum HRM2]
 gi|223692375|gb|ACN15658.1| putative cold-shock inducible membrane protein [Desulfobacterium
           autotrophicum HRM2]
          Length = 235

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 145/239 (60%), Gaps = 23/239 (9%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP- 83
           + +++  VYN MA+GL +TG  +F V+               N  +M   FG     +P 
Sbjct: 16  VNSFIRSVYNWMAIGLALTGFTAFYVSG--------------NETLMRAIFG-----NPV 56

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           L +  IF  LG+  +L+ R+  + A  A  +F++YS L G++LSS F+VYTS SIV TFF
Sbjct: 57  LLFGLIFGELGLVFYLSARVQKIQASTATALFVVYSILNGVTLSSIFMVYTSTSIVSTFF 116

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           I A +F   S+YG  TKRDL  +G FM+MG  G+ + +LVN+F RS A+ + +S +G+++
Sbjct: 117 ICALTFSVCSVYGMVTKRDLTSMGGFMMMGLIGIIVATLVNMFFRSPAMSMLISYVGVIV 176

Query: 204 FSALTAYDTQKIKE-AYSDRYDV--AYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           F  LTAYDTQK+K  A +   D+  A   + +++GAL LY+DFI +F+ LLR  G  RD
Sbjct: 177 FVGLTAYDTQKLKNMAMTQPADLSGAVVRKGAIMGALTLYLDFINLFLMLLRIFGGSRD 235


>gi|331646003|ref|ZP_08347106.1| inner membrane protein YbhL [Escherichia coli M605]
 gi|331044755|gb|EGI16882.1| inner membrane protein YbhL [Escherichia coli M605]
          Length = 234

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 96/237 (40%), Positives = 140/237 (59%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++     A  ++     ++    V L G         
Sbjct: 16  GLQTYMAQVYGWMIVGLLLTAFVAWYAANSAAVME-----LLFTNRVFLIGL-------- 62

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF 
Sbjct: 63  -----IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++
Sbjct: 118 VTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIV 177

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 FVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|238763836|ref|ZP_04624794.1| Inner membrane protein YbhL [Yersinia kristensenii ATCC 33638]
 gi|238697966|gb|EEP90725.1| Inner membrane protein YbhL [Yersinia kristensenii ATCC 33638]
          Length = 254

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 100/260 (38%), Positives = 147/260 (56%), Gaps = 20/260 (7%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M  +    R   S        + G++AYM +VY  M  GL +T ++++           +
Sbjct: 13  MHKVTTMDRYPRSNGSIVERANSGIQAYMAQVYGWMTCGLLLTAVVAWYA--------AN 64

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
             SII           AL     L +  I A LG+   ++  ++ LS  AA  +F+LYSA
Sbjct: 65  TPSIIF----------ALQSNQILFFGLIIAQLGLVFVISGMINRLSGSAATSLFMLYSA 114

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L GL+LSS  ++YT  SI  TF I A  FG++SLYGYTTKRDL  +GS + MG  G+ L 
Sbjct: 115 LTGLTLSSILILYTGASIASTFVICAGMFGAMSLYGYTTKRDLSGLGSILFMGLIGIILA 174

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALM 238
           SLVN++++S A+   ++ +G+++F  LTAYDTQK+K   A  D  D     + +++GAL 
Sbjct: 175 SLVNIWLKSPALMWAVTYIGVLVFVGLTAYDTQKLKNMGAQLDANDKDGFRKYAIVGALT 234

Query: 239 LYMDFIQIFVHLLRFLGSRR 258
           LY+DFI +F+ LLR  G+RR
Sbjct: 235 LYLDFINLFLMLLRIFGNRR 254


>gi|57239618|ref|YP_180754.1| hypothetical protein Erum8920 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161697|emb|CAH58627.1| putative integral membrane protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 234

 Score =  159 bits (402), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 86/238 (36%), Positives = 149/238 (62%), Gaps = 23/238 (9%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GLR Y+++VYN MA+ LG+TG+++F V+         ++S  +N          ++Y +P
Sbjct: 17  GLRNYLMKVYNYMAMALGLTGLVAFFVS---------SSSYAVN----------IIYNTP 57

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           L W+ +F+P+ +   ++ +L + S     ++F  ++AL+G S+SS FL+YT+ SI + FF
Sbjct: 58  LHWVIMFSPIVLVFLMSYKLSTFSFQTVLVVFFSFAALMGASISSIFLIYTAASITKVFF 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           I+++ FG+++ YG  TK+DL    SF+IMG  G+ + SLVNLF+ +  +D  +S + +++
Sbjct: 118 ISSSMFGAMAWYGNVTKKDLSQFQSFLIMGIIGVIIASLVNLFLHNGPLDFAISFIAVIL 177

Query: 204 FSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F+ +TA D Q+IK+ Y   +D   V+   + +V+GA  LY ++I IF+ LL   G RR
Sbjct: 178 FTGMTACDAQRIKDMYYRFNDGNSVS-LNKMAVLGATTLYFNYINIFLSLLNLQGERR 234


>gi|170769092|ref|ZP_02903545.1| putative membrane protein [Escherichia albertii TW07627]
 gi|170122164|gb|EDS91095.1| putative membrane protein [Escherichia albertii TW07627]
          Length = 234

 Score =  159 bits (402), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 145/238 (60%), Gaps = 22/238 (9%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++           ++A+++            L++T+ 
Sbjct: 16  GLQTYMAQVYGWMTVGLLLTAFVAWYA--------ANSAALM-----------ELLFTNR 56

Query: 84  LRWI-FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
           +  I  I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 57  VFLIALIIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 117 VVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 176

Query: 203 IFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|238799252|ref|ZP_04642698.1| Inner membrane protein YbhL [Yersinia mollaretii ATCC 43969]
 gi|238716886|gb|EEQ08756.1| Inner membrane protein YbhL [Yersinia mollaretii ATCC 43969]
          Length = 236

 Score =  159 bits (401), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 143/239 (59%), Gaps = 20/239 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + G++AYM +VY  M  GL +T ++++           +  SI+I          AL   
Sbjct: 16  NTGIQAYMAQVYGWMTCGLLLTAVVAWYA--------ANTPSIVI----------ALQSN 57

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
             L +  I A LG+   ++  ++ LS  AA  +F+LYSAL GL+LSS  ++YT  SI  T
Sbjct: 58  QILFFGLIIAQLGLVFVISGMINRLSGTAATSLFMLYSALTGLTLSSILMMYTGASIAST 117

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F I A  FG++S YGYTTKRDL  +GS + MG  G+ L S+VN++++S A+   ++ +G+
Sbjct: 118 FIICAGMFGAMSFYGYTTKRDLSGMGSMLFMGLIGIVLASIVNIWLKSPALMWAVTYIGV 177

Query: 202 VIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++F  LTAYDTQK+K   A  D  D     + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 LVFVGLTAYDTQKLKNMGAQLDANDKDSFRKYSIVGALTLYLDFINLFLMLLRIFGNRR 236


>gi|58584747|ref|YP_198320.1| integral membrane protein, interacts with FtsH [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58419063|gb|AAW71078.1| Integral membrane protein, interacts with FtsH [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 240

 Score =  158 bits (400), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 156/250 (62%), Gaps = 29/250 (11%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MS ++N Q + + G  + +    GLR+Y+ +VYN MAL LG+TG+++FL      TV  D
Sbjct: 1   MSYMKNEQDIRSQGVYYSA----GLRSYLTKVYNYMALALGITGLIAFL------TVFFD 50

Query: 61  AASIIINRGVMLTGFGALMYTSP-LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
              +I              Y++P L  + I +P+ +  +++ RL  LSA +   +F L+S
Sbjct: 51  LFQVI--------------YSNPVLSIVVILSPIVLVFYMSHRLQYLSAQSTVTVFFLFS 96

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
            L+GLSLS  F+VYT+++I + FFIT+  FGS++LYG +TK+DL  +GSF+IMG +GL +
Sbjct: 97  VLMGLSLSYIFIVYTTENIARAFFITSIMFGSMALYGNSTKKDLTSMGSFLIMGIWGLII 156

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYD---VAYAERQSVIGA 236
            S+VNLF+ SS +   +S + +++F+ +TAYD Q+IK+ Y  RY+    A   + ++ GA
Sbjct: 157 ASIVNLFLGSSPLYFAISFISVIVFTLMTAYDAQRIKDVYY-RYNDGSEAVTTKLAIFGA 215

Query: 237 LMLYMDFIQI 246
             LY DFI +
Sbjct: 216 TNLYFDFINV 225


>gi|284007128|emb|CBA72404.1| conserved hypothetical protein [Arsenophonus nasoniae]
          Length = 242

 Score =  158 bits (400), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 142/240 (59%), Gaps = 26/240 (10%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           G++AYM +VY  M +GL +T  +++                I N  +       +MY + 
Sbjct: 24  GIQAYMAQVYGWMTVGLLLTAFVAWYA--------------INNSNI-------IMYLAT 62

Query: 84  LRWIFI---FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
             W+ I    A   + I L+  L  LSA  A  MF+LYSAL GL++S   + YT  S+  
Sbjct: 63  HGWVLIGLIIAEFALVIGLSFLLPKLSAGLATAMFMLYSALTGLTISLVLVAYTGASVAS 122

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
           TFFITAA FG+LS YGYTTKR L  +GSF+ M   GL + SLVN++++SS + L ++  G
Sbjct: 123 TFFITAAMFGALSFYGYTTKRSLSGMGSFLFMALIGLIIASLVNIWLQSSGLTLVITYAG 182

Query: 201 LVIFSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++IFS LTAYDTQK+K+  +  D  D     + +++GAL LY+DFI +F+ +LR LG RR
Sbjct: 183 VLIFSGLTAYDTQKLKDMGNQIDSRDQEGMRKYAILGALTLYLDFINLFLMMLRILGDRR 242


>gi|194433176|ref|ZP_03065458.1| putative membrane protein [Shigella dysenteriae 1012]
 gi|194418673|gb|EDX34760.1| putative membrane protein [Shigella dysenteriae 1012]
          Length = 261

 Score =  158 bits (400), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 95/237 (40%), Positives = 139/237 (58%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++     A  ++     ++    V L G         
Sbjct: 43  GLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVME-----LLFTNRVFLIGL-------- 89

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L + I L+  +  LSA    M+F+LYS L GL+LSS F+VYT+ SI  TF 
Sbjct: 90  -----IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSVLTGLTLSSIFIVYTAASIASTFV 144

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++
Sbjct: 145 VTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIV 204

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 205 FVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 261


>gi|295096524|emb|CBK85614.1| Integral membrane protein, interacts with FtsH [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 235

 Score =  158 bits (400), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 141/237 (59%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T   +F+    A T  P+    I +  +  T FG       
Sbjct: 17  GLQTYMAQVYGWMTVGLLLT---AFIAWYAANT--PELMMFIFSSKI--TFFG------- 62

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L +   L+  +H LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF 
Sbjct: 63  ----LIIAQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTFV 118

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +T   FG +SLYGYTTKRDL   G+ + MG  G+ L SLVNL+++S A+   ++ +G+VI
Sbjct: 119 VTGGMFGVMSLYGYTTKRDLSGFGNMLFMGLIGIVLASLVNLWLKSDALMWAVTYIGVVI 178

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 179 FVGLTAYDTQKLKNIGEQIDVRDSSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 235


>gi|308274747|emb|CBX31346.1| Inner membrane protein ybhL [uncultured Desulfobacterium sp.]
          Length = 234

 Score =  158 bits (399), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 145/244 (59%), Gaps = 21/244 (8%)

Query: 18  GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
           GS     +  ++  VYN M +GL +TG++++ V     + D    S+I   G  L  FG 
Sbjct: 9   GSQTQVLVNEFIRSVYNWMGIGLALTGLVAYYV-----SNDAGLQSLIF--GNRLVFFG- 60

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
                      I A L +   ++ R++ + A  A  MF++Y+AL G +LS  FL+YT+ S
Sbjct: 61  ----------LIIAELALVFTISSRVNKMKASTATSMFIIYAALNGATLSVIFLIYTASS 110

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           I  TFFI +A+F + S+YG TTKRDL  +G FM MG  G+ + S+VN+F+RSSA+++ +S
Sbjct: 111 ITSTFFICSATFLACSIYGMTTKRDLTSMGGFMAMGLIGIIIASVVNIFIRSSAMNMIIS 170

Query: 198 AMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
            +G+++F  LTAYDTQK+K          D     + +++GAL LY+DFI +F+ LLR L
Sbjct: 171 YIGVIVFVGLTAYDTQKLKNMAMTQPSGLDAGVVRKGAILGALSLYLDFINLFLMLLRIL 230

Query: 255 GSRR 258
           G RR
Sbjct: 231 GDRR 234


>gi|296284488|ref|ZP_06862486.1| integral membrane protein [Citromicrobium bathyomarinum JL354]
          Length = 263

 Score =  158 bits (399), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 93/241 (38%), Positives = 143/241 (59%), Gaps = 20/241 (8%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +T D GLR YM+ +YN M  G+ +TGI++ L                       +G    
Sbjct: 43  TTFDAGLRKYMLSIYNYMCSGVLLTGIVALL--------------------TYQSGLAVT 82

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
             + PL WI   +PL +   ++      S    ++MF  ++ L+GLSLS+ F  YT  SI
Sbjct: 83  FASGPLMWIVALSPLAIVFAMSFGAQKFSQGTLQLMFWGFATLMGLSLSTVFFEYTQGSI 142

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
             TFF TA +F  LSL+GYTTK+DL   GSF+IMG  G+ +  ++N+F++S+A++L +S 
Sbjct: 143 AATFFATAGAFAGLSLFGYTTKKDLSGWGSFLIMGVIGILIAMVINIFLQSAALELAVSI 202

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +G++IF+ LTAYDTQ++K  Y      ++  +  ++GAL LY+DFI +F+ LLRF+G+ R
Sbjct: 203 LGVLIFAGLTAYDTQRLKSDYQRLRGTSWEGKSIILGALSLYLDFINMFLFLLRFMGAAR 262

Query: 259 D 259
           D
Sbjct: 263 D 263


>gi|271500994|ref|YP_003334019.1| hypothetical protein Dd586_2465 [Dickeya dadantii Ech586]
 gi|270344549|gb|ACZ77314.1| protein of unknown function UPF0005 [Dickeya dadantii Ech586]
          Length = 236

 Score =  157 bits (398), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 98/246 (39%), Positives = 142/246 (57%), Gaps = 23/246 (9%)

Query: 18  GSTIDQ---GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           GS + Q   GL+ YM +VY  M  GL +T  +S+     A T  P    ++ +  +   G
Sbjct: 9   GSIVQQASTGLQTYMAQVYGWMTCGLLLTAFVSWYA---ANT--PAVLQLVFSSKITFYG 63

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
                         + A LG+   L+  +H LS   A  +F+LYSAL GL+LSS F+VY+
Sbjct: 64  L-------------VIAQLGLVFVLSGMVHRLSGGVATTLFMLYSALTGLTLSSIFIVYS 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
            +SI  TF ITA  FG++SLYGY TKRDL  +GS + M   G+ L +LVN +++S  + L
Sbjct: 111 GESIASTFVITAGMFGAMSLYGYVTKRDLTGLGSMLFMALIGILLATLVNFWLKSEGLQL 170

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFIQIFVHLLR 252
            ++ +G+++F  LTAYDTQK+K    +    D     + S++GAL LY+DFI +F+ LLR
Sbjct: 171 AITYIGVLVFVGLTAYDTQKLKNIGEELSVDDKDNFRKYSIMGALTLYLDFINLFLMLLR 230

Query: 253 FLGSRR 258
             GSRR
Sbjct: 231 LFGSRR 236


>gi|237707256|ref|ZP_04537737.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|226898466|gb|EEH84725.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
          Length = 234

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 97/237 (40%), Positives = 140/237 (59%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++     A  ++     +  NR V L G         
Sbjct: 16  GLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMEL----LFTNR-VFLIGL-------- 62

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF 
Sbjct: 63  -----IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++S YGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++
Sbjct: 118 VTAGMFGAMSRYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIV 177

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 FVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|15800537|ref|NP_286549.1| hypothetical protein Z1005 [Escherichia coli O157:H7 EDL933]
 gi|15830118|ref|NP_308891.1| hypothetical protein ECs0864 [Escherichia coli O157:H7 str. Sakai]
 gi|168752004|ref|ZP_02777026.1| putative membrane protein [Escherichia coli O157:H7 str. EC4113]
 gi|168757129|ref|ZP_02782136.1| putative membrane protein [Escherichia coli O157:H7 str. EC4401]
 gi|168764311|ref|ZP_02789318.1| putative membrane protein [Escherichia coli O157:H7 str. EC4501]
 gi|168767286|ref|ZP_02792293.1| putative membrane protein [Escherichia coli O157:H7 str. EC4486]
 gi|168777235|ref|ZP_02802242.1| putative membrane protein [Escherichia coli O157:H7 str. EC4196]
 gi|168779329|ref|ZP_02804336.1| putative membrane protein [Escherichia coli O157:H7 str. EC4076]
 gi|168786999|ref|ZP_02812006.1| putative membrane protein [Escherichia coli O157:H7 str. EC869]
 gi|168799941|ref|ZP_02824948.1| putative membrane protein [Escherichia coli O157:H7 str. EC508]
 gi|195936826|ref|ZP_03082208.1| hypothetical protein EscherichcoliO157_10240 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208808114|ref|ZP_03250451.1| putative membrane protein [Escherichia coli O157:H7 str. EC4206]
 gi|208815304|ref|ZP_03256483.1| putative membrane protein [Escherichia coli O157:H7 str. EC4045]
 gi|208822458|ref|ZP_03262777.1| putative membrane protein [Escherichia coli O157:H7 str. EC4042]
 gi|209400563|ref|YP_002269455.1| hypothetical protein ECH74115_0934 [Escherichia coli O157:H7 str.
           EC4115]
 gi|217325457|ref|ZP_03441541.1| putative membrane protein [Escherichia coli O157:H7 str. TW14588]
 gi|254791980|ref|YP_003076817.1| putative inner membrane protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|261225433|ref|ZP_05939714.1| predicted inner membrane protein [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261258598|ref|ZP_05951131.1| predicted inner membrane protein [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291281783|ref|YP_003498601.1| hypothetical protein G2583_1014 [Escherichia coli O55:H7 str.
           CB9615]
 gi|12513775|gb|AAG55157.1|AE005259_8 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|13360323|dbj|BAB34287.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|187767511|gb|EDU31355.1| putative membrane protein [Escherichia coli O157:H7 str. EC4196]
 gi|188014047|gb|EDU52169.1| putative membrane protein [Escherichia coli O157:H7 str. EC4113]
 gi|189002867|gb|EDU71853.1| putative membrane protein [Escherichia coli O157:H7 str. EC4076]
 gi|189355833|gb|EDU74252.1| putative membrane protein [Escherichia coli O157:H7 str. EC4401]
 gi|189363603|gb|EDU82022.1| putative membrane protein [Escherichia coli O157:H7 str. EC4486]
 gi|189365675|gb|EDU84091.1| putative membrane protein [Escherichia coli O157:H7 str. EC4501]
 gi|189373142|gb|EDU91558.1| putative membrane protein [Escherichia coli O157:H7 str. EC869]
 gi|189377780|gb|EDU96196.1| putative membrane protein [Escherichia coli O157:H7 str. EC508]
 gi|208727915|gb|EDZ77516.1| putative membrane protein [Escherichia coli O157:H7 str. EC4206]
 gi|208731952|gb|EDZ80640.1| putative membrane protein [Escherichia coli O157:H7 str. EC4045]
 gi|208737943|gb|EDZ85626.1| putative membrane protein [Escherichia coli O157:H7 str. EC4042]
 gi|209161963|gb|ACI39396.1| putative membrane protein [Escherichia coli O157:H7 str. EC4115]
 gi|209776018|gb|ACI86321.1| hypothetical protein ECs0864 [Escherichia coli]
 gi|209776020|gb|ACI86322.1| hypothetical protein ECs0864 [Escherichia coli]
 gi|209776022|gb|ACI86323.1| hypothetical protein ECs0864 [Escherichia coli]
 gi|209776024|gb|ACI86324.1| hypothetical protein ECs0864 [Escherichia coli]
 gi|209776026|gb|ACI86325.1| hypothetical protein ECs0864 [Escherichia coli]
 gi|217321678|gb|EEC30102.1| putative membrane protein [Escherichia coli O157:H7 str. TW14588]
 gi|254591380|gb|ACT70741.1| predicted inner membrane protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|290761656|gb|ADD55617.1| hypothetical protein G2583_1014 [Escherichia coli O55:H7 str.
           CB9615]
 gi|320192739|gb|EFW67380.1| Putative membrane protein [Escherichia coli O157:H7 str. EC1212]
 gi|320637648|gb|EFX07440.1| hypothetical protein ECO5101_22625 [Escherichia coli O157:H7 str.
           G5101]
 gi|320642774|gb|EFX11975.1| hypothetical protein ECO9389_02381 [Escherichia coli O157:H- str.
           493-89]
 gi|320648230|gb|EFX16885.1| hypothetical protein ECO2687_18486 [Escherichia coli O157:H- str. H
           2687]
 gi|320654067|gb|EFX22135.1| hypothetical protein ECO7815_07629 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320659690|gb|EFX27246.1| hypothetical protein ECO5905_24308 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320664160|gb|EFX31311.1| hypothetical protein ECOSU61_00978 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|326338328|gb|EGD62157.1| Putative membrane protein [Escherichia coli O157:H7 str. 1125]
 gi|326346306|gb|EGD70044.1| Putative membrane protein [Escherichia coli O157:H7 str. 1044]
          Length = 234

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 95/237 (40%), Positives = 139/237 (58%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++     A  ++     ++    V L G         
Sbjct: 16  GLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVME-----LLFTNRVFLIGL-------- 62

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF 
Sbjct: 63  -----IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++
Sbjct: 118 VTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIV 177

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D +   + S++ AL LY+DFI +F+ LLR  G+RR
Sbjct: 178 FVGLTAYDTQKLKNMGEQIDTRDASNLRKYSILCALTLYLDFINLFLMLLRIFGNRR 234


>gi|58040340|ref|YP_192304.1| hypothetical protein GOX1910 [Gluconobacter oxydans 621H]
 gi|58002754|gb|AAW61648.1| Hypothetical transmembrane protein [Gluconobacter oxydans 621H]
          Length = 256

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 160/267 (59%), Gaps = 32/267 (11%)

Query: 6   NYQRV-VNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVD------ 58
           N+ R  V +G+G   ++D GLRAYM RV+N MALGL +TG++++   +  T++       
Sbjct: 6   NFSRTGVQAGAG---SLDAGLRAYMCRVFNWMALGLVITGLVAY--GVAQTSLRALFFHL 60

Query: 59  ---PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMF 115
              P+ A  I+ R  +L G            I IFAPL   + L+  ++ LS  A + +F
Sbjct: 61  AEMPNGA--IVLRPTLLGG------------ISIFAPLVFVMVLSFGVNRLSRPAVQGIF 106

Query: 116 LLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAF 175
           LL+SA +G S++S  L YT  S+ +TFF+TA +F  +SL+GYTT  +L  +GSF+ MG  
Sbjct: 107 LLFSAAMGASMASLLLSYTGVSVARTFFVTAITFAGMSLWGYTTGANLARLGSFLFMGLI 166

Query: 176 GLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---RQS 232
           G+ L S+VN+F+ SS + + +S +G+ +F+ L AYDTQ+IK  Y      A  E   + S
Sbjct: 167 GIILASVVNIFLHSSPLAMLVSIIGVGLFTLLAAYDTQRIKITYQQYMAYAGPEEVAKLS 226

Query: 233 VIGALMLYMDFIQIFVHLLRFLGSRRD 259
           V  AL +Y++F+ +F  L++F+G R D
Sbjct: 227 VYDALTMYLNFVNLFQFLIQFMGVRSD 253


>gi|251790116|ref|YP_003004837.1| hypothetical protein Dd1591_2518 [Dickeya zeae Ech1591]
 gi|247538737|gb|ACT07358.1| protein of unknown function UPF0005 [Dickeya zeae Ech1591]
          Length = 236

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 99/249 (39%), Positives = 144/249 (57%), Gaps = 29/249 (11%)

Query: 18  GSTIDQ---GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           GS + Q   GL+ YM +VY  M  GL +T  +S+     A T  P    ++ +  +   G
Sbjct: 9   GSIVQQASTGLQTYMAQVYGWMTCGLLLTAFVSWYA---AHT--PAVLQLVFSSKITFYG 63

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
                         + A LG+   L+  +H LS   A  +F+LYSAL GL+LSS F+VY+
Sbjct: 64  L-------------VIAQLGLVFVLSGMVHRLSGGVATTLFMLYSALTGLTLSSIFIVYS 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
            +SI  TF ITA  FG++SLYGY TKRDL  +GS + M   G+ L +LVN +++S  + L
Sbjct: 111 GESIASTFVITAGMFGAMSLYGYVTKRDLTGMGSMLFMALIGILLATLVNFWLKSEGLQL 170

Query: 195 TMSAMGLVIFSALTAYDTQKIKE-----AYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
            ++ +G+++F  LTAYDTQK+K      +  DR +     + S++GAL LY+DFI +F+ 
Sbjct: 171 AITYIGVLVFVGLTAYDTQKLKNIGEELSVDDRDNF---RKYSIMGALTLYLDFINLFLM 227

Query: 250 LLRFLGSRR 258
           LLR  GSRR
Sbjct: 228 LLRLFGSRR 236


>gi|51595538|ref|YP_069729.1| stationary phase anti-death family (SAD), acetate uptake [Yersinia
           pseudotuberculosis IP 32953]
 gi|153947670|ref|YP_001401795.1| hypothetical protein YpsIP31758_2832 [Yersinia pseudotuberculosis
           IP 31758]
 gi|170025140|ref|YP_001721645.1| hypothetical protein YPK_2918 [Yersinia pseudotuberculosis YPIII]
 gi|186894594|ref|YP_001871706.1| hypothetical protein YPTS_1274 [Yersinia pseudotuberculosis PB1/+]
 gi|51588820|emb|CAH20434.1| Stationary phase anti-death Family (SAD), acetate uptake [Yersinia
           pseudotuberculosis IP 32953]
 gi|152959165|gb|ABS46626.1| putative membrane protein [Yersinia pseudotuberculosis IP 31758]
 gi|169751674|gb|ACA69192.1| protein of unknown function UPF0005 [Yersinia pseudotuberculosis
           YPIII]
 gi|186697620|gb|ACC88249.1| protein of unknown function UPF0005 [Yersinia pseudotuberculosis
           PB1/+]
          Length = 236

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 146/246 (59%), Gaps = 23/246 (9%)

Query: 18  GSTIDQ---GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           GS +++   G++AYM +VY  M  GL +T ++++           +  SII         
Sbjct: 9   GSIVERAGSGIQAYMAQVYGWMTCGLLLTAVVAWYA--------ANTPSIIF-------- 52

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
             AL     L +  I A LG+   ++  ++ LS  AA  +F+LYSAL GL+LSS  ++YT
Sbjct: 53  --ALQSNQILFFGLIIAQLGLVFVISGMVNRLSGTAATSLFMLYSALTGLTLSSILIMYT 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI  TF I A  FG++S YGYTTKRDL  +GS + MG  G+ L SLVN++++S A+  
Sbjct: 111 GASIASTFVICAGMFGAMSFYGYTTKRDLSGMGSMLFMGLIGIILASLVNIWLKSPALMW 170

Query: 195 TMSAMGLVIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
            ++ +G+++F  LTAYDTQK+K   A  D  D     + S++GAL LY+DFI +F+ LLR
Sbjct: 171 AVTYIGVLVFVGLTAYDTQKLKNLGAQLDVNDKDSFRKYSIVGALTLYLDFINLFLMLLR 230

Query: 253 FLGSRR 258
             G+RR
Sbjct: 231 IFGNRR 236


>gi|292487705|ref|YP_003530578.1| inner membrane protein YbhL [Erwinia amylovora CFBP1430]
 gi|292898942|ref|YP_003538311.1| membrane protein [Erwinia amylovora ATCC 49946]
 gi|291198790|emb|CBJ45899.1| putative membrane protein [Erwinia amylovora ATCC 49946]
 gi|291553125|emb|CBA20170.1| Inner membrane protein ybhL [Erwinia amylovora CFBP1430]
 gi|312171817|emb|CBX80074.1| Inner membrane protein ybhL [Erwinia amylovora ATCC BAA-2158]
          Length = 236

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 97/237 (40%), Positives = 138/237 (58%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           G+  YM +VY  M  GL +T  +S+     A         +  NR   +T FG       
Sbjct: 18  GISVYMAQVYGWMTCGLLLTAFISWY----AANTPAVMQLVFANR---ITFFG------- 63

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I   LG+   L+  +H LS   A  +F+LYSAL GL+++S FLVYTS SI  TF 
Sbjct: 64  ----LIIVQLGLVFVLSGMVHKLSGAVATGLFMLYSALTGLTMASIFLVYTSSSIASTFV 119

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +T   FG++SL+GYTTKRDL  +GS + M   G+ L SLVN++++S+A+   ++ +G+V+
Sbjct: 120 VTGGMFGAMSLWGYTTKRDLSGMGSMLFMALIGIVLASLVNIWLKSTALMWAVTYIGVVV 179

Query: 204 FSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      +  D     R S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 180 FVGLTAYDTQKLKNIGEGINVEDKENMRRYSIMGALTLYLDFINLFLMLLRIFGNRR 236


>gi|22126895|ref|NP_670318.1| hypothetical protein y3018 [Yersinia pestis KIM 10]
 gi|45440831|ref|NP_992370.1| hypothetical protein YP_0996 [Yersinia pestis biovar Microtus str.
           91001]
 gi|108812998|ref|YP_648765.1| membrane protein [Yersinia pestis Nepal516]
 gi|145599803|ref|YP_001163879.1| membrane protein [Yersinia pestis Pestoides F]
 gi|149366841|ref|ZP_01888875.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|162419433|ref|YP_001605957.1| hypothetical protein YpAngola_A1438 [Yersinia pestis Angola]
 gi|165924546|ref|ZP_02220378.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165938360|ref|ZP_02226918.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166011618|ref|ZP_02232516.1| putative membrane protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211762|ref|ZP_02237797.1| putative membrane protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167400327|ref|ZP_02305840.1| putative membrane protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419426|ref|ZP_02311179.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167424262|ref|ZP_02316015.1| putative membrane protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|218928327|ref|YP_002346202.1| hypothetical protein YPO1163 [Yersinia pestis CO92]
 gi|229841103|ref|ZP_04461262.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229843207|ref|ZP_04463353.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229894044|ref|ZP_04509230.1| putative membrane protein [Yersinia pestis Pestoides A]
 gi|229903435|ref|ZP_04518548.1| putative membrane protein [Yersinia pestis Nepal516]
 gi|270487210|ref|ZP_06204284.1| inner membrane family protein [Yersinia pestis KIM D27]
 gi|294503163|ref|YP_003567225.1| hypothetical protein YPZ3_1053 [Yersinia pestis Z176003]
 gi|21959931|gb|AAM86569.1|AE013903_6 hypothetical protein y3018 [Yersinia pestis KIM 10]
 gi|45435689|gb|AAS61247.1| putative membrane protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|108776646|gb|ABG19165.1| membrane protein [Yersinia pestis Nepal516]
 gi|115346938|emb|CAL19827.1| putative membrane protein [Yersinia pestis CO92]
 gi|145211499|gb|ABP40906.1| membrane protein [Yersinia pestis Pestoides F]
 gi|149291215|gb|EDM41290.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|162352248|gb|ABX86196.1| putative membrane protein [Yersinia pestis Angola]
 gi|165913738|gb|EDR32357.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165923606|gb|EDR40738.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989566|gb|EDR41867.1| putative membrane protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207533|gb|EDR52013.1| putative membrane protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962167|gb|EDR58188.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167050276|gb|EDR61684.1| putative membrane protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167057111|gb|EDR66874.1| putative membrane protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229679205|gb|EEO75308.1| putative membrane protein [Yersinia pestis Nepal516]
 gi|229689554|gb|EEO81615.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229697469|gb|EEO87516.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229703929|gb|EEO90942.1| putative membrane protein [Yersinia pestis Pestoides A]
 gi|262361200|gb|ACY57921.1| hypothetical protein YPD4_1012 [Yersinia pestis D106004]
 gi|262365243|gb|ACY61800.1| hypothetical protein YPD8_1115 [Yersinia pestis D182038]
 gi|270335714|gb|EFA46491.1| inner membrane family protein [Yersinia pestis KIM D27]
 gi|294353622|gb|ADE63963.1| hypothetical protein YPZ3_1053 [Yersinia pestis Z176003]
 gi|320014303|gb|ADV97874.1| putative membrane protein [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 236

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 146/246 (59%), Gaps = 23/246 (9%)

Query: 18  GSTIDQ---GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           GS +++   G++AYM +VY  M  GL +T ++++           +  SII         
Sbjct: 9   GSIVERAGSGIQAYMAQVYGWMTCGLLLTAVVAWYA--------ANTPSIIF-------- 52

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
             AL     L +  I A LG+   ++  ++ LS  AA  +F+LYSAL GL+LSS  ++YT
Sbjct: 53  --ALQSNQILFFGLIIAQLGLVFVISGMVNRLSGTAATSLFMLYSALTGLTLSSILIMYT 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI  TF I A  FG++S YGYTTKRDL  +GS + MG  G+ L SLVN++++S A+  
Sbjct: 111 GASIASTFVICAGMFGAMSFYGYTTKRDLSGMGSMLFMGLIGIILASLVNIWLKSPALMW 170

Query: 195 TMSAMGLVIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
            ++ +G+++F  LTAYDTQK+K   A  D  D     + S++GAL LY+DFI +F+ LLR
Sbjct: 171 VVTYIGVLVFVGLTAYDTQKLKNLGAQLDVNDKDSFRKYSIVGALTLYLDFINLFLMLLR 230

Query: 253 FLGSRR 258
             G+RR
Sbjct: 231 IFGNRR 236


>gi|242239850|ref|YP_002988031.1| hypothetical protein Dd703_2427 [Dickeya dadantii Ech703]
 gi|242131907|gb|ACS86209.1| protein of unknown function UPF0005 [Dickeya dadantii Ech703]
          Length = 236

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 102/249 (40%), Positives = 147/249 (59%), Gaps = 29/249 (11%)

Query: 18  GSTIDQG---LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           GS + Q    ++A+M +VY  MA GL        L   +A     ++A + +  G   T 
Sbjct: 9   GSIVQQAGTRVQAFMAQVYGWMACGL-------LLTAFVAWYAPQNSAIMQLVFGSKFTF 61

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           FG            +   LG+   L+  +H LS   A  +F+LYSAL GL++SS FLVYT
Sbjct: 62  FG-----------LVIVQLGLVFVLSGMVHRLSGGVATTLFMLYSALTGLTISSIFLVYT 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI  TF ITA +FG++S+YGYTTKRDL  +GS + M   G+ L +LVN +++SS + L
Sbjct: 111 GDSIASTFVITAGTFGAMSVYGYTTKRDLTGLGSMLFMALIGILLATLVNFWLKSSGLAL 170

Query: 195 TMSAMGLVIFSALTAYDTQKIK---EAYS--DRYDVAYAERQSVIGALMLYMDFIQIFVH 249
            ++ +G+++F  LTAYDTQK+K   E+ S  DR +     R S++GAL LY+DFI +F+ 
Sbjct: 171 AINYIGVLVFVGLTAYDTQKLKYLGESLSPDDRENF---RRYSIVGALDLYLDFINLFLM 227

Query: 250 LLRFLGSRR 258
           LLR  G+RR
Sbjct: 228 LLRLFGNRR 236


>gi|238893837|ref|YP_002918571.1| putative transport protein [Klebsiella pneumoniae NTUH-K2044]
 gi|238546153|dbj|BAH62504.1| putative transport protein [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 234

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 101/237 (42%), Positives = 140/237 (59%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T   +F+    A T  P     + +  +  T FG       
Sbjct: 16  GLQTYMAQVYGWMTVGLLLT---AFIAWFAANT--PAVMMFVFSSKI--TFFG------- 61

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L +   L+  +  LSA  A  +F+LYSAL GL+LSS F+ YT  SI  TF 
Sbjct: 62  ----LIIAQLALVFVLSGMVQRLSARMATTLFMLYSALTGLTLSSIFIAYTYSSIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +T   FG++SLYGYTTKRDL   GS + MG  G+ L SLVNL+++S A+   ++ +G+V+
Sbjct: 118 VTGGMFGAMSLYGYTTKRDLSGFGSMLFMGLIGIVLASLVNLWLKSEALMWAVTYIGVVL 177

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D A   + S++GAL LY+DFI +F+ LLR +G+RR
Sbjct: 178 FVGLTAYDTQKLKNIGEQIDTRDSATLRKYSILGALTLYLDFINLFLMLLRIMGNRR 234


>gi|307130568|ref|YP_003882584.1| hypothetical protein Dda3937_03769 [Dickeya dadantii 3937]
 gi|306528097|gb|ADM98027.1| Putative membrane protein [Dickeya dadantii 3937]
          Length = 236

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 101/249 (40%), Positives = 146/249 (58%), Gaps = 29/249 (11%)

Query: 18  GSTIDQ---GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           GS + Q   GL+ YM +VY  M  GL +T   +F+    A T  P    ++ +  +  T 
Sbjct: 9   GSIVQQASTGLQTYMAQVYGWMTCGLLLT---AFVAWYAANT--PAVLQMVFSSKI--TF 61

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           FG            + A LG+   L+  +H LS   A  +F+LYSAL GL+LSS F+VY+
Sbjct: 62  FG-----------LVIAQLGLVFVLSGMVHRLSGGVATTLFMLYSALTGLTLSSIFIVYS 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
            +SI  TF ITA  FG++SLYGY TKRDL  +GS + M   G+ L +LVN +++S  + L
Sbjct: 111 GESIASTFVITAGMFGAMSLYGYVTKRDLTGMGSMLFMALIGILLATLVNFWLKSEGLQL 170

Query: 195 TMSAMGLVIFSALTAYDTQKIKE-----AYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
            ++ +G+++F  LTAYDTQK+K      +  DR +     + S++GAL LY+DFI +F+ 
Sbjct: 171 AITYIGVLVFVGLTAYDTQKLKNIGEELSVDDRDNF---RKYSIMGALTLYLDFINLFLM 227

Query: 250 LLRFLGSRR 258
           LLR  GSRR
Sbjct: 228 LLRLFGSRR 236


>gi|238749847|ref|ZP_04611351.1| hypothetical protein yrohd0001_36140 [Yersinia rohdei ATCC 43380]
 gi|238711776|gb|EEQ03990.1| hypothetical protein yrohd0001_36140 [Yersinia rohdei ATCC 43380]
          Length = 236

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 97/239 (40%), Positives = 145/239 (60%), Gaps = 20/239 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + G++AYM +VY  M  GL +T ++++     A T  P   + I +    +T FG     
Sbjct: 16  NTGIQAYMAQVYGWMTCGLLLTAVVAWYA---ANT--PAVLNFIFSS--QITFFG----- 63

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                  I   LG+   ++  ++ LS   A  +F+LYSAL GL++SS F+VYTS SI  T
Sbjct: 64  ------LIIVQLGLVFVISGMVNRLSGAMATSLFMLYSALTGLTISSIFIVYTSSSIAST 117

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F I A  FG++S YGYTTKRDL  +GS + MG  G+ L S+VN++++S+A+   ++ +G+
Sbjct: 118 FLIAAGMFGAMSFYGYTTKRDLSGMGSMLFMGLIGIVLASIVNIWLKSTALMWAVTYIGV 177

Query: 202 VIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++F  LTAYDTQK+K   A  D  D     + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 LVFVGLTAYDTQKLKNMGAQLDANDKDSFRKYSIVGALTLYLDFINLFLMLLRIFGNRR 236


>gi|228470189|ref|ZP_04055096.1| membrane protein [Porphyromonas uenonis 60-3]
 gi|228308140|gb|EEK17003.1| membrane protein [Porphyromonas uenonis 60-3]
          Length = 240

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 119/174 (68%), Gaps = 2/174 (1%)

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           W+ I A L +   L+ R++ +S   A +M ++YSAL G++LS  F+VY+  SI +TFFIT
Sbjct: 67  WLLIIAELVLVFVLSARINKMSVATATIMLIVYSALNGVTLSFIFVVYSLGSIAKTFFIT 126

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
              FG ++L G TTKRDL  +GS + M   GL + SLVN+F+RSS +D  +S +G+V+F+
Sbjct: 127 TGMFGVMALVGATTKRDLSKLGSILFMALIGLIIASLVNIFLRSSGLDWIISLIGVVLFT 186

Query: 206 ALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           ALTAYD Q++K+  A SD YD     R +VI AL LY+DFI +F++LLRF G +
Sbjct: 187 ALTAYDVQRVKQLAAESDLYDDTQVGRLAVISALSLYLDFINLFLYLLRFFGRK 240


>gi|241176175|ref|XP_002399495.1| inner membrane protein ybhL [Ixodes scapularis]
 gi|215495147|gb|EEC04788.1| inner membrane protein ybhL [Ixodes scapularis]
          Length = 215

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 142/234 (60%), Gaps = 22/234 (9%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           YM +VY  M +GL +T  +++           ++A+++            L++T+ +  I
Sbjct: 1   YMAQVYGWMTVGLLLTAFVAWYA--------ANSAAVM-----------ELLFTNRVFLI 41

Query: 88  -FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
             I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF +TA
Sbjct: 42  GLIIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTA 101

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
             FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  
Sbjct: 102 GMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVG 161

Query: 207 LTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 162 LTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 215


>gi|152969372|ref|YP_001334481.1| putative transport protein [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|206581124|ref|YP_002239576.1| inner membrane protein YbhL [Klebsiella pneumoniae 342]
 gi|262041130|ref|ZP_06014347.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288936419|ref|YP_003440478.1| hypothetical protein Kvar_3566 [Klebsiella variicola At-22]
 gi|290510525|ref|ZP_06549895.1| inner membrane protein ybhL [Klebsiella sp. 1_1_55]
 gi|330014479|ref|ZP_08307919.1| hypothetical protein HMPREF9538_05639 [Klebsiella sp. MS 92-3]
 gi|150954221|gb|ABR76251.1| putative transport protein [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|206570182|gb|ACI11958.1| inner membrane protein YbhL [Klebsiella pneumoniae 342]
 gi|259041504|gb|EEW42558.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288891128|gb|ADC59446.1| protein of unknown function UPF0005 [Klebsiella variicola At-22]
 gi|289777241|gb|EFD85239.1| inner membrane protein ybhL [Klebsiella sp. 1_1_55]
 gi|328533006|gb|EGF59780.1| hypothetical protein HMPREF9538_05639 [Klebsiella sp. MS 92-3]
          Length = 234

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 101/237 (42%), Positives = 140/237 (59%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T   +F+    A T  P     + +  +  T FG       
Sbjct: 16  GLQTYMAQVYGWMTVGLLLT---AFIAWFAANT--PAVMMFVFSSKI--TFFG------- 61

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L +   L+  +  LSA  A  +F+LYSAL GL+LSS F+ YT  SI  TF 
Sbjct: 62  ----LIIAQLALVFVLSGMVQRLSAGMATTLFMLYSALTGLTLSSIFIAYTYSSIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +T   FG++SLYGYTTKRDL   GS + MG  G+ L SLVNL+++S A+   ++ +G+V+
Sbjct: 118 VTGGMFGAMSLYGYTTKRDLSGFGSMLFMGLIGIVLASLVNLWLKSEALMWAVTYIGVVL 177

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D A   + S++GAL LY+DFI +F+ LLR +G+RR
Sbjct: 178 FVGLTAYDTQKLKNIGEQIDTRDSATLRKYSILGALTLYLDFINLFLMLLRIMGNRR 234


>gi|238794068|ref|ZP_04637685.1| Inner membrane protein YbhL [Yersinia intermedia ATCC 29909]
 gi|238726573|gb|EEQ18110.1| Inner membrane protein YbhL [Yersinia intermedia ATCC 29909]
          Length = 249

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 99/260 (38%), Positives = 149/260 (57%), Gaps = 20/260 (7%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M  +    R   S        + G++AYM +VY  M  GL +T ++++     A T  P 
Sbjct: 8   MHKVTTMDRYPRSNGSIVERANTGIQAYMAQVYGWMTCGLLLTAVVAWYA---ANT--PA 62

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
             + I +  +  T FG            I   LG+   ++  ++ LS   A  +F+LYSA
Sbjct: 63  VLNFIFSSQI--TFFG-----------LIIVQLGLVFVISGMVNRLSGSMATSLFMLYSA 109

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L GL++SS F++YTS SI  TF I A  FG++S YGYTTKRDL  +GS + MG  G+ L 
Sbjct: 110 LTGLTISSIFIMYTSSSIASTFLIAAGMFGAMSFYGYTTKRDLSGMGSMLFMGLIGIVLA 169

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALM 238
           S+VN++++S+A+   ++ +G+++F  LTAYDTQK+K   S  D  D     + S++GAL 
Sbjct: 170 SIVNIWLKSTALMWAVTYIGVLVFVGLTAYDTQKLKNMGSQLDANDKDNFRKYSIVGALT 229

Query: 239 LYMDFIQIFVHLLRFLGSRR 258
           LY+DFI +F+ LLR  G+RR
Sbjct: 230 LYLDFINLFLMLLRIFGNRR 249


>gi|332089004|gb|EGI94116.1| hypothetical protein SB521682_2588 [Shigella boydii 5216-82]
          Length = 214

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 93/233 (39%), Positives = 142/233 (60%), Gaps = 22/233 (9%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI- 87
           M++VY  M +GL +T  +++           ++A+++            L++T+ +  I 
Sbjct: 1   MVQVYGWMTVGLLLTAFVAWYA--------ANSAAVM-----------ELLFTNRVFLIG 41

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
            I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF +TA 
Sbjct: 42  LIIAQLALVIVLSAMIKKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTAG 101

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
            FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  L
Sbjct: 102 MFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVGL 161

Query: 208 TAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           TAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 162 TAYDTQKLKNMSEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 214


>gi|220904012|ref|YP_002479324.1| hypothetical protein Ddes_0738 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219868311|gb|ACL48646.1| protein of unknown function UPF0005 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 234

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 92/234 (39%), Positives = 140/234 (59%), Gaps = 20/234 (8%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           YM +VY  M LGLG+T +M++ V   A+T  P    +I    +++ G             
Sbjct: 19  YMRQVYQWMTLGLGITTVMAWFV---AST--PAVQQVIFGNSLIMIGL------------ 61

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
            I A  G+ I ++  +H +S   A  +FLLYSAL G +LSS F+VY   SI   F +T  
Sbjct: 62  -IVAQFGLVIAISAAVHKMSGSTATGLFLLYSALTGATLSSIFVVYPVASITNAFLVTTG 120

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
           +F ++++YG  TKRDL  +GSF+ MG  G+ +  +VN+F++S+ +D  +S +G++IF+ L
Sbjct: 121 TFLAMTVYGTVTKRDLTAMGSFLFMGLIGIIIAMVVNIFLKSAMMDFVVSCLGVLIFTGL 180

Query: 208 TAYDTQKIKE-AYSDRYDVAYA-ERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           TAYDTQK++    S   D A A  R +++GAL LY+DFI +F+ LLR  G  R+
Sbjct: 181 TAYDTQKLRRFGESAPLDDATALRRGAILGALTLYLDFINLFLMLLRLFGGNRN 234


>gi|238897680|ref|YP_002923359.1| hypothetical protein HDEF_0457 [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465437|gb|ACQ67211.1| putative membrane protein [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 236

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 94/246 (38%), Positives = 144/246 (58%), Gaps = 23/246 (9%)

Query: 18  GSTID---QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           GS I+    G++ YM +VY  M  GL +T  +++         +P   ++I +  ++  G
Sbjct: 9   GSIIEGRSTGIQVYMSQVYGWMTCGLLLTAFVAWY-----AANNPAILNLIFSSQIVFFG 63

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
                         I   LG+   ++  +H LS   A  +F+LYSAL GL++SS F+VYT
Sbjct: 64  L-------------IIVQLGLVFVISGMIHKLSGAMATSLFMLYSALTGLTISSIFVVYT 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI  TF ITA  FG++S YGY TKRDL  +G+ + MG  G+ L S+VN++++SSA+  
Sbjct: 111 QSSIASTFVITAGMFGAMSFYGYVTKRDLTGLGNMLFMGVIGILLASIVNIWLKSSALMW 170

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
            ++ +G+V+F  LTAYDTQK+K      D  D     + S++GAL LY+DFI +F+ L+R
Sbjct: 171 AVTYIGVVLFVGLTAYDTQKLKNMGEQLDSNDKEGFRKYSIVGALTLYIDFINLFLMLIR 230

Query: 253 FLGSRR 258
            +G+RR
Sbjct: 231 IVGNRR 236


>gi|329295982|ref|ZP_08253318.1| hypothetical protein Pstas_03774 [Plautia stali symbiont]
          Length = 235

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 103/247 (41%), Positives = 142/247 (57%), Gaps = 25/247 (10%)

Query: 18  GSTIDQ---GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           GS + Q   GL+ YM +VY  M  GL +T  +S+     A         +  NR   +T 
Sbjct: 8   GSIVQQASTGLQTYMAQVYGWMTCGLLLTAFVSWF----AARTPAVMELVFANR---ITF 60

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           FG            I A L +   L+  +  +S   A  +F+LYSAL GL+++S FLVYT
Sbjct: 61  FG-----------LIIAQLALVFVLSGMVQRMSGAVATGLFMLYSALTGLTMASIFLVYT 109

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI  TFF+TA  FG++S YGYTTKRDL   GS + M   G+ L SLVN +++S A+  
Sbjct: 110 YSSIASTFFVTAGMFGAMSFYGYTTKRDLSRFGSLLFMALIGILLASLVNFWLKSPALMW 169

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLL 251
            ++ +G+V+F  LTAYDTQK+K A  +  DV   E   R S++GAL LY+DFI +F+ LL
Sbjct: 170 AITYIGVVVFVGLTAYDTQKLK-AIGEGIDVNDKENLRRFSIMGALTLYLDFINLFLMLL 228

Query: 252 RFLGSRR 258
           R  G+RR
Sbjct: 229 RIFGNRR 235


>gi|224582620|ref|YP_002636418.1| permease [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|224467147|gb|ACN44977.1| putative permease [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
          Length = 224

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 139/237 (58%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T   +F+    A T  P     + +  +  T FG       
Sbjct: 6   GLQTYMAQVYGWMTVGLLLT---AFIAWYAANT--PAVMMFVFSSKI--TFFG------- 51

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L +   L+  +H LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF 
Sbjct: 52  ----LIIAQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTFV 107

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +T   FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V+
Sbjct: 108 VTGGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVVV 167

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D A   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 168 FVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR 224


>gi|307719711|ref|YP_003875243.1| hypothetical protein STHERM_c20350 [Spirochaeta thermophila DSM
           6192]
 gi|306533436|gb|ADN02970.1| hypothetical protein STHERM_c20350 [Spirochaeta thermophila DSM
           6192]
          Length = 234

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 99/238 (41%), Positives = 143/238 (60%), Gaps = 22/238 (9%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           L+  +  VY  M  GL +TG++S     L     P           +L  F    +++PL
Sbjct: 16  LQRILTNVYLWMTGGLALTGVVS-----LGVASSP----------ALLRAF----FSNPL 56

Query: 85  RW-IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
            + + I   L +  +L++R+  +S +AA + F  YSAL G++L+  FLVYT  SI Q FF
Sbjct: 57  IFFLLIGGELALVFYLSLRIQKMSPFAATVAFASYSALNGVTLAPLFLVYTGTSIAQVFF 116

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           ITAA+F  +S YGY TKRDL  +GS + M  +GL + SLVN+F+RS    L +S +G++I
Sbjct: 117 ITAATFAGMSAYGYLTKRDLSRVGSIVGMALWGLIIASLVNIFLRSEGFSLVISYVGVLI 176

Query: 204 FSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           F  LTAYDTQ +K+  +  D  D +   R S++GAL LY+DFI +F+ LLR +GSRRD
Sbjct: 177 FVGLTAYDTQVLKQWATQIDPSDESVYVRFSIMGALKLYLDFINLFLFLLRIMGSRRD 234


>gi|227884252|ref|ZP_04002057.1| membrane protein [Escherichia coli 83972]
 gi|300816431|ref|ZP_07096653.1| putative inner membrane protein [Escherichia coli MS 107-1]
 gi|300822930|ref|ZP_07103065.1| putative inner membrane protein [Escherichia coli MS 119-7]
 gi|300898274|ref|ZP_07116625.1| putative inner membrane protein [Escherichia coli MS 198-1]
 gi|300907114|ref|ZP_07124780.1| putative inner membrane protein [Escherichia coli MS 84-1]
 gi|300920033|ref|ZP_07136492.1| putative inner membrane protein [Escherichia coli MS 115-1]
 gi|300922810|ref|ZP_07138896.1| putative inner membrane protein [Escherichia coli MS 182-1]
 gi|300929412|ref|ZP_07144881.1| putative inner membrane protein [Escherichia coli MS 187-1]
 gi|300947134|ref|ZP_07161348.1| putative inner membrane protein [Escherichia coli MS 116-1]
 gi|300957733|ref|ZP_07169920.1| putative inner membrane protein [Escherichia coli MS 175-1]
 gi|300992088|ref|ZP_07179790.1| putative inner membrane protein [Escherichia coli MS 200-1]
 gi|300993261|ref|ZP_07180308.1| putative inner membrane protein [Escherichia coli MS 45-1]
 gi|301020723|ref|ZP_07184791.1| putative inner membrane protein [Escherichia coli MS 69-1]
 gi|301051295|ref|ZP_07198121.1| putative inner membrane protein [Escherichia coli MS 185-1]
 gi|301306927|ref|ZP_07212971.1| putative inner membrane protein [Escherichia coli MS 124-1]
 gi|301327978|ref|ZP_07221143.1| putative inner membrane protein [Escherichia coli MS 78-1]
 gi|301646215|ref|ZP_07246111.1| putative inner membrane protein [Escherichia coli MS 146-1]
 gi|309797963|ref|ZP_07692342.1| putative inner membrane protein [Escherichia coli MS 145-7]
 gi|312967830|ref|ZP_07782043.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|312970860|ref|ZP_07785039.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|227839004|gb|EEJ49470.1| membrane protein [Escherichia coli 83972]
 gi|300297054|gb|EFJ53439.1| putative inner membrane protein [Escherichia coli MS 185-1]
 gi|300305417|gb|EFJ59937.1| putative inner membrane protein [Escherichia coli MS 200-1]
 gi|300315549|gb|EFJ65333.1| putative inner membrane protein [Escherichia coli MS 175-1]
 gi|300358063|gb|EFJ73933.1| putative inner membrane protein [Escherichia coli MS 198-1]
 gi|300398534|gb|EFJ82072.1| putative inner membrane protein [Escherichia coli MS 69-1]
 gi|300401159|gb|EFJ84697.1| putative inner membrane protein [Escherichia coli MS 84-1]
 gi|300406669|gb|EFJ90207.1| putative inner membrane protein [Escherichia coli MS 45-1]
 gi|300412980|gb|EFJ96290.1| putative inner membrane protein [Escherichia coli MS 115-1]
 gi|300420842|gb|EFK04153.1| putative inner membrane protein [Escherichia coli MS 182-1]
 gi|300453212|gb|EFK16832.1| putative inner membrane protein [Escherichia coli MS 116-1]
 gi|300462612|gb|EFK26105.1| putative inner membrane protein [Escherichia coli MS 187-1]
 gi|300524471|gb|EFK45540.1| putative inner membrane protein [Escherichia coli MS 119-7]
 gi|300531121|gb|EFK52183.1| putative inner membrane protein [Escherichia coli MS 107-1]
 gi|300837853|gb|EFK65613.1| putative inner membrane protein [Escherichia coli MS 124-1]
 gi|300845543|gb|EFK73303.1| putative inner membrane protein [Escherichia coli MS 78-1]
 gi|301075552|gb|EFK90358.1| putative inner membrane protein [Escherichia coli MS 146-1]
 gi|308118451|gb|EFO55713.1| putative inner membrane protein [Escherichia coli MS 145-7]
 gi|310336621|gb|EFQ01788.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|312287556|gb|EFR15463.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|315257772|gb|EFU37740.1| putative inner membrane protein [Escherichia coli MS 85-1]
 gi|315287189|gb|EFU46601.1| putative inner membrane protein [Escherichia coli MS 110-3]
 gi|315292594|gb|EFU51946.1| putative inner membrane protein [Escherichia coli MS 153-1]
 gi|315299283|gb|EFU58535.1| putative inner membrane protein [Escherichia coli MS 16-3]
 gi|320175207|gb|EFW50316.1| putative membrane protein [Shigella dysenteriae CDC 74-1112]
 gi|320178497|gb|EFW53462.1| Putative membrane protein [Shigella boydii ATCC 9905]
 gi|320196719|gb|EFW71342.1| Putative membrane protein [Escherichia coli WV_060327]
 gi|323159715|gb|EFZ45693.1| hypothetical protein ECE128010_4021 [Escherichia coli E128010]
 gi|323165703|gb|EFZ51489.1| hypothetical protein SS53G_3909 [Shigella sonnei 53G]
 gi|323185059|gb|EFZ70425.1| hypothetical protein ECOK1357_1515 [Escherichia coli 1357]
 gi|323190912|gb|EFZ76179.1| hypothetical protein ECRN5871_0760 [Escherichia coli RN587/1]
 gi|323967384|gb|EGB62805.1| inner membrane protein ybhL [Escherichia coli M863]
 gi|324009628|gb|EGB78847.1| putative inner membrane protein [Escherichia coli MS 57-2]
 gi|324011119|gb|EGB80338.1| putative inner membrane protein [Escherichia coli MS 60-1]
 gi|324018564|gb|EGB87783.1| putative inner membrane protein [Escherichia coli MS 117-3]
 gi|327253570|gb|EGE65199.1| hypothetical protein ECSTEC7V_0994 [Escherichia coli STEC_7v]
 gi|332097516|gb|EGJ02496.1| hypothetical protein SB359474_0793 [Shigella boydii 3594-74]
 gi|332759685|gb|EGJ89988.1| hypothetical protein SF434370_0977 [Shigella flexneri 4343-70]
 gi|333007143|gb|EGK26635.1| hypothetical protein SFK218_1112 [Shigella flexneri K-218]
 gi|333009772|gb|EGK29221.1| hypothetical protein SFK272_1134 [Shigella flexneri K-272]
          Length = 214

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 115/172 (66%), Gaps = 2/172 (1%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF +TA  
Sbjct: 43  IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTAGM 102

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  LT
Sbjct: 103 FGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVGLT 162

Query: 209 AYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 163 AYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 214


>gi|315619785|gb|EFV00304.1| conserved hypothetical protein [Escherichia coli 3431]
 gi|323172098|gb|EFZ57737.1| hypothetical protein ECLT68_3339 [Escherichia coli LT-68]
 gi|332767948|gb|EGJ98134.1| hypothetical protein SF293071_0904 [Shigella flexneri 2930-71]
          Length = 207

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 115/172 (66%), Gaps = 2/172 (1%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF +TA  
Sbjct: 36  IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTAGM 95

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  LT
Sbjct: 96  FGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVGLT 155

Query: 209 AYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 156 AYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 207


>gi|301024510|ref|ZP_07188186.1| putative inner membrane protein [Escherichia coli MS 196-1]
 gi|299880363|gb|EFI88574.1| putative inner membrane protein [Escherichia coli MS 196-1]
          Length = 214

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 115/172 (66%), Gaps = 2/172 (1%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF +TA  
Sbjct: 43  IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTAGM 102

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  LT
Sbjct: 103 FGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVGLT 162

Query: 209 AYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 163 AYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 214


>gi|253687906|ref|YP_003017096.1| hypothetical protein PC1_1517 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754484|gb|ACT12560.1| protein of unknown function UPF0005 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 235

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 145/246 (58%), Gaps = 23/246 (9%)

Query: 18  GSTIDQ---GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           GS +++   GL+AYM +VY  M  GL +T  +S+     A T  P   + + +    +T 
Sbjct: 8   GSIVERSQSGLQAYMAQVYGWMTCGLLLTAFVSWYA---ANT--PAVLNFVFSS--QITF 60

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           FG            I A LG+   ++  +  LS   A  +F+LYSAL GL+LSS F VY+
Sbjct: 61  FG-----------LIIAQLGLVFVISGMVQRLSGAVATSLFMLYSALTGLTLSSIFAVYS 109

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
           ++SI  TF ITA  FG++SLYGYTTKRDL   GS + M   G+ L SLVNL+++S A+  
Sbjct: 110 TESIASTFVITAGMFGAMSLYGYTTKRDLSGFGSMLFMALIGIVLASLVNLWLKSEALMW 169

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFIQIFVHLLR 252
            ++ +G+V+F  LTAYDTQK+K         D     + S++GAL LY+DFI +F+ LLR
Sbjct: 170 AVTYIGVVVFVGLTAYDTQKLKNIGEQLSVDDKDSFRKYSIVGALTLYLDFINLFLMLLR 229

Query: 253 FLGSRR 258
             G+RR
Sbjct: 230 IFGNRR 235


>gi|82776141|ref|YP_402488.1| hypothetical protein SDY_0817 [Shigella dysenteriae Sd197]
 gi|81240289|gb|ABB60999.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
          Length = 184

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 115/172 (66%), Gaps = 2/172 (1%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF +TA  
Sbjct: 12  IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTAGM 71

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  LT
Sbjct: 72  FGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVGLT 131

Query: 209 AYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 132 AYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 183


>gi|317154422|ref|YP_004122470.1| hypothetical protein Daes_2728 [Desulfovibrio aespoeensis Aspo-2]
 gi|316944673|gb|ADU63724.1| protein of unknown function UPF0005 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 243

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 96/242 (39%), Positives = 146/242 (60%), Gaps = 23/242 (9%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLV-NILAT-----TVDPDAASIIINRGVMLTGFGAL 78
           + A+M  VY  M+ GL +T ++S++V N  A       VDP             TG  ++
Sbjct: 17  VNAFMRGVYGWMSGGLALTALVSYIVINSQALMQMFFVVDPA------------TGTASM 64

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
              S L +I +FA LG+  +L+ R+ +++   A  +F+LYS L GL+L+   L YT++S+
Sbjct: 65  ---STLVFILLFAELGIVFYLSARISTMNPATATGLFMLYSGLNGLTLTPILLAYTAESV 121

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
             TFFI+A  FG++S YG  TK+DL   GS + MG  G+ +  +VN+FM+SSA+   +S 
Sbjct: 122 ASTFFISAGMFGAMSAYGLLTKKDLTSWGSLLFMGLIGIIIAMVVNMFMQSSAMAFAISV 181

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           +G++IF  LTAYDTQK+K    +    D A   R +++GAL LY+DFI +F+ LLR +G 
Sbjct: 182 IGVIIFLGLTAYDTQKLKTMGENVPVGDTAAIRRGTILGALTLYLDFINLFLMLLRLMGD 241

Query: 257 RR 258
           RR
Sbjct: 242 RR 243


>gi|84500275|ref|ZP_00998541.1| hypothetical protein OB2597_10044 [Oceanicola batsensis HTCC2597]
 gi|84392209|gb|EAQ04477.1| hypothetical protein OB2597_10044 [Oceanicola batsensis HTCC2597]
          Length = 220

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 91/233 (39%), Positives = 145/233 (62%), Gaps = 16/233 (6%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M +VY  M++G+    +++FLV   A    P+  S+  +         A +  + L WI 
Sbjct: 1   MNKVYGTMSVGM----VLTFLVA-WAVGSSPELLSVFRDP--------ATLQPNILGWIV 47

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           +FAPL +    +  ++ +SA AA++ F  ++A++GLSLS  F+ +T  SI Q F +TA +
Sbjct: 48  MFAPLIMVFAFSAMINRMSAAAAQLFFYAFAAVMGLSLSWIFVAFTGFSIAQVFLVTAIA 107

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           F  LSLYGY TKRDL  +G+F++MG  GL + S++NLF+ SSA+   ++ +G++IF+ LT
Sbjct: 108 FAGLSLYGYVTKRDLSGMGTFLMMGVIGLIVASIINLFIASSALHFAITIIGVLIFAGLT 167

Query: 209 AYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQ IK  Y   +   D  +  + +++GAL LY+DFI +F+ LL+ LG+R 
Sbjct: 168 AYDTQSIKNEYVQHAHHGDSEWLGKSAIMGALRLYLDFINMFMFLLQLLGNRE 220


>gi|219684171|ref|ZP_03539115.1| putative membrane protein [Borrelia garinii PBr]
 gi|219685108|ref|ZP_03539928.1| putative membrane protein [Borrelia garinii Far04]
 gi|219672160|gb|EED29213.1| putative membrane protein [Borrelia garinii PBr]
 gi|219673204|gb|EED30223.1| putative membrane protein [Borrelia garinii Far04]
          Length = 232

 Score =  155 bits (392), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 148/238 (62%), Gaps = 25/238 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ I ++     AT+ +    +II              +++P+ 
Sbjct: 15  NKFLAKVFGLMSIGLLISAIFAY-----ATSENQAIKAII--------------FSNPMS 55

Query: 86  WI-FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
           ++  I    G+   ++  L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF I
Sbjct: 56  FMAIILMQFGLVYAISGALNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGI 115

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TA +F  +S+YGYTT  DL  +GS++IMG +G+ + SLVN+F RSS ++  +S +G++IF
Sbjct: 116 TAGTFLGMSVYGYTTTTDLTKMGSYLIMGLWGIIIASLVNMFFRSSGLNFLISILGVIIF 175

Query: 205 SALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           + LTAYD Q I  A  DR    D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 176 TGLTAYDVQNI--AKMDRMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|238788767|ref|ZP_04632558.1| Inner membrane protein YbhL [Yersinia frederiksenii ATCC 33641]
 gi|238723072|gb|EEQ14721.1| Inner membrane protein YbhL [Yersinia frederiksenii ATCC 33641]
          Length = 236

 Score =  155 bits (392), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 145/239 (60%), Gaps = 20/239 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + G++AYM +VY  M  GL +T ++++     A T  P   + I +    +T FG     
Sbjct: 16  NSGIQAYMAQVYGWMTCGLLLTAVVAWYA---ANT--PAVLNFIFSS--QITFFG----- 63

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                  I   LG+   ++  ++ LS   A  +F+LYSAL GL++SS F++YTS SI  T
Sbjct: 64  ------LIIVQLGLVFVISGMVNRLSGTMATSLFMLYSALTGLTISSIFIMYTSSSIAST 117

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F I A  FG++S YGYTTKRDL  +GS + MG  G+ L S+VN++++S+A+   ++ +G+
Sbjct: 118 FLIAAGMFGAMSFYGYTTKRDLSGMGSMLFMGLIGIVLASIVNIWLKSTALMWAVTYIGV 177

Query: 202 VIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++F  LTAYDTQK+K   A  D  D     + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 LVFVGLTAYDTQKLKNMGAQLDANDKDGFRKYSIVGALTLYLDFINLFLMLLRIFGNRR 236


>gi|16764170|ref|NP_459785.1| permease [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|167550516|ref|ZP_02344273.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167992038|ref|ZP_02573136.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168230693|ref|ZP_02655751.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168236735|ref|ZP_02661793.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168240669|ref|ZP_02665601.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168263695|ref|ZP_02685668.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168466396|ref|ZP_02700258.1| membrane protein [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|168820050|ref|ZP_02832050.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194444921|ref|YP_002040042.1| membrane protein [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194470070|ref|ZP_03076054.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194738102|ref|YP_002113899.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197247740|ref|YP_002145762.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197262226|ref|ZP_03162300.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198244079|ref|YP_002214771.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200389380|ref|ZP_03215991.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204929976|ref|ZP_03220997.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205352065|ref|YP_002225866.1| hypothetical protein SG0786 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207856244|ref|YP_002242895.1| hypothetical protein SEN0753 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|238913366|ref|ZP_04657203.1| hypothetical protein SentesTe_19876 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|16419313|gb|AAL19744.1| putative permease [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|194403584|gb|ACF63806.1| membrane protein [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194456434|gb|EDX45273.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194713604|gb|ACF92825.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195630993|gb|EDX49579.1| membrane protein [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197211443|gb|ACH48840.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197240481|gb|EDY23101.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197290215|gb|EDY29572.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197938595|gb|ACH75928.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199601825|gb|EDZ00371.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204320970|gb|EDZ06171.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205271846|emb|CAR36681.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205324506|gb|EDZ12345.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205329610|gb|EDZ16374.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205334708|gb|EDZ21472.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205340211|gb|EDZ26975.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205343192|gb|EDZ29956.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205347790|gb|EDZ34421.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206708047|emb|CAR32338.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261246065|emb|CBG23867.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992547|gb|ACY87432.1| putative permease [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301157392|emb|CBW16881.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911829|dbj|BAJ35803.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320085078|emb|CBY94865.1| Glutamate [NMDA] receptor-associated protein 1 NMDA receptor
           glutamate-binding subunit; putative MAPK-activating
           protein PM02 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321226380|gb|EFX51431.1| Putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322613845|gb|EFY10783.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322620344|gb|EFY17211.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322622770|gb|EFY19615.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322628682|gb|EFY25469.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631620|gb|EFY28376.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322637146|gb|EFY33849.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322641654|gb|EFY38290.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322648035|gb|EFY44505.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322648483|gb|EFY44935.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322654220|gb|EFY50543.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658135|gb|EFY54402.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322663609|gb|EFY59811.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670345|gb|EFY66485.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322671581|gb|EFY67703.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676937|gb|EFY73004.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322682862|gb|EFY78881.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686541|gb|EFY82523.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323129114|gb|ADX16544.1| putative permease [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323194562|gb|EFZ79755.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323199107|gb|EFZ84203.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202063|gb|EFZ87122.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208912|gb|EFZ93849.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323213448|gb|EFZ98242.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323215251|gb|EFZ99996.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323220830|gb|EGA05268.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323227113|gb|EGA11291.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229929|gb|EGA14052.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233154|gb|EGA17250.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323240889|gb|EGA24931.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323243206|gb|EGA27226.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323248745|gb|EGA32673.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323251749|gb|EGA35616.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323258759|gb|EGA42416.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323260696|gb|EGA44301.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323267868|gb|EGA51347.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323268748|gb|EGA52208.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326622526|gb|EGE28871.1| putative permease [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
 gi|326627107|gb|EGE33450.1| putative permease [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
 gi|332987738|gb|AEF06721.1| putative permease [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 234

 Score =  155 bits (391), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 139/238 (58%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T   +F+    A T  P     + +  +  T FG      
Sbjct: 15  SGLQTYMAQVYGWMTVGLLLT---AFIAWYAANT--PAVMMFVFSSKI--TFFG------ 61

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                 I A L +   L+  +H LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF
Sbjct: 62  -----LIIAQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V
Sbjct: 117 VVTGGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVV 176

Query: 203 IFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K      D  D A   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|320354923|ref|YP_004196262.1| hypothetical protein Despr_2837 [Desulfobulbus propionicus DSM
           2032]
 gi|320123425|gb|ADW18971.1| protein of unknown function UPF0005 [Desulfobulbus propionicus DSM
           2032]
          Length = 237

 Score =  155 bits (391), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 93/236 (39%), Positives = 140/236 (59%), Gaps = 25/236 (10%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++ +V++ MA+GL +TG ++ L    +  V P                   +  SPL +I
Sbjct: 23  FLAKVFHWMAIGLAITGGVA-LFTAESGLVKP-------------------LIASPLFFI 62

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
            + A LG+  +L+ R+  L    A  +F+ YS L G++LS+ FL YT  SI  TF +TA 
Sbjct: 63  LVLAELGMVFYLSARIDKLQPGTATGLFVGYSVLNGVTLSTIFLAYTHASIGATFLVTAG 122

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
            F ++++YG  TKRDL  +GSFM MG  G+ L S+VN+F +S A+   +SA+G+++F  L
Sbjct: 123 MFAAMAVYGMVTKRDLSGMGSFMFMGLIGILLASIVNIFFKSPALYWAISAIGVLVFVGL 182

Query: 208 TAYDTQKIK----EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           TAYD QKIK    E   ++ +VA   + ++IGAL LY+DFI +F+ LLRF G  RD
Sbjct: 183 TAYDVQKIKTIGEEGIMEQGEVAI-RKGAIIGALALYLDFINLFLMLLRFFGGSRD 237


>gi|300939821|ref|ZP_07154459.1| putative inner membrane protein [Escherichia coli MS 21-1]
 gi|300455353|gb|EFK18846.1| putative inner membrane protein [Escherichia coli MS 21-1]
          Length = 214

 Score =  155 bits (391), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 115/172 (66%), Gaps = 2/172 (1%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           + A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF +TA  
Sbjct: 43  VIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTAGM 102

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  LT
Sbjct: 103 FGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVGLT 162

Query: 209 AYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 163 AYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 214


>gi|309786560|ref|ZP_07681183.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|308925623|gb|EFP71107.1| conserved hypothetical protein [Shigella dysenteriae 1617]
          Length = 183

 Score =  155 bits (391), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 115/172 (66%), Gaps = 2/172 (1%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF +TA  
Sbjct: 12  IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTAGM 71

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  LT
Sbjct: 72  FGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVGLT 131

Query: 209 AYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 132 AYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 183


>gi|218549650|ref|YP_002383441.1| hypothetical protein EFER_2325 [Escherichia fergusonii ATCC 35469]
 gi|218357191|emb|CAQ89826.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia fergusonii ATCC 35469]
 gi|324114350|gb|EGC08319.1| inner membrane protein ybhL [Escherichia fergusonii B253]
 gi|325498043|gb|EGC95902.1| hypothetical protein ECD227_2140 [Escherichia fergusonii ECD227]
          Length = 234

 Score =  155 bits (391), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 142/238 (59%), Gaps = 22/238 (9%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M  GL +T  +++           ++A+++            L++T+ 
Sbjct: 16  GLQTYMAQVYGWMTAGLLLTAFVAWYA--------ANSAALM-----------ELLFTNR 56

Query: 84  LRWI-FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
           +  I  + A L + I L+  +  LSA     +F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 57  VFLIGLVIAQLALVIVLSAMIQKLSAGVTTTLFMLYSALTGLTLSSIFIVYTAASIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG +SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 117 VVTAGMFGVMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 176

Query: 203 IFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|260427723|ref|ZP_05781702.1| integral membrane protein, interacts with FtsH [Citreicella sp.
           SE45]
 gi|260422215|gb|EEX15466.1| integral membrane protein, interacts with FtsH [Citreicella sp.
           SE45]
          Length = 246

 Score =  155 bits (391), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 99/255 (38%), Positives = 155/255 (60%), Gaps = 18/255 (7%)

Query: 9   RVVNSGSGFGST--IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           R + + +G  S   ID+GLRA+M +VY  M++G+    +++F V   A    P+  S+  
Sbjct: 5   RTIRTATGPTSAAQIDEGLRAHMNKVYGTMSVGM----LLTFAVA-WAVGTSPELLSVFR 59

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           +         A +  + L WI +FAPL +       L  +SA  A++ F  ++A++GLSL
Sbjct: 60  DP--------ATLQPNILGWIVMFAPLIMAFAFGAALSRISAAGAQLFFFAFAAVMGLSL 111

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           S  F+ +T  SI Q F +TA +F  LSL+GYTTK+D+   GSF+IMG  G+ + S++N+F
Sbjct: 112 SWIFVAFTGFSIAQVFLVTAIAFAGLSLWGYTTKKDISGWGSFLIMGVIGILVASIINIF 171

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEA---YSDRYDVAYAERQSVIGALMLYMDF 243
           + S AI   +S +G++IF+ LTAYDTQKIK     Y+   D  +  + +++GAL LY+DF
Sbjct: 172 LGSPAIYFAISILGVLIFAGLTAYDTQKIKNTYLQYAAHGDSEWLGKAAIMGALNLYLDF 231

Query: 244 IQIFVHLLRFLGSRR 258
           I +F+ LL+ LG+R 
Sbjct: 232 INMFMFLLQLLGNRE 246


>gi|50121736|ref|YP_050903.1| hypothetical protein ECA2812 [Pectobacterium atrosepticum SCRI1043]
 gi|227326984|ref|ZP_03831008.1| hypothetical protein PcarcW_06554 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
 gi|49612262|emb|CAG75712.1| putative membrane protein [Pectobacterium atrosepticum SCRI1043]
          Length = 235

 Score =  154 bits (390), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 145/246 (58%), Gaps = 23/246 (9%)

Query: 18  GSTIDQ---GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           GS +++   GL+AYM +VY  M  GL +T  +S+     A T  P   + + +    +T 
Sbjct: 8   GSIVERSQSGLQAYMAQVYGWMTCGLLLTAFVSWYA---ANT--PAVLNFVFSS--QITF 60

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           FG            I A LG+   ++  +  LS   A  +F+LYSAL GL+LSS F++Y+
Sbjct: 61  FG-----------LIIAQLGLVFVISGMVQRLSGTVATSLFMLYSALTGLTLSSIFIMYS 109

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
            +SI  TF ITA  FG++SLYGYTTKRDL   GS + M   G+ L SLVNL+++S A+  
Sbjct: 110 GESIASTFVITAGMFGAMSLYGYTTKRDLSGFGSMLFMALIGIVLASLVNLWLKSEALMW 169

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFIQIFVHLLR 252
            ++ +G+V+F  LTAYDTQK+K         D     + S++GAL LY+DFI +F+ LLR
Sbjct: 170 AVTYIGVVVFVGLTAYDTQKLKNIGEQLSVDDKDSFRKYSIVGALTLYLDFINLFLMLLR 229

Query: 253 FLGSRR 258
             G+RR
Sbjct: 230 IFGNRR 235


>gi|161614955|ref|YP_001588920.1| hypothetical protein SPAB_02709 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161364319|gb|ABX68087.1| hypothetical protein SPAB_02709 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 234

 Score =  154 bits (390), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 139/238 (58%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T   +F+    A T  P     + +  +  T FG      
Sbjct: 15  SGLQTYMAQVYGWMTVGLLLT---AFIAWYAANT--PAVMMFVFSSKI--TFFGV----- 62

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                 I A L +   L+  +H LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF
Sbjct: 63  ------IIAQLALVFALSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V
Sbjct: 117 VVTGGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVV 176

Query: 203 IFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K      D  D A   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|227113008|ref|ZP_03826664.1| hypothetical protein PcarbP_08603 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 235

 Score =  154 bits (390), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 145/246 (58%), Gaps = 23/246 (9%)

Query: 18  GSTIDQ---GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           GS +++   GL+AYM +VY  M  GL +T  +S+     A T  P   + + +    +T 
Sbjct: 8   GSIVERSQSGLQAYMAQVYGWMTCGLLLTAFVSWYA---ANT--PAVLNFVFSS--QITF 60

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           FG            I A LG+   ++  +  LS   A  +F+LYSAL GL+LSS F++Y+
Sbjct: 61  FG-----------LIIAQLGLVFVISGMVQRLSGAVATSLFMLYSALTGLTLSSIFIMYS 109

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
            +SI  TF ITA  FG++SLYGYTTKRDL   GS + M   G+ L SLVNL+++S A+  
Sbjct: 110 GESIASTFVITAGMFGAMSLYGYTTKRDLSGFGSMLFMALIGIVLASLVNLWLKSEALMW 169

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFIQIFVHLLR 252
            ++ +G+V+F  LTAYDTQK+K         D     + S++GAL LY+DFI +F+ LLR
Sbjct: 170 AVTYIGVVVFVGLTAYDTQKLKNIGEQLSVDDKDSFRKYSIVGALTLYLDFINLFLMLLR 229

Query: 253 FLGSRR 258
             G+RR
Sbjct: 230 IFGNRR 235


>gi|116748356|ref|YP_845043.1| hypothetical protein Sfum_0912 [Syntrophobacter fumaroxidans MPOB]
 gi|116697420|gb|ABK16608.1| protein of unknown function UPF0005 [Syntrophobacter fumaroxidans
           MPOB]
          Length = 232

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 94/230 (40%), Positives = 136/230 (59%), Gaps = 20/230 (8%)

Query: 31  RVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIF 90
           RVYN M +GL  T +++ L    +TT              +L  +  LM         + 
Sbjct: 22  RVYNWMGIGLATTAVVAMLTFSSSTTSR------------LLAQYPGLMLG------LVL 63

Query: 91  APLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFG 150
           A LG+ I ++  ++   A +A +MF +YSAL G++LS  FLVY   SI  TFF+TA  F 
Sbjct: 64  AELGLVIAISAGINRFRASSATLMFFIYSALNGVTLSVIFLVYAHSSIANTFFVTAGMFA 123

Query: 151 SLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAY 210
            +S+YGYTT+ DL  +G+F+ MG  G+ L S+VN+F+ S ++D  +S +G++IF  LTAY
Sbjct: 124 IMSVYGYTTRTDLTSLGNFLFMGLIGIILASVVNIFLGSQSLDWIISCLGVIIFVGLTAY 183

Query: 211 DTQKIKE-AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           DTQ IK  A+    D    ++ +VIGAL LY+DFI +F+ LLR  G RRD
Sbjct: 184 DTQSIKAMAHGGFADAETEQKAAVIGALRLYLDFINLFLMLLRLFG-RRD 232


>gi|238759760|ref|ZP_04620918.1| Inner membrane protein YbhL [Yersinia aldovae ATCC 35236]
 gi|238701992|gb|EEP94551.1| Inner membrane protein YbhL [Yersinia aldovae ATCC 35236]
          Length = 236

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 144/239 (60%), Gaps = 20/239 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + G++AYM +VY  M  GL +T ++++     A T  P   + I +  +  T FG     
Sbjct: 16  NSGIQAYMAQVYGWMTCGLLLTAVVAWYA---ANT--PAILNFIFSSQI--TFFG----- 63

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                  I   LG+   ++  ++ LS   A  +F+LYSAL GL++SS F++YTS SI  T
Sbjct: 64  ------LIIVQLGLVFVISGMVNRLSGSMATSLFMLYSALTGLTISSIFIMYTSSSIAST 117

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F I A  FG++S YGYTTKRDL  +GS + MG  G+ L S+VN++++S A+   ++ +G+
Sbjct: 118 FLIAAGMFGAMSFYGYTTKRDLSGLGSMLFMGLIGIVLASIVNIWLKSPALMWAVTYIGV 177

Query: 202 VIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++F  LTAYDTQK+K   A  D  D     + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 LVFVGLTAYDTQKLKNMGAQLDANDRDSFRKYSIVGALTLYLDFINLFLMLLRIFGNRR 236


>gi|46580874|ref|YP_011682.1| membrane protein [Desulfovibrio vulgaris str. Hildenborough]
 gi|120601821|ref|YP_966221.1| hypothetical protein Dvul_0772 [Desulfovibrio vulgaris DP4]
 gi|46450294|gb|AAS96942.1| membrane protein, putaive [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120562050|gb|ABM27794.1| protein of unknown function UPF0005 [Desulfovibrio vulgaris DP4]
 gi|311234568|gb|ADP87422.1| protein of unknown function UPF0005 [Desulfovibrio vulgaris RCH1]
          Length = 233

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 102/256 (39%), Positives = 144/256 (56%), Gaps = 27/256 (10%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y R + S +   +T      AYM  VY+ M LGL VT   ++        V    A I  
Sbjct: 2   YNRTMGSAARVEAT-----NAYMRGVYSWMTLGLAVTAAAAW-------GVASSEALIAF 49

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G     FG            I A   + I ++  +  LSA  A  +FLLYSAL GL+L
Sbjct: 50  IFGNTFVFFG-----------LIIAEFALVIGISAGIARLSAGMASGLFLLYSALNGLTL 98

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS  LVY   ++ Q F  TA  F  +S+YG TTKRDL  +GSF++MG FG+ L S+VN+F
Sbjct: 99  SSILLVYAQSAVFQAFITTAGMFAVMSIYGATTKRDLTSMGSFLMMGLFGIILASVVNIF 158

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDF 243
           MRSS ++  +SA+G+++F+ LTAYDTQK+K A+ +     D     R +++GAL LY+DF
Sbjct: 159 MRSSMMEFIISAVGVLVFTGLTAYDTQKLK-AFGENAPMDDAVAIRRGTILGALTLYLDF 217

Query: 244 IQIFVHLLRFLGSRRD 259
           + +F+ ++R  GS RD
Sbjct: 218 VNLFIMMVRLFGSSRD 233


>gi|332091045|gb|EGI96135.1| hypothetical protein SD15574_2523 [Shigella dysenteriae 155-74]
          Length = 214

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 114/172 (66%), Gaps = 2/172 (1%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A L + I L+  +  LSA    M+F+LYS L GL+LSS F+VYT+ SI  TF +TA  
Sbjct: 43  IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSVLTGLTLSSIFIVYTAASIASTFVVTAGM 102

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  LT
Sbjct: 103 FGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVGLT 162

Query: 209 AYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 163 AYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 214


>gi|224531786|ref|ZP_03672418.1| putative membrane protein [Borrelia valaisiana VS116]
 gi|224511251|gb|EEF81657.1| putative membrane protein [Borrelia valaisiana VS116]
          Length = 232

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 92/238 (38%), Positives = 148/238 (62%), Gaps = 25/238 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ + ++     AT+ +    +II              +++P+ 
Sbjct: 15  NKFLAKVFGLMSIGLLISAMFAY-----ATSENQTIKAII--------------FSNPMS 55

Query: 86  WI-FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
           ++  I    G+   ++  L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF I
Sbjct: 56  FMTIILIQFGLVYAISGALNKISSNTAIALFLLYSALTGVTLSSIFMIYTQGSIVFTFGI 115

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TA +F  +S+YGYTT  DL  +GS+MIMG +G+ + SLVN+F RSS ++  +S +G++IF
Sbjct: 116 TAGTFLGMSVYGYTTTTDLTKMGSYMIMGLWGIIIASLVNMFFRSSGLNFLISILGVIIF 175

Query: 205 SALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           + LTAYD Q I  A  D+    D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 176 TGLTAYDVQNI--AKMDKMLQDDTEVKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|157146579|ref|YP_001453898.1| hypothetical protein CKO_02340 [Citrobacter koseri ATCC BAA-895]
 gi|157083784|gb|ABV13462.1| hypothetical protein CKO_02340 [Citrobacter koseri ATCC BAA-895]
          Length = 249

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 138/237 (58%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T   +F+    A T  P     + +  +  T FG       
Sbjct: 31  GLQTYMAQVYGWMTVGLLLT---AFIAWYAANT--PAVMMFVFSSKI--TFFG------- 76

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L + I L+  +  LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF 
Sbjct: 77  ----LIIAQLALVIALSAMVQKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTFV 132

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +T   FG +SLYGYTTKRDL   GS + M   G+ L SLVN +++S A+   ++ +G+V+
Sbjct: 133 VTGGMFGVMSLYGYTTKRDLSGWGSMLFMALIGIILASLVNFWLKSEALMWAVTYIGVVV 192

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 193 FVGLTAYDTQKLKNIGEQIDVRDSSTLRKYSILGALTLYLDFINLFLMLLRIFGNRR 249


>gi|315185953|gb|EFU19717.1| protein of unknown function UPF0005 [Spirochaeta thermophila DSM
           6578]
          Length = 234

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 86/183 (46%), Positives = 124/183 (67%), Gaps = 3/183 (1%)

Query: 80  YTSPLRW-IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +++PL + + I   L +  +L++R+  +S +AA + F  YSAL G++L+  FLVYT  SI
Sbjct: 52  FSNPLIFFLLIGGELALVFYLSLRIQKMSPFAATVAFASYSALNGVTLAPLFLVYTGTSI 111

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            Q FFITAA+F  +S YGY TKRDL  +GS + M  +GL + SLVN+F+RS    L +S 
Sbjct: 112 AQVFFITAATFAGMSAYGYLTKRDLSRVGSIVGMALWGLIIASLVNIFLRSEGFSLIISY 171

Query: 199 MGLVIFSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           +G++IF  LTAYDTQ +K+  +  D  D +   R S++GAL LY+DFI +F+ LLR +GS
Sbjct: 172 VGVLIFVGLTAYDTQILKQWATQIDPSDESVYVRFSIMGALKLYLDFINLFLFLLRIMGS 231

Query: 257 RRD 259
           RRD
Sbjct: 232 RRD 234


>gi|56414092|ref|YP_151167.1| permease [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|197363014|ref|YP_002142651.1| permease [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|56128349|gb|AAV77855.1| putative permease [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197094491|emb|CAR60009.1| putative permease [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
          Length = 234

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 99/237 (41%), Positives = 139/237 (58%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T   +F+    A T  P     + +  +  T FG       
Sbjct: 16  GLQTYMAQVYGWMTVGLLLT---AFIAWYAANT--PAVMMFVFSSKI--TFFG------- 61

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L +   L+  +H LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF 
Sbjct: 62  ----LIIAQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +T   FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++
Sbjct: 118 VTGEMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVMV 177

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D A   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 FVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|313886339|ref|ZP_07820064.1| putative membrane protein [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|312924208|gb|EFR34992.1| putative membrane protein [Porphyromonas asaccharolytica
           PR426713P-I]
          Length = 242

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 88/193 (45%), Positives = 125/193 (64%), Gaps = 3/193 (1%)

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
           GV+ +G    + +S   W+ I A L +   L+ R++ +S   A +M ++YSAL G +LS 
Sbjct: 50  GVVNSGLFYQIASSGAMWLLIIAELVLVFVLSARINKMSVTTATIMLIVYSALNGATLSF 109

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            FL Y+  SI +TFFIT   FG ++L G TTKRDL  +GS ++M   GL + SLVN+F+R
Sbjct: 110 IFLAYSLGSIAKTFFITTGMFGVMALVGATTKRDLSKMGSILLMALIGLIIASLVNIFLR 169

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           SS +D  +S +G+V+F+ALTAYD Q++K     SD YD     R +VI AL LY+DFI +
Sbjct: 170 SSGLDWIISLIGVVLFTALTAYDVQRVKRLATESDLYDDTQVGRLAVISALSLYLDFINL 229

Query: 247 FVHLLRFLGSRRD 259
           F++LLRF G R D
Sbjct: 230 FLYLLRFFG-RND 241


>gi|62179375|ref|YP_215792.1| putative permease [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62127008|gb|AAX64711.1| putative permease [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322713846|gb|EFZ05417.1| putative permease [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 234

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 99/238 (41%), Positives = 138/238 (57%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T   +F+    A T  P     + +  +  T FG      
Sbjct: 15  SGLQTYMAQVYGWMTVGLLLT---AFIAWYAANT--PAVMMFVFSSKI--TFFG------ 61

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                 I A L +   L+  +H LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF
Sbjct: 62  -----LIIAQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V
Sbjct: 117 VVTGGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVV 176

Query: 203 IFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K      D  D A   + S++G L LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGTLTLYLDFINLFLMLLRIFGNRR 234


>gi|259909028|ref|YP_002649384.1| membrane protein [Erwinia pyrifoliae Ep1/96]
 gi|224964650|emb|CAX56164.1| membrane protein [Erwinia pyrifoliae Ep1/96]
 gi|283479044|emb|CAY74960.1| Inner membrane protein ybhL [Erwinia pyrifoliae DSM 12163]
 gi|310767074|gb|ADP12024.1| membrane protein [Erwinia sp. Ejp617]
          Length = 236

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 95/238 (39%), Positives = 139/238 (58%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            G+  YM +VY  M  GL +T  +S+     A         +  NR   +T FG +++  
Sbjct: 17  SGISVYMAQVYGWMTCGLLLTAFISWY----AANTPAVMQLVFANR---ITFFGLIIF-- 67

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                     LG+   L+  +H LS   A  +F+LYSAL GL+++S FLVYT  SI  TF
Sbjct: 68  ---------QLGLVFVLSGMVHKLSGAVATGLFMLYSALTGLTMASIFLVYTYSSIASTF 118

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG++SL+GYTTKRDL  +GS + M   G+ L SLVN++++S+A+   ++ +G+V
Sbjct: 119 VVTGGMFGAMSLWGYTTKRDLSGMGSMLFMALIGIVLASLVNIWLKSTALMWAVTYIGVV 178

Query: 203 IFSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K      +  D     R S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 179 VFVGLTAYDTQKLKNIGEGINVEDKENMRRYSIMGALTLYLDFINLFLMLLRIFGNRR 236


>gi|332300273|ref|YP_004442194.1| protein of unknown function UPF0005 [Porphyromonas asaccharolytica
           DSM 20707]
 gi|332177336|gb|AEE13026.1| protein of unknown function UPF0005 [Porphyromonas asaccharolytica
           DSM 20707]
          Length = 241

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 88/193 (45%), Positives = 125/193 (64%), Gaps = 3/193 (1%)

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
           GV+ +G    + +S   W+ I A L +   L+ R++ +S   A +M ++YSAL G +LS 
Sbjct: 50  GVVNSGLFYQIASSGAMWLLIIAELVLVFVLSARINKMSVTTATIMLIVYSALNGATLSF 109

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            FL Y+  SI +TFFIT   FG ++L G TTKRDL  +GS ++M   GL + SLVN+F+R
Sbjct: 110 IFLAYSLGSIAKTFFITTGMFGVMALVGATTKRDLSKMGSILLMALIGLIIASLVNIFLR 169

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           SS +D  +S +G+V+F+ALTAYD Q++K     SD YD     R +VI AL LY+DFI +
Sbjct: 170 SSGLDWIISLIGVVLFTALTAYDVQRVKRLATESDLYDDTQVGRLAVISALSLYLDFINL 229

Query: 247 FVHLLRFLGSRRD 259
           F++LLRF G R D
Sbjct: 230 FLYLLRFFG-RND 241


>gi|238753341|ref|ZP_04614704.1| Inner membrane protein YbhL [Yersinia ruckeri ATCC 29473]
 gi|238708294|gb|EEQ00649.1| Inner membrane protein YbhL [Yersinia ruckeri ATCC 29473]
          Length = 236

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 141/239 (58%), Gaps = 20/239 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + G++AYM +VY  M  GL +T  +++      T   P     I +    +T FG     
Sbjct: 16  NTGIQAYMAQVYGWMTCGLLLTAFVAWY-----TASTPAILHFIFSS--QITFFG----- 63

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                  I A LG+   ++  ++ LS   A  +F+LYSAL GL+LSS  ++YT  SI  T
Sbjct: 64  ------LIIAQLGLVFVISGMVNRLSGTMATSLFMLYSALTGLTLSSILVMYTGASIAST 117

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F I A  FG++S++GYTTKRDL  +GS + MG  G+ L SLVN++++S A+   ++ +G+
Sbjct: 118 FIICAGMFGAMSVFGYTTKRDLSGMGSMLFMGLIGIVLASLVNIWLKSDALMWAVTYIGV 177

Query: 202 VIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           V+F  LTAYDTQK+K   A  D  D     + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 VVFVGLTAYDTQKLKNMGAQLDANDKDSFRKYSIVGALTLYLDFINLFLMLLRIFGNRR 236


>gi|221236714|ref|YP_002519151.1| integral membrane protein [Caulobacter crescentus NA1000]
 gi|15214335|sp|Q9A2A3|Y3663_CAUCR RecName: Full=Uncharacterized protein CC_3663
 gi|220965887|gb|ACL97243.1| integral membrane protein [Caulobacter crescentus NA1000]
          Length = 250

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 100/265 (37%), Positives = 153/265 (57%), Gaps = 21/265 (7%)

Query: 1   MSDI-RNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D  R Y R + +      ++D GLR +M+ VYN +ALGL V+G +++     AT+  P
Sbjct: 1   MNDFNRGYARSIPADRA-DMSVDAGLRKFMLGVYNKVALGLVVSGALAY-----ATSSVP 54

Query: 60  DAASII-INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
               ++ + +G  L G       +PL  +  FAPL + +     + +     A  ++   
Sbjct: 55  AVRDLLFVVQGGRLAG------VTPLYMVVAFAPLVLMLIAGFAMRNPKPETAGALYWTI 108

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
            +LIG SL S  L YT +S+  TFF+TA +FG LSL+GYTTK+DL   GSF++MG  GL 
Sbjct: 109 VSLIGASLGSVMLRYTGESVAATFFVTATAFGGLSLFGYTTKKDLTGFGSFLMMGVIGLI 168

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY----SDRYDVAYAERQSVI 234
           + S+V++F++S A+   ++ +G++IFS L AYDTQ++K  Y     DR  +A A      
Sbjct: 169 VASIVSIFLKSPALLFAINVLGVLIFSGLIAYDTQRLKMTYYEMGGDRASMAVATN---F 225

Query: 235 GALMLYMDFIQIFVHLLRFLGSRRD 259
           GAL LY++FI +F  LL F G  R+
Sbjct: 226 GALSLYINFINLFQFLLSFFGGNRE 250


>gi|322419616|ref|YP_004198839.1| hypothetical protein GM18_2100 [Geobacter sp. M18]
 gi|320126003|gb|ADW13563.1| protein of unknown function UPF0005 [Geobacter sp. M18]
          Length = 224

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 119/171 (69%), Gaps = 8/171 (4%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           +F  LG+ + ++  ++ +S+  A ++FLLY+AL GL++S+ F+VYT  SI  TF ITA  
Sbjct: 61  VFGELGLVVAISGAINRISSATASLLFLLYAALNGLTMSTIFVVYTQSSIASTFLITAGM 120

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGY TK DL   GSF+ MG  G+ + SLVN+F++SS +   MS  G+++F+ LT
Sbjct: 121 FGAMSLYGYLTKSDLSSWGSFLFMGLVGVVIASLVNIFLQSSMLGWVMSLCGILVFTGLT 180

Query: 209 AYDTQKIKE-AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQKIK+   S R       + +++GAL LY+DFI +F+ LLRF G+RR
Sbjct: 181 AYDTQKIKQMGVSGR-------KGAILGALTLYLDFINMFLLLLRFFGNRR 224


>gi|224026838|ref|ZP_03645204.1| hypothetical protein BACCOPRO_03595 [Bacteroides coprophilus DSM
           18228]
 gi|224020074|gb|EEF78072.1| hypothetical protein BACCOPRO_03595 [Bacteroides coprophilus DSM
           18228]
          Length = 233

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 77/176 (43%), Positives = 123/176 (69%), Gaps = 4/176 (2%)

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           W  + A  G+  +++ R++ +S   A ++F++YS L G+++S  FL+YT  SI  TFF+T
Sbjct: 59  WGVLIAEFGLVFYMSARINRISFTTATILFIVYSILNGVTMSMLFLIYTMSSIATTFFVT 118

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +FG+++L+GY TK+DL  IG+  IMG  GL + SLVN+F+ +S +DL +S +G+++F 
Sbjct: 119 AGTFGAMALFGYATKKDLTRIGNLCIMGVIGLIIASLVNMFLHNSMMDLIISYVGVLLFV 178

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            LTAYD+QKIK+  S   D+   E   + +++GAL LY+DFI +F++LLR LG R+
Sbjct: 179 GLTAYDSQKIKQMLSGE-DIEVNETTQKIALMGALTLYLDFINLFLYLLRILGDRK 233


>gi|261822197|ref|YP_003260303.1| hypothetical protein Pecwa_2947 [Pectobacterium wasabiae WPP163]
 gi|261606210|gb|ACX88696.1| protein of unknown function UPF0005 [Pectobacterium wasabiae
           WPP163]
          Length = 235

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 100/246 (40%), Positives = 142/246 (57%), Gaps = 23/246 (9%)

Query: 18  GSTIDQ---GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           GS +++   GL+AYM +VY  M  GL +T  +S+         D   +S +       T 
Sbjct: 8   GSIVERSQSGLQAYMAQVYGWMGCGLLLTAFVSWYAAHTPAVFDFVFSSRV-------TF 60

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           FG            I A LG+   ++  +  LS   A  +F+LYSAL GL+LSS F VY+
Sbjct: 61  FG-----------LIIAQLGLVFVISGMVQRLSGAVATSLFMLYSALTGLTLSSIFAVYS 109

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
           ++SI  TF ITA  FG++SLYGYTTKRDL   GS + M   G+ L SLVNL+++S A+  
Sbjct: 110 TESIASTFVITAGMFGAMSLYGYTTKRDLSGFGSMLFMALIGIILASLVNLWLKSEALMW 169

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFIQIFVHLLR 252
            ++ +G+V+F  LTAYDTQK+K         D     + +++GAL LY+DFI +F+ LLR
Sbjct: 170 AVTYIGVVVFVGLTAYDTQKLKNIGEQLSVDDKDSFRKYAIVGALTLYLDFINLFLMLLR 229

Query: 253 FLGSRR 258
             G+RR
Sbjct: 230 IFGNRR 235


>gi|149186193|ref|ZP_01864507.1| integral membrane protein [Erythrobacter sp. SD-21]
 gi|148830224|gb|EDL48661.1| integral membrane protein [Erythrobacter sp. SD-21]
          Length = 260

 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 96/243 (39%), Positives = 153/243 (62%), Gaps = 10/243 (4%)

Query: 18  GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
           G+T D+GLR +M+ +YN+MA G+ +TGI++ L   + T +   A +++       T +G 
Sbjct: 26  GTTFDEGLRKHMLSIYNMMASGVLLTGIVALL--FVNTPLFESAFNVV------QTPYGR 77

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVR-LHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK 136
            + T+ L W+   APL   + ++   +   S    + MF  ++ L+GLSLS+ F VYT +
Sbjct: 78  SLQTTGLGWVIKLAPLAFILVISFGGVQRFSKTTLQAMFWGFATLMGLSLSTIFAVYTGE 137

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM-RSSAIDLT 195
           S+   FF  AA+F  LSLYGYTTK++L   GSF++MG  G+ +  L+N F+ +S A+ L 
Sbjct: 138 SVASAFFAAAAAFAGLSLYGYTTKKNLSGWGSFLMMGLIGIIVAMLLNAFIFQSGAMGLV 197

Query: 196 MSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           +S +G++IF+  TAYDTQ++KE Y       +A +  V+GAL LY+DFI +F+ +L+FLG
Sbjct: 198 ISILGVLIFAGFTAYDTQRLKEEYQYLRGTEFAGKAVVMGALSLYLDFINLFLFILQFLG 257

Query: 256 SRR 258
           +R 
Sbjct: 258 NRE 260


>gi|16127893|ref|NP_422457.1| hypothetical protein CC_3663 [Caulobacter crescentus CB15]
 gi|13425421|gb|AAK25625.1| conserved hypothetical protein [Caulobacter crescentus CB15]
          Length = 281

 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 100/265 (37%), Positives = 153/265 (57%), Gaps = 21/265 (7%)

Query: 1   MSDI-RNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D  R Y R + +      ++D GLR +M+ VYN +ALGL V+G +++     AT+  P
Sbjct: 32  MNDFNRGYARSIPADRA-DMSVDAGLRKFMLGVYNKVALGLVVSGALAY-----ATSSVP 85

Query: 60  DAASII-INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
               ++ + +G  L G       +PL  +  FAPL + +     + +     A  ++   
Sbjct: 86  AVRDLLFVVQGGRLAG------VTPLYMVVAFAPLVLMLIAGFAMRNPKPETAGALYWTI 139

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
            +LIG SL S  L YT +S+  TFF+TA +FG LSL+GYTTK+DL   GSF++MG  GL 
Sbjct: 140 VSLIGASLGSVMLRYTGESVAATFFVTATAFGGLSLFGYTTKKDLTGFGSFLMMGVIGLI 199

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY----SDRYDVAYAERQSVI 234
           + S+V++F++S A+   ++ +G++IFS L AYDTQ++K  Y     DR  +A A      
Sbjct: 200 VASIVSIFLKSPALLFAINVLGVLIFSGLIAYDTQRLKMTYYEMGGDRASMAVATN---F 256

Query: 235 GALMLYMDFIQIFVHLLRFLGSRRD 259
           GAL LY++FI +F  LL F G  R+
Sbjct: 257 GALSLYINFINLFQFLLSFFGGNRE 281


>gi|238785225|ref|ZP_04629217.1| Inner membrane protein YbhL [Yersinia bercovieri ATCC 43970]
 gi|238713903|gb|EEQ05923.1| Inner membrane protein YbhL [Yersinia bercovieri ATCC 43970]
          Length = 236

 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 143/239 (59%), Gaps = 20/239 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + G++AYM +VY  M  GL +T ++++     A T  P   + I +    +T FG     
Sbjct: 16  NTGIQAYMAQVYGWMTCGLLLTAVVAWYA---ANT--PAVLNFIFSS--QITFFG----- 63

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                  I A LG+   ++  ++ LS   A  +F+LYSAL GL+LSS  ++YT  SI  T
Sbjct: 64  ------LIIAQLGLVFVISGMVNRLSGSMATSLFMLYSALTGLTLSSVLIMYTGASIAST 117

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F I A  FG++S YGYTTKRDL  +GS + MG  G+ L S+VN++++S A+   ++ +G+
Sbjct: 118 FIICAGMFGAMSFYGYTTKRDLSGMGSMLFMGLIGIVLASVVNIWLKSPALMWAVTYIGV 177

Query: 202 VIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++F  LTAYDTQK+K   A  D  D     + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 LVFVGLTAYDTQKLKNMGAQLDANDKDSFRKYSIVGALTLYLDFINLFLMLLRIFGNRR 236


>gi|216263386|ref|ZP_03435381.1| putative membrane protein [Borrelia afzelii ACA-1]
 gi|215980230|gb|EEC21051.1| putative membrane protein [Borrelia afzelii ACA-1]
          Length = 232

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 148/237 (62%), Gaps = 23/237 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ + ++     AT+ +    +II +  +      + M    ++
Sbjct: 15  NKFLAKVFGLMSIGLLISAMFAY-----ATSENQTIKAIIFSNSM------SFMTLILIQ 63

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           +  ++A  G        L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 64  FGLVYAIGGA-------LNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS++IMG +G+ + SLVN+F RSS ++L +S +G+VIF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYLIMGLWGIIIASLVNMFFRSSGLNLLISILGVVIFT 176

Query: 206 ALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +   D+    D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNISKM--DKMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|123443109|ref|YP_001007083.1| hypothetical protein YE2895 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332161006|ref|YP_004297583.1| hypothetical protein YE105_C1384 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|122090070|emb|CAL12933.1| putative membrane protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318604878|emb|CBY26376.1| putative membrane protein [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665236|gb|ADZ41880.1| hypothetical protein YE105_C1384 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330859398|emb|CBX69743.1| inner membrane protein ybhL [Yersinia enterocolitica W22703]
          Length = 236

 Score =  152 bits (384), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 95/239 (39%), Positives = 143/239 (59%), Gaps = 20/239 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + G++AYM +VY  M  GL +T ++++     A T  P   + I +    +T FG     
Sbjct: 16  NSGIQAYMAQVYGWMTCGLLLTAVVAWYA---ANT--PAVMNFIFSS--QITFFG----- 63

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                  I   LG+   ++  ++ LS   A  +F+LYSAL GL+LSS  ++YT  SI  T
Sbjct: 64  ------LIIVQLGLVFVISGMVNRLSGSMATSLFMLYSALTGLTLSSILIMYTGASIAST 117

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F I A  FG++S+YGYTTKRDL  +GS + MG  G+ L S+VN++++S A+   ++ +G+
Sbjct: 118 FIICAGMFGAMSVYGYTTKRDLSGMGSMLFMGLIGIVLASIVNIWLKSPALMWAVTYIGV 177

Query: 202 VIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++F  LTAYDTQK+K   A  D  D     + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 LVFVGLTAYDTQKLKNMGAQLDSNDRDNFRKYSIVGALTLYLDFINLFLMLLRIFGNRR 236


>gi|212704988|ref|ZP_03313116.1| hypothetical protein DESPIG_03056 [Desulfovibrio piger ATCC 29098]
 gi|212671652|gb|EEB32135.1| hypothetical protein DESPIG_03056 [Desulfovibrio piger ATCC 29098]
          Length = 232

 Score =  152 bits (384), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 93/236 (39%), Positives = 134/236 (56%), Gaps = 24/236 (10%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           YM +VY  M  GL +T + +F     A    PD    I+   V++               
Sbjct: 17  YMRQVYMWMTAGLAITAVTAF-----AVASSPDLQMAILGNMVIMIAL------------ 59

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
            I A  G+ I L+  +H +SA  A  +F+ YSAL GL+LSS F+VY   SI   F     
Sbjct: 60  -IVAQFGLVIALSAAIHKMSATTATAVFIAYSALTGLTLSSIFVVYPIGSIANAFLTATG 118

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
           +F ++S+YG  TKRDL  +G+F+IMG FG+ + S+VN+F+ SS +D  +S +G++IF+ L
Sbjct: 119 TFLAMSVYGTVTKRDLTGMGNFLIMGLFGIIIASIVNIFLASSMMDFVISCIGVLIFTGL 178

Query: 208 TAYDTQKIK----EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           TAYDTQK++     A  D  D     R +++GAL LY+DFI +F+ LLR  G  RD
Sbjct: 179 TAYDTQKLRVFGMNAPVD--DATAMRRGALLGALELYLDFINLFLMLLRLFGGNRD 232


>gi|78357643|ref|YP_389092.1| membrane protein [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
 gi|78220048|gb|ABB39397.1| membrane protein, putative [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 233

 Score =  152 bits (384), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 90/237 (37%), Positives = 142/237 (59%), Gaps = 20/237 (8%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           + A+M  VY  MA GL VT + +F     A    P    +I         FG    T  L
Sbjct: 15  VNAFMRGVYQWMAAGLAVTAVSAF-----AVASSPALLQLI---------FG----TPML 56

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
             + +   +G+  +++ R+ ++SA  A  +F++YSAL G+ LSS  +VY + S+ Q F  
Sbjct: 57  PLVLMIGLVGLVFYMSARIGTMSAGTATTLFMVYSALNGVVLSSVLIVYATASVFQAFVT 116

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
            AA FG++++YG TTKRDL  +GSFM MG  G+ + S+VN+F+ SS ++L +SA+G+++F
Sbjct: 117 AAAMFGAMTVYGMTTKRDLTSMGSFMFMGLIGILIASVVNIFLGSSMMELVISAIGVIVF 176

Query: 205 SALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           + LTAYD+Q++++    +   D     R +++GAL LY+DFI +F+ LLR  G  RD
Sbjct: 177 TGLTAYDSQQLRQMGETAPMDDPVAIRRGTILGALRLYLDFINLFLMLLRLFGGARD 233


>gi|157369568|ref|YP_001477557.1| hypothetical protein Spro_1325 [Serratia proteamaculans 568]
 gi|157321332|gb|ABV40429.1| protein of unknown function UPF0005 [Serratia proteamaculans 568]
          Length = 236

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 96/241 (39%), Positives = 142/241 (58%), Gaps = 24/241 (9%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + G++AYM +VY  M  G+ +T  +S+     A T  P   + I +  +   G       
Sbjct: 16  NSGIQAYMAQVYGWMTCGMLLTAFVSWYA---ANT--PAILNFIFSSQITFFGL------ 64

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                  I A LG+   ++  ++ LS   A  +F+LYSAL GL+LSS F+ YT  SI  T
Sbjct: 65  -------IIAQLGLVFVISGMVNRLSGTVATSLFMLYSALTGLTLSSIFIAYTYSSIAST 117

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F +TA  FG++SLYGYTTKRDL   GS + M   G+ L SLVN++++SSA+   ++ +G+
Sbjct: 118 FVVTAGMFGAMSLYGYTTKRDLSGFGSMLFMALIGIVLASLVNIWLKSSALMWAITYIGV 177

Query: 202 VIFSALTAYDTQKIK----EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           V+F  LTAYDTQK+K    +  +D  D     + +++GAL LY+DFI +F+ LLR  G+R
Sbjct: 178 VVFVGLTAYDTQKLKAMGEQLNADDKDS--FRKYAIVGALTLYLDFINLFLMLLRIFGNR 235

Query: 258 R 258
           R
Sbjct: 236 R 236


>gi|188534380|ref|YP_001908177.1| hypothetical protein ETA_22530 [Erwinia tasmaniensis Et1/99]
 gi|188029422|emb|CAO97299.1| Putative membrane protein [Erwinia tasmaniensis Et1/99]
          Length = 236

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 139/239 (58%), Gaps = 22/239 (9%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            G+  YM +VY  M  GL +T  +++     A         +  NR   +T FG      
Sbjct: 17  SGISVYMAQVYGWMTCGLLLTAFIAWY----AANTPAVMQLVFANR---ITFFG------ 63

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                 I A L +   L+  +H LS   A  +F+LYSAL GL+++S FL YT  SI  TF
Sbjct: 64  -----LIIAQLALVFVLSGMVHKLSGTVATGLFMLYSALTGLTMASIFLAYTYSSIASTF 118

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG++SL+GYTTKRDL  +GS + M   G+ L SLVN++++S+A+   ++ +G+V
Sbjct: 119 VVTGGMFGAMSLWGYTTKRDLSGMGSMLFMALIGIVLASLVNIWLKSTALMWAVTYIGVV 178

Query: 203 IFSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K    +  DV+  E   R S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 179 VFVGLTAYDTQKLKNI-GEGIDVSDKENLRRYSIMGALTLYLDFINLFLMLLRIFGNRR 236


>gi|224534717|ref|ZP_03675289.1| putative membrane protein [Borrelia spielmanii A14S]
 gi|224513965|gb|EEF84287.1| putative membrane protein [Borrelia spielmanii A14S]
          Length = 232

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 147/237 (62%), Gaps = 23/237 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ + ++     AT+ +    +II +  +      + M    ++
Sbjct: 15  NKFLAKVFGLMSIGLLISAMFAY-----ATSENQTIKAIIFSNSM------SFMAIILIQ 63

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           +  ++A  G        L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 64  FGLVYAISGA-------LNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS+MIMG +G+ + SLVN+F RSS ++  +S +G++IF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYMIMGLWGIIIASLVNMFFRSSGLNFLISILGVIIFT 176

Query: 206 ALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +   D+    D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNISKM--DKMLQDDTEVKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|15594884|ref|NP_212673.1| hypothetical protein BB0539 [Borrelia burgdorferi B31]
 gi|195941673|ref|ZP_03087055.1| hypothetical protein Bbur8_02171 [Borrelia burgdorferi 80a]
 gi|216264211|ref|ZP_03436203.1| putative membrane protein [Borrelia burgdorferi 156a]
 gi|218249285|ref|YP_002375045.1| hypothetical protein BbuZS7_0549 [Borrelia burgdorferi ZS7]
 gi|225548731|ref|ZP_03769778.1| putative membrane protein [Borrelia burgdorferi 94a]
 gi|225552130|ref|ZP_03773070.1| putative membrane protein [Borrelia sp. SV1]
 gi|226321845|ref|ZP_03797371.1| putative membrane protein [Borrelia burgdorferi Bol26]
 gi|15214340|sp|O51489|Y539_BORBU RecName: Full=Uncharacterized protein BB_0539
 gi|2688450|gb|AAC66898.1| conserved hypothetical integral membrane protein [Borrelia
           burgdorferi B31]
 gi|215980684|gb|EEC21491.1| putative membrane protein [Borrelia burgdorferi 156a]
 gi|218164473|gb|ACK74534.1| putative membrane protein [Borrelia burgdorferi ZS7]
 gi|225370761|gb|EEH00197.1| putative membrane protein [Borrelia burgdorferi 94a]
 gi|225371128|gb|EEH00558.1| putative membrane protein [Borrelia sp. SV1]
 gi|226233034|gb|EEH31787.1| putative membrane protein [Borrelia burgdorferi Bol26]
 gi|312148125|gb|ADQ30784.1| membrane protein, putative [Borrelia burgdorferi JD1]
 gi|312149727|gb|ADQ29798.1| membrane protein, putative [Borrelia burgdorferi N40]
          Length = 232

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 147/237 (62%), Gaps = 23/237 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ + ++     AT+ +    +II +  +      + M    ++
Sbjct: 15  NKFLAKVFGLMSIGLLISAVFAY-----ATSENQTIKAIIFSNSM------SFMAMILIQ 63

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           +  ++A  G        L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 64  FGLVYAISGA-------LNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS++IMG +G+ + SLVN+F RSS ++  +S +G+VIF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYLIMGLWGIIIASLVNMFFRSSGLNFLISILGVVIFT 176

Query: 206 ALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +   D+    D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNISKM--DKMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|156934723|ref|YP_001438639.1| hypothetical protein ESA_02558 [Cronobacter sakazakii ATCC BAA-894]
 gi|156532977|gb|ABU77803.1| hypothetical protein ESA_02558 [Cronobacter sakazakii ATCC BAA-894]
          Length = 235

 Score =  152 bits (383), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 143/241 (59%), Gaps = 28/241 (11%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ +M +VY  M  GL +T  +++            +A+   N  +M       MY   
Sbjct: 17  GLQTFMAQVYGWMTCGLLLTAFVAWY-----------SAN---NENLM-------MYIFS 55

Query: 84  LRWIF---IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            R++F   I A L +   L+  +H LS   A  +F+LYSAL GL+LSS FLVYT  SI  
Sbjct: 56  SRFVFFGLIIAQLALVFVLSGLVHKLSPAVATALFMLYSALTGLTLSSIFLVYTYASIAS 115

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
           TF +TA  FG +SLYGYTTKRDL   G+ + M   GL + SLVN +++S+A+   ++ +G
Sbjct: 116 TFVVTAGMFGVMSLYGYTTKRDLSGWGNILFMALIGLIIASLVNFWLKSTALMWAVTYIG 175

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDV---AYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           +++F  LTAYDTQK+K A  ++ DV       + S++GAL LY+DFI +F+ LLR  G+R
Sbjct: 176 VIVFVGLTAYDTQKLK-ALGEQIDVNDHGNLRKYSILGALTLYLDFINLFLMLLRIFGNR 234

Query: 258 R 258
           R
Sbjct: 235 R 235


>gi|194448564|ref|YP_002044834.1| hypothetical protein SeHA_C0933 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194406868|gb|ACF67087.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
          Length = 237

 Score =  152 bits (383), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 99/238 (41%), Positives = 137/238 (57%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T   +F+    A T  P     + +  +  T FG      
Sbjct: 15  SGLQTYMAQVYGWMTVGLLLT---AFIAWYAANT--PAVMMFVFSSKI--TFFG------ 61

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                 I A L +   L+  +H LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF
Sbjct: 62  -----LIIAQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V
Sbjct: 117 VVTGGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVV 176

Query: 203 IFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K      D  D A   + S++GAL LY+DFI +F+ LLR  G  R
Sbjct: 177 VFVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGKVR 234


>gi|224533558|ref|ZP_03674147.1| putative membrane protein [Borrelia burgdorferi CA-11.2a]
 gi|224513231|gb|EEF83593.1| putative membrane protein [Borrelia burgdorferi CA-11.2a]
          Length = 232

 Score =  152 bits (383), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 90/237 (37%), Positives = 147/237 (62%), Gaps = 23/237 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ + ++     AT+ +    +II +  +      + M    ++
Sbjct: 15  NKFLAKVFGLMSIGLLISAVFAY-----ATSENQTIKAIIFSNSM------SFMAMILIQ 63

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           +  ++A  G        L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 64  FGLVYAISGT-------LNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS++IMG +G+ + SLVN+F RSS ++  +S +G++IF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYLIMGLWGIIIASLVNMFFRSSGLNFLISILGVIIFT 176

Query: 206 ALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +   D+    D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNISKM--DKMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|221218123|ref|ZP_03589589.1| putative membrane protein [Borrelia burgdorferi 72a]
 gi|224532707|ref|ZP_03673324.1| putative membrane protein [Borrelia burgdorferi WI91-23]
 gi|225549638|ref|ZP_03770604.1| putative membrane protein [Borrelia burgdorferi 118a]
 gi|226320961|ref|ZP_03796508.1| putative membrane protein [Borrelia burgdorferi 29805]
 gi|221192071|gb|EEE18292.1| putative membrane protein [Borrelia burgdorferi 72a]
 gi|224512325|gb|EEF82709.1| putative membrane protein [Borrelia burgdorferi WI91-23]
 gi|225369915|gb|EEG99362.1| putative membrane protein [Borrelia burgdorferi 118a]
 gi|226233634|gb|EEH32368.1| putative membrane protein [Borrelia burgdorferi 29805]
          Length = 232

 Score =  151 bits (382), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 90/237 (37%), Positives = 147/237 (62%), Gaps = 23/237 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ + ++     AT+ +    +II +  +      + M    ++
Sbjct: 15  NKFLAKVFGLMSIGLLISAVFAY-----ATSENQTIKAIIFSNSM------SFMAMILIQ 63

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           +  ++A  G        L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 64  FGLVYAISGA-------LNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS++IMG +G+ + SLVN+F RSS ++  +S +G++IF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYLIMGLWGIIIASLVNMFFRSSGLNFLISILGVIIFT 176

Query: 206 ALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +   D+    D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNISKM--DKMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|223889018|ref|ZP_03623609.1| putative membrane protein [Borrelia burgdorferi 64b]
 gi|223885834|gb|EEF56933.1| putative membrane protein [Borrelia burgdorferi 64b]
          Length = 232

 Score =  151 bits (382), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 146/237 (61%), Gaps = 23/237 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ + ++     AT+ +    +II +  +      + M    ++
Sbjct: 15  NKFLAKVFGLMSIGLLISAVFAY-----ATSENQTIKAIIFSNSM------SFMAMILIQ 63

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           +  ++A  G        L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 64  FGLVYAISGA-------LNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS++IMG +G+ + SLVN+F RSS ++   S +G+VIF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYLIMGLWGIIIASLVNMFFRSSGLNFLTSILGVVIFT 176

Query: 206 ALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +   D+    D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNISKM--DKMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|332970126|gb|EGK09120.1| protein of hypothetical function UPF0005 [Desmospora sp. 8437]
          Length = 224

 Score =  151 bits (382), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 92/229 (40%), Positives = 132/229 (57%), Gaps = 18/229 (7%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M RV++ M  GL +TGI+SFL+      +     +I +  G+M+                
Sbjct: 13  MTRVFSWMFAGLSLTGIISFLLVSDGGAIRYFYQNIGVLYGLMI---------------- 56

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
             A L +  FL  R+H ++A  A  +F LY+AL G++LS    +YT  SI Q FFITA  
Sbjct: 57  --AELILVFFLAARVHKMAAGTATFVFFLYAALNGVTLSPLLYLYTPVSITQVFFITAGM 114

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG  +LYG  TKRDL  +GS + M   GL + S+VN FM+SS +   +S +G++IF  LT
Sbjct: 115 FGVFALYGAVTKRDLSKLGSILFMALIGLIIASVVNWFMQSSVLYWVVSYLGVIIFCGLT 174

Query: 209 AYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           A+D QKIK    +  D     + +++GAL LY+DFI +F++LLR LGSR
Sbjct: 175 AFDVQKIKRIQDENMDYDTHTKTAIMGALALYLDFINMFIYLLRILGSR 223


>gi|161504025|ref|YP_001571137.1| hypothetical protein SARI_02118 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865372|gb|ABX21995.1| hypothetical protein SARI_02118 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 234

 Score =  151 bits (381), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 137/238 (57%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T   +F+    A T  P     + +  +  T FG      
Sbjct: 15  SGLQTYMAQVYGWMTVGLLLT---AFIAWYAANT--PAVMMFVFSSKI--TFFG------ 61

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                 I A L +   L+  +H LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF
Sbjct: 62  -----LIIAQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFVVYTYSSIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG +SLYGYTTKRDL   G+ + M   G+ L SLVN +++S  +   ++ +G++
Sbjct: 117 VVTGGMFGVMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSETLMWIVTYIGVI 176

Query: 203 IFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K      D  D A   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|317486260|ref|ZP_07945093.1| hypothetical protein HMPREF0179_02451 [Bilophila wadsworthia 3_1_6]
 gi|316922506|gb|EFV43759.1| hypothetical protein HMPREF0179_02451 [Bilophila wadsworthia 3_1_6]
          Length = 233

 Score =  151 bits (381), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 101/235 (42%), Positives = 143/235 (60%), Gaps = 24/235 (10%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           +M  VY  M +GL VT   +F V          A+S  +   +    FG ++       I
Sbjct: 19  FMRHVYQWMTVGLLVTAGTAFFV----------ASSPALLSAIFGNTFGLIILA-----I 63

Query: 88  FIFA-PLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
            +FA PL     L+  +  LSA+AA  +F++YSAL+G  LSS  LVYT  S++ TF   A
Sbjct: 64  AVFAMPL----VLSGMISRLSAFAATALFVVYSALMGAFLSSVLLVYTGASVMSTFVTCA 119

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
           A FG +S+YG  TKRDL  +GSFM+MG FGL +  +VN+F++SSA+   +SA+G+VIF+ 
Sbjct: 120 AMFGGMSIYGTVTKRDLTGMGSFMMMGLFGLIIAMIVNIFLQSSAMTFVISALGVVIFTG 179

Query: 207 LTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           LTAYDTQKI+ A+ +     D     R +++GAL LY+DFI +F+ LLR +G RR
Sbjct: 180 LTAYDTQKIR-AFGENAPLDDATAIRRGALLGALTLYLDFINLFLMLLRLMGDRR 233


>gi|218886029|ref|YP_002435350.1| hypothetical protein DvMF_0927 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756983|gb|ACL07882.1| protein of unknown function UPF0005 [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 235

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 139/239 (58%), Gaps = 20/239 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
           + + A+M  VYN M +GL VT   ++      T   P    ++     +L G        
Sbjct: 15  ETVNAFMRGVYNWMFVGLAVTAGAAWF-----TASSPAMLQLVFGNSFVLIGL------- 62

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                 I A LG+ + ++  +  LS  AA  +F+LYSAL G++LS+  L YTS ++ Q F
Sbjct: 63  ------ILAELGLVMGISAGIARLSGGAATGLFVLYSALNGITLSAVLLAYTSGTVFQAF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
              A  FG++SLYG TTK+DL   GSF+ MG  G+ + S+VN+F+ SSA+ L +SA+G++
Sbjct: 117 ATAAGMFGAMSLYGLTTKKDLTSWGSFLFMGLIGILIASVVNIFVGSSAMSLVISAIGVI 176

Query: 203 IFSALTAYDTQKIK--EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +F+ LTAYD+QK++     +   D     R +++GAL LY+DFI +F+ LLR  GS RD
Sbjct: 177 VFTGLTAYDSQKLRMMGETAPMDDATAIRRGTILGALTLYLDFINLFLMLLRLFGSSRD 235


>gi|283784546|ref|YP_003364411.1| hypothetical protein ROD_07871 [Citrobacter rodentium ICC168]
 gi|282948000|emb|CBG87564.1| putative membrane protein [Citrobacter rodentium ICC168]
          Length = 234

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 141/238 (59%), Gaps = 22/238 (9%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++  +  A  ++                   L+YT+ 
Sbjct: 16  GLQTYMAQVYGWMTVGLLLTAFIAWYASHSAAFIE-------------------LLYTNR 56

Query: 84  LRWI-FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
           L +   + A L V   L+  ++ LSA     +F+LYSAL GL+LSS F++YT+ SI  TF
Sbjct: 57  LFFFGLVIAQLAVVFVLSGLINRLSAGVMTTLFMLYSALTGLTLSSIFIIYTASSIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            ++   FG +SL+GYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V
Sbjct: 117 VVSGGMFGVMSLWGYTTKRDLSSWGNILFMALIGIILASLVNFWLKSEALMWAVTYIGVV 176

Query: 203 IFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F ALTAYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVALTAYDTQKLKNIGEQIDVRDSSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|260597178|ref|YP_003209749.1| Inner membrane protein YbhL [Cronobacter turicensis z3032]
 gi|260216355|emb|CBA29379.1| Inner membrane protein ybhL [Cronobacter turicensis z3032]
          Length = 235

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 98/240 (40%), Positives = 139/240 (57%), Gaps = 26/240 (10%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ +M +VY  M  GL +T  +++            +A+   N  +M       MY   
Sbjct: 17  GLQTFMAQVYGWMTCGLLLTAFVAWY-----------SAN---NENLM-------MYIFS 55

Query: 84  LRWIF---IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            R++F   I A L +   L+  +H LS   A  +F+LYSAL GL+LSS FLVYT  SI  
Sbjct: 56  SRFVFFGLIIAQLALVFVLSGLVHKLSPAVATALFMLYSALTGLTLSSIFLVYTYASIAS 115

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
           TF +TA  FG +SLYGYTTKRDL   G+ + M   GL + SLVN +++S A+   ++ +G
Sbjct: 116 TFVVTAGMFGVMSLYGYTTKRDLSGWGNILFMALIGLIIASLVNFWLKSPALMWAVTYIG 175

Query: 201 LVIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +++F  LTAYDTQK+K      D  D     + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 176 VIVFVGLTAYDTQKLKSLGEQIDVNDHGNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 235


>gi|51598790|ref|YP_072978.1| hypothetical protein BG0549 [Borrelia garinii PBi]
 gi|51573361|gb|AAU07386.1| conserved hypothetical integral membrane protein [Borrelia garinii
           PBi]
          Length = 232

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 147/238 (61%), Gaps = 25/238 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ I ++     AT+ +    +II              +++P+ 
Sbjct: 15  NKFLAKVFGLMSIGLLISAIFAY-----ATSENQAIKAII--------------FSNPMS 55

Query: 86  WI-FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
           ++  I    G+   ++  L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF I
Sbjct: 56  FMAIILIQFGLVYAISGALNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGI 115

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TA +F  +S+YGYTT  DL  +GS++IM  +G+ + SLVN+F R+S ++  +S +G++IF
Sbjct: 116 TAGTFLGMSVYGYTTTTDLTKMGSYLIMSLWGIIIASLVNMFFRNSGLNFLISILGVIIF 175

Query: 205 SALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           + LTAYD Q I  A  D+    D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 176 TGLTAYDVQNI--AKMDKMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|111115365|ref|YP_709983.1| hypothetical protein BAPKO_0567 [Borrelia afzelii PKo]
 gi|110890639|gb|ABH01807.1| hypothetical protein BAPKO_0567 [Borrelia afzelii PKo]
          Length = 232

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 147/237 (62%), Gaps = 23/237 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ + ++     AT+ +    +II +  +      + M    ++
Sbjct: 15  NKFLAKVFGLMSIGLLISAMFAY-----ATSENQTIKAIIFSNSM------SFMTLILIQ 63

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           +  ++A  G        L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 64  FGLVYAIGGA-------LNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS++IMG +G+ + SLVN+F RSS ++  +S +G+VIF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYLIMGLWGIIIASLVNMFFRSSGLNFLISILGVVIFT 176

Query: 206 ALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +   D+    D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNISKM--DKMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|311280334|ref|YP_003942565.1| hypothetical protein Entcl_3035 [Enterobacter cloacae SCF1]
 gi|308749529|gb|ADO49281.1| protein of unknown function UPF0005 [Enterobacter cloacae SCF1]
          Length = 234

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 95/237 (40%), Positives = 140/237 (59%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M  GL +T   +F+    A T  P+    + +  +  T FG       
Sbjct: 16  GLQTYMAQVYGWMTCGLLLT---AFVAWYAANT--PEVMMFVFSSKI--TFFG------- 61

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                + A L +   L+  +  LSA  A  +F+LYSAL GL+L+S FLVYT  SI  TF 
Sbjct: 62  ----LVIAQLALVFVLSGMVQRLSAGLATTLFMLYSALTGLTLASIFLVYTYSSIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++SLYGYTTKRDL  +G  + M   G+ L SLVN++++S+ +   ++ +G+++
Sbjct: 118 VTAGMFGAMSLYGYTTKRDLSGVGKMLFMALIGIVLASLVNIWLKSTPLMWAVTYIGVLV 177

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D +   + +++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 FVGLTAYDTQKLKAIGEQIDTRDSSTMRKYAILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|300715931|ref|YP_003740734.1| hypothetical protein EbC_13520 [Erwinia billingiae Eb661]
 gi|299061767|emb|CAX58883.1| Putative membrane protein [Erwinia billingiae Eb661]
          Length = 236

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 96/253 (37%), Positives = 140/253 (55%), Gaps = 20/253 (7%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
            R   S S   S  + GL+ YM +VY  M  GL +T  +S+     A         +  N
Sbjct: 2   DRYPRSDSSMVSQANTGLQTYMAQVYGWMTCGLLLTAFVSWF----AANTPAVMEMVFAN 57

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
           R   +T +G            I   LG+   L+  +H LS   A  +F+LYSAL GL+++
Sbjct: 58  R---ITFYG-----------LIIVQLGLVFVLSGMVHKLSGAVATGLFMLYSALTGLTMA 103

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
           S FLVYT  SI  TF +    FG +S +GYTTKRDL  +GS + M   G+ L S+VN+++
Sbjct: 104 SIFLVYTYSSIAGTFLVAGGMFGVMSFWGYTTKRDLSGMGSMLFMALIGIVLASVVNIWL 163

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQ 245
           +S+A+   ++ +G+++F  LTAYDTQK+K      +  D     R S++GAL LY+DFI 
Sbjct: 164 KSTALMWAVTYIGVLVFVGLTAYDTQKLKNIGEGINVEDKENLRRYSIMGALTLYLDFIN 223

Query: 246 IFVHLLRFLGSRR 258
           +F+ LLR  G+RR
Sbjct: 224 LFLMLLRIFGNRR 236


>gi|282859826|ref|ZP_06268920.1| putative membrane protein [Prevotella bivia JCVIHMP010]
 gi|282587446|gb|EFB92657.1| putative membrane protein [Prevotella bivia JCVIHMP010]
          Length = 239

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 88/238 (36%), Positives = 143/238 (60%), Gaps = 21/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
           Q +   M +VY  M + L +TGI ++ V+                      G   LM++S
Sbjct: 21  QAMPILMRKVYTWMTMALIITGIAAYWVS-------------------QSVGLMNLMFSS 61

Query: 83  PLRW-IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
            L + + I A +G+ I+L+ R+H LS  AA + F+ YS L G+  +   L +T  SI +T
Sbjct: 62  RLTFFLLIGAQVGIVIYLSARIHKLSLQAATLWFIAYSVLTGVVFAPIILAFTGASIAKT 121

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F ITA +FG++++ G TTKRDL  +GS + MG  GL +  +VN+F++S+ +D  +S  G+
Sbjct: 122 FLITAGTFGAMAVIGTTTKRDLSRMGSILTMGIIGLIIAMVVNIFLKSTMMDFIISGAGV 181

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQ-SVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +IF+ LTA+D Q IK+  S   +V+ + ++ +++GAL LY+DFI +F++LLRF G R+
Sbjct: 182 LIFTGLTAWDVQNIKKQLSLAGNVSESTQKIALLGALNLYLDFINLFLYLLRFFGDRK 239


>gi|269139687|ref|YP_003296388.1| hypothetical protein ETAE_2342 [Edwardsiella tarda EIB202]
 gi|267985348|gb|ACY85177.1| hypothetical protein ETAE_2342 [Edwardsiella tarda EIB202]
 gi|304559556|gb|ADM42220.1| Putative membrane protein [Edwardsiella tarda FL6-60]
          Length = 236

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 140/240 (58%), Gaps = 24/240 (10%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            G++AYM +VY  M  GL +T ++++          P   ++I    ++  G        
Sbjct: 17  SGIQAYMAQVYGWMCCGLLLTALVAWY-----AARTPAVLNLIFANKMVFFGL------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                 I   LGV   L+  ++ LS  AA  +F+LYS L GL+LSS F+VYT  SI  TF
Sbjct: 65  ------IIVQLGVVFVLSGMVNRLSGAAATSLFMLYSLLTGLTLSSIFIVYTYSSIASTF 118

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            ++A  FG++SLYGYTTKRDL  +GS + M   GL L SLVN++++SSA+   ++  G++
Sbjct: 119 VVSAGMFGAMSLYGYTTKRDLSGMGSMLFMALIGLVLASLVNIWLKSSALTWIVTYAGVL 178

Query: 203 IFSALTAYDTQKIK----EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           IF  LTAYDTQK++    +  +D  D     R +++GAL LY+DFI +F+ LLR  G RR
Sbjct: 179 IFVGLTAYDTQKLRVMGEQLSADDRDG--FRRYAIMGALTLYLDFINLFLMLLRIFGDRR 236


>gi|301059643|ref|ZP_07200552.1| conserved hypothetical protein [delta proteobacterium NaphS2]
 gi|300446289|gb|EFK10145.1| conserved hypothetical protein [delta proteobacterium NaphS2]
          Length = 221

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 137/231 (59%), Gaps = 21/231 (9%)

Query: 32  VYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFA 91
           VYN M +GL +T +++  V+               N  +M   FG     S +  + I A
Sbjct: 9   VYNWMGIGLALTAVVALYVSG--------------NESLMRLIFG----NSMIFILLIVA 50

Query: 92  PLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGS 151
            LG+   ++  +  LS+  A ++FL+YSAL G++LS  FL YT  SIV TFFI A +F +
Sbjct: 51  ELGLVFAISGMVQKLSSGTATLLFLIYSALNGVTLSFIFLAYTQTSIVSTFFICAGTFVA 110

Query: 152 LSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYD 211
            S+YG+ TKRDL  +G F++MG  G+ + SLVN+F+RS  + + +S +G+++F  LTAYD
Sbjct: 111 CSIYGWITKRDLTSMGGFLMMGLIGIIIASLVNMFLRSPGMSMVISYIGVIVFVGLTAYD 170

Query: 212 TQKIKEAYSDR---YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           TQK+K     +    D A   + +++GAL LY+DFI +F+ LLR  G  RD
Sbjct: 171 TQKLKNMARTQPVDADGAVVRKGAILGALSLYLDFINLFLMLLRIFGQGRD 221


>gi|332703207|ref|ZP_08423295.1| protein of unknown function UPF0005 [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332553356|gb|EGJ50400.1| protein of unknown function UPF0005 [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 235

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 90/237 (37%), Positives = 136/237 (57%), Gaps = 20/237 (8%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           + A+M  VY  M  GLGVT +++FLV        P  A +     ++L G          
Sbjct: 17  MNAFMRGVYGWMTAGLGVTAVLAFLV-----ATSPTLAQLFWGNSILLIGI--------- 62

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
               I A +G+   ++  +H +SA  A  +FLLYSAL G++LS  F  Y   +I + F  
Sbjct: 63  ----IIAEVGLVFAISGAIHRMSAGTATSLFLLYSALNGITLSVIFAAYAPAAIFKAFVT 118

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TA  FG++S+YG TTK+DL   GSF+ MG  G+F+  +VN+F++S  +   +S +G+++F
Sbjct: 119 TAGMFGAMSIYGLTTKKDLTSWGSFLFMGLIGVFIAMIVNIFLQSPVMHFVISLVGVIVF 178

Query: 205 SALTAYDTQKIK-EAYSDRY-DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           + LTAYDTQ+++    S  Y D     R S++GAL LY+DFI +F+ LLR  G  R+
Sbjct: 179 TGLTAYDTQQLRVMGESAPYGDATAIRRGSILGALRLYLDFINLFLMLLRLFGGSRE 235


>gi|294637132|ref|ZP_06715441.1| membrane protein [Edwardsiella tarda ATCC 23685]
 gi|291089666|gb|EFE22227.1| membrane protein [Edwardsiella tarda ATCC 23685]
          Length = 236

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 139/240 (57%), Gaps = 24/240 (10%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+AYM +VY  M  GL +T ++++     A T  P    +I    V+  G        
Sbjct: 17  SGLQAYMAQVYGWMCCGLLLTALVAWYA---ART--PALMELIFANKVVFFGL------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                 I   LGV   L+  ++ LS  AA  +F+ YS L GL+LSS F+VYT  SI  TF
Sbjct: 65  ------IIVQLGVVFVLSGMVNRLSGSAATGLFMFYSLLTGLTLSSIFIVYTYSSIASTF 118

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            ++A  FG++SLYGYTTKRDL  +GS + M   GL L SLVN++++SS +   ++  G++
Sbjct: 119 VVSAGMFGAMSLYGYTTKRDLSGMGSMLFMALIGLVLASLVNIWLKSSTLTWIVTYAGVL 178

Query: 203 IFSALTAYDTQKIK----EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           IF  LTAYDTQK++    +  SD  D     R +++GAL LY+DFI +F+ LLR  G RR
Sbjct: 179 IFVGLTAYDTQKLRVMGEQIASDDRDG--FRRYAIMGALTLYLDFINLFLMLLRIFGDRR 236


>gi|320538876|ref|ZP_08038552.1| putative inner membrane protein [Serratia symbiotica str. Tucson]
 gi|320031036|gb|EFW13039.1| putative inner membrane protein [Serratia symbiotica str. Tucson]
          Length = 236

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 143/241 (59%), Gaps = 24/241 (9%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + G++AYM +VY  M  GL +T  +S+     A T  P   + I +  +  T FG     
Sbjct: 16  NSGIQAYMAQVYGWMTCGLLLTAFVSWYA---AQT--PAILNFIFSSQI--TFFG----- 63

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                  I A L +   ++  ++ LSA  A  +F+LYS L GL+LSS F+ YT  SI  T
Sbjct: 64  ------LIIAQLALVFVISGMVNRLSAALATSLFMLYSVLTGLTLSSIFIAYTYSSIAST 117

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F +TA  FG++SLYGYTTKRDL   GS + M   G+ L SLVN++++SSA+   ++ +G+
Sbjct: 118 FVVTAGMFGAMSLYGYTTKRDLSGFGSMLFMALIGIVLASLVNIWLKSSALMWVITYIGV 177

Query: 202 VIFSALTAYDTQKIK----EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            +F  LTAYDTQK+K    +  +D +D     + +++GAL LY+DFI +F+ LLR  G+R
Sbjct: 178 AVFVGLTAYDTQKLKAMGEQLNTDDHDS--LRKYAIVGALTLYLDFINLFLMLLRIFGNR 235

Query: 258 R 258
           R
Sbjct: 236 R 236


>gi|296103287|ref|YP_003613433.1| hypothetical protein ECL_02948 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295057746|gb|ADF62484.1| hypothetical protein ECL_02948 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 214

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 84/172 (48%), Positives = 114/172 (66%), Gaps = 2/172 (1%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A L +   L+  +  LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF +T   
Sbjct: 43  IIAQLALVFVLSGLVQKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTFVVTGGM 102

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG +SLYGYTTKRDL  +G+ + MG  G+ L SLVNL+++S A+   ++ +G+VIF  LT
Sbjct: 103 FGVMSLYGYTTKRDLSGLGNMLFMGLIGIVLASLVNLWLKSDALMWAVTYIGVVIFVGLT 162

Query: 209 AYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 163 AYDTQKLKNIGEQIDVRDSSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 214


>gi|282881074|ref|ZP_06289761.1| inner membrane family protein [Prevotella timonensis CRIS 5C-B1]
 gi|281304878|gb|EFA96951.1| inner membrane family protein [Prevotella timonensis CRIS 5C-B1]
          Length = 238

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 91/257 (35%), Positives = 148/257 (57%), Gaps = 23/257 (8%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           +I+  ++++    G   ++     A M +VY  M L L +TGI ++          P+  
Sbjct: 2   EIKELEKLIREKEG---SLSLAFPALMRKVYVWMTLALVITGITAY-----GVASSPNIM 53

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
             ++ +  +L             W  I A L + + ++  ++ LS   A ++F+LYS L 
Sbjct: 54  MWLVQKPAIL-------------WGLIIAELALVLTVSAAINRLSLTTATLLFVLYSVLN 100

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G++LS  F+ YT  SI   FFITA +FG ++ YGY TKRDL  +G  ++M   GL + S+
Sbjct: 101 GVTLSLIFMAYTLTSIASVFFITAGTFGVMAAYGYFTKRDLTSLGKLLLMALIGLIIASV 160

Query: 183 VNL-FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAY-AERQSVIGALMLY 240
           VN+ F++SS  DL +S +G++IF  LTAYDTQKIK+  + + D+   A++ +++GAL LY
Sbjct: 161 VNIFFVKSSGFDLIVSYIGVLIFVGLTAYDTQKIKQMLALQTDMGEGAQKIALMGALSLY 220

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DFI +F++LLR  G R
Sbjct: 221 LDFINLFLYLLRIFGKR 237


>gi|183598220|ref|ZP_02959713.1| hypothetical protein PROSTU_01604 [Providencia stuartii ATCC 25827]
 gi|188020389|gb|EDU58429.1| hypothetical protein PROSTU_01604 [Providencia stuartii ATCC 25827]
          Length = 235

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 94/237 (39%), Positives = 138/237 (58%), Gaps = 21/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           G++ +M +VY  M +GL +T  +++      +T++      I    V+  G         
Sbjct: 18  GIQTFMSQVYGWMTVGLLLTAFVAW------STLNSGLFYTIATNNVLFFGL-------- 63

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I    G+ + L+  L  +S   A  MF+LYS L GL++S     YT +S+  TFF
Sbjct: 64  -----IIVEFGLVLGLSFLLPRMSGMMATGMFMLYSVLTGLTISVVLAAYTMESVAGTFF 118

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           ITAA FG+LS+YGYTTKR L  IG+F+ M   GL + S+VN+FM+SSA+   ++  G++I
Sbjct: 119 ITAAMFGALSVYGYTTKRSLSGIGNFLFMALIGLIIASIVNIFMKSSALYWVITYAGVLI 178

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F+ LTAYDTQK+KE  A  D  D     + +++GAL LY+DFI +F+ LLR  G RR
Sbjct: 179 FAGLTAYDTQKLKEMGAQIDVEDKESMRKLAILGALNLYLDFINLFLMLLRIFGDRR 235


>gi|114762989|ref|ZP_01442419.1| hypothetical protein 1100011001344_R2601_20956 [Pelagibaca
           bermudensis HTCC2601]
 gi|114544313|gb|EAU47321.1| hypothetical protein R2601_20956 [Roseovarius sp. HTCC2601]
          Length = 220

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 89/237 (37%), Positives = 141/237 (59%), Gaps = 24/237 (10%)

Query: 29  MIRVYNLMALGLGVTGIMSFLV----NILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           M +VY  M++G+ +T  +++ V     +LA   DP                 A +  + L
Sbjct: 1   MNKVYGTMSIGMLLTFAVAWAVGTSPELLAVFRDP-----------------ATLQPNIL 43

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
            WI +FAPL +       L+ +SA  A++ F  ++A++GLSLS  F+ +T  SI Q F +
Sbjct: 44  GWIVMFAPLIMAFAFGAILNRISAAGAQLFFFGFAAVMGLSLSWIFVAFTGFSIAQVFLV 103

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           T+ +F  LSL+GYTTK+D+   GSF+IMG  G+ + S++N+F+ S AI   +S +G++IF
Sbjct: 104 TSIAFAGLSLWGYTTKKDISGWGSFLIMGVIGILVASIINIFLASPAIYFAISILGVLIF 163

Query: 205 SALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           + LTAYDTQ IK  Y   +   D  +  + +++GAL LY+DFI +F+ LL+ LG+R 
Sbjct: 164 AGLTAYDTQNIKNTYLQHAAHSDSEWLGKAAIMGALQLYLDFINMFMFLLQLLGNRE 220


>gi|307564992|ref|ZP_07627509.1| putative membrane protein [Prevotella amnii CRIS 21A-A]
 gi|307346305|gb|EFN91625.1| putative membrane protein [Prevotella amnii CRIS 21A-A]
          Length = 239

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 118/168 (70%), Gaps = 1/168 (0%)

Query: 92  PLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGS 151
            +G+  +++ R++ LS  +A M F+L+S + G +L   F+ Y   SI +TF ITA +FG+
Sbjct: 72  EVGIVFYVSARINRLSLQSATMWFILFSIINGATLGWIFMAYNIASITKTFLITAGTFGA 131

Query: 152 LSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYD 211
           ++L GY TKRDL  +GS ++M   GL +  +VN+F++SS +DL +SA G++IF+ LTA+D
Sbjct: 132 MALIGYATKRDLSRLGSILMMAVIGLIIAGVVNIFLKSSMMDLIVSAFGVLIFTGLTAWD 191

Query: 212 TQKIKEAYSDRYDV-AYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           TQ IK+  S   DV   A++ ++IGAL LY+DF+ +F++LLRFLG R+
Sbjct: 192 TQNIKKQLSLVGDVNEQAQKVALIGALSLYLDFVNLFLYLLRFLGDRK 239


>gi|238920523|ref|YP_002934038.1| hypothetical protein NT01EI_2635 [Edwardsiella ictaluri 93-146]
 gi|238870092|gb|ACR69803.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 236

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 97/240 (40%), Positives = 142/240 (59%), Gaps = 24/240 (10%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            G++AYM +VY  M  GL +T ++++     A T  P   ++I    ++  G        
Sbjct: 17  SGIQAYMAQVYGWMCCGLLLTALVAWYA---ART--PAVLNLIFANKMVFFGL------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                 I   LGV   L+  ++ LS  AA  +F+LYS L GL+LSS F+VYT  SI  TF
Sbjct: 65  ------IIVQLGVVFVLSGMVNRLSGAAATSLFMLYSLLTGLTLSSIFVVYTYSSIASTF 118

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            ++A  FG++SLYGYTTKRDL  +GS + M   GL L S+VN++++SSA+   ++  G++
Sbjct: 119 VVSAGMFGAMSLYGYTTKRDLSGMGSMLFMALIGLVLASVVNIWLKSSALTWIVTYAGVL 178

Query: 203 IFSALTAYDTQKIK----EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           IF  LTAYDTQK++    +  +D  D     R +++GAL LY+DFI +F+ LLR  G RR
Sbjct: 179 IFVGLTAYDTQKLRVMGEQLSADDRD--GFRRYAIMGALTLYLDFINLFLMLLRIFGDRR 236


>gi|167648948|ref|YP_001686611.1| hypothetical protein Caul_4993 [Caulobacter sp. K31]
 gi|167351378|gb|ABZ74113.1| protein of unknown function UPF0005 [Caulobacter sp. K31]
          Length = 248

 Score =  148 bits (374), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 104/263 (39%), Positives = 153/263 (58%), Gaps = 20/263 (7%)

Query: 1   MSDI-RNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D  R+Y R +  G+G   ++D GLR++M+ VYN +A      G++        T+  P
Sbjct: 1   MNDFNRDYARPL-PGAGADMSVDAGLRSFMLGVYNKVA-----LGLLLSAALAWLTSSYP 54

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                   R +M    G  +  + L  I  FAPLG+ +F    + S++A  A +++    
Sbjct: 55  PV------RDLMFQVTGNRVGYTMLGTIIAFAPLGILLFSGFLMKSITARTAGVIYWSIV 108

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           +LIG SL +  L+YT  S+ QTF ITA +FG LSL GYTTK+DL   GSF+I+G +GL L
Sbjct: 109 SLIGASLGTVVLLYTGASVFQTFLITAIAFGGLSLVGYTTKKDLTGFGSFLIVGLWGLIL 168

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVI----G 235
            S+V++F  S  +   ++A+G++IF+ L AYDTQK+K  Y   Y+V   E    +    G
Sbjct: 169 ASIVSIFFPSGPLVFAINAIGVLIFAGLIAYDTQKLKMTY---YEVGGDETAKAVATNFG 225

Query: 236 ALMLYMDFIQIFVHLLRFLGSRR 258
           AL LY+DFI +F  LL F+GSRR
Sbjct: 226 ALNLYLDFINLFRFLLYFMGSRR 248


>gi|270260814|ref|ZP_06189087.1| hypothetical protein SOD_a00390 [Serratia odorifera 4Rx13]
 gi|270044298|gb|EFA17389.1| hypothetical protein SOD_a00390 [Serratia odorifera 4Rx13]
          Length = 236

 Score =  148 bits (374), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 96/241 (39%), Positives = 143/241 (59%), Gaps = 24/241 (9%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + G++AYM +VY  M  GL +T  +S+     A T  P   + I +  +  T FG     
Sbjct: 16  NSGIQAYMAQVYGWMTCGLLLTAFVSWYA---ANT--PAILNFIFSSQI--TFFG----- 63

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                  I A L +   ++  ++ LS   A  +F+LYSAL GL+LSS F+ YT  SI  T
Sbjct: 64  ------LIIAQLALVFVISGMVNRLSGTVATSLFMLYSALTGLTLSSIFIAYTYSSIAST 117

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F +TA  FG++SLYGYTTKRDL   GS + M   G+ L SLVN++++S+A+   ++ +G+
Sbjct: 118 FVVTAGMFGAMSLYGYTTKRDLSGFGSMLFMALIGIVLASLVNIWLKSTALMWAITYIGV 177

Query: 202 VIFSALTAYDTQKIK----EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           ++F  LTAYDTQK+K    +  +D  D     + +++GAL LY+DFI +F+ LLR  G+R
Sbjct: 178 LVFVGLTAYDTQKLKAMGEQLNADDKDS--FRKYAIVGALTLYLDFINLFLMLLRIFGNR 235

Query: 258 R 258
           R
Sbjct: 236 R 236


>gi|281420936|ref|ZP_06251935.1| membrane protein [Prevotella copri DSM 18205]
 gi|281404854|gb|EFB35534.1| membrane protein [Prevotella copri DSM 18205]
          Length = 252

 Score =  148 bits (374), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 142/235 (60%), Gaps = 20/235 (8%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A M +VY  M L L +TG+ ++ V    T +     +++ +RG++   FG          
Sbjct: 36  ALMRKVYTWMTLALLITGVTAYGVASSPTLL----MTLMTSRGLL---FG---------- 78

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
             I A L +   +   L  LS   A ++F++YS L G  LSS F+VYT  SI + FFITA
Sbjct: 79  -LIIAELALVFIITGALQRLSLTTATLLFIVYSVLNGAMLSSVFVVYTMTSIAKVFFITA 137

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
            +FG+++ YGYTTK+DL   G  + M   GL + ++VN+F++SS  D  +S  G+ IF  
Sbjct: 138 GTFGAMAFYGYTTKKDLTSFGKILFMALIGLIIATVVNMFLKSSGFDYILSYAGVAIFVG 197

Query: 207 LTAYDTQKIKEAYSDRYDVAY-AERQSVIGALMLYMDFIQIFVHLLR-FLGSRRD 259
           LTA+D+QKIK+    +YD++  A++ ++IGAL LY+DFI +F++LLR F GS ++
Sbjct: 198 LTAWDSQKIKQMLQTQYDMSEGAQKLALIGALTLYLDFINLFLYLLRIFGGSNKE 252


>gi|261880930|ref|ZP_06007357.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
 gi|270332317|gb|EFA43103.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
          Length = 245

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 87/257 (33%), Positives = 149/257 (57%), Gaps = 24/257 (9%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           +++  ++++    G  S +     A M +VY  M + L +TGI ++ V          + 
Sbjct: 10  EVKELEQLIREKEGALSAV---FPALMRKVYIWMTMALAITGICAYGV--------ATSP 58

Query: 63  SIIINRGVMLTGFGALMYTSPLR-WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
           SI+            ++Y + +  W+   A LG+  +   R+  LS   A  +F+++SAL
Sbjct: 59  SIL-----------QMLYANSMTIWVLFIAELGLVFYTTARISKLSLTIATTLFIVFSAL 107

Query: 122 IGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS 181
            G++LSS FLVY+  SI + FFIT+ +F +++ YGY TK DL  +GS + M   GL + +
Sbjct: 108 NGVTLSSIFLVYSLTSIAKVFFITSGTFAAMAAYGYFTKTDLSKLGSILFMALIGLIIAT 167

Query: 182 LVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAY-AERQSVIGALMLY 240
           +VNLFM+S+  D+ +  +G+ IF  LTA+D+QKIK   + + D+   A++ +++GAL LY
Sbjct: 168 VVNLFMKSAMFDMILCYIGVAIFVGLTAWDSQKIKRMLAMQMDMGEGAQKIALLGALSLY 227

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DFI +F+++LR  G R
Sbjct: 228 LDFINLFLYMLRIFGGR 244


>gi|237730763|ref|ZP_04561244.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226906302|gb|EEH92220.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 234

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 96/237 (40%), Positives = 136/237 (57%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M  GL +T   +F+    A T  P     + +  +  T FG       
Sbjct: 16  GLQTYMAQVYGWMTCGLLLT---AFIAWYAANT--PAVMMFVFSSKI--TFFG------- 61

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L +   L+  +  LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF 
Sbjct: 62  ----LIIAQLALVFVLSGMVQRLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +T   FG +SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++
Sbjct: 118 VTGGMFGIMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIV 177

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D +   + +++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 FVGLTAYDTQKLKNIGEQIDLRDSSNLRKYAILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|260593490|ref|ZP_05858948.1| membrane protein [Prevotella veroralis F0319]
 gi|260534606|gb|EEX17223.1| membrane protein [Prevotella veroralis F0319]
          Length = 242

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 149/258 (57%), Gaps = 20/258 (7%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D  NY  VVN+       + +   A M +VY  MA+ L +TGI+++     A +      
Sbjct: 4   DFNNYSNVVNNHDR-ELEMSRAFPALMRKVYVWMAMALAITGIVAYG----AGSSPALIQ 58

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
           ++ I++G +L              I      G+  +L+ R++ LS  +A + F+L+SA+ 
Sbjct: 59  ALYISKGPIL--------------IAALVEFGIVWYLSSRIYKLSLASATLWFILFSAIN 104

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GL+L   F VY    I +TFF+TA +FG+++L G TTK+DL  +G  + M   GL + SL
Sbjct: 105 GLTLGWIFAVYKIAIIAKTFFVTAGTFGAMALIGSTTKKDLTKMGGILFMALIGLIIASL 164

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAY-AERQSVIGALMLYM 241
           VN+F++SS +D  +S +G+++F+ LTA+D Q IK       D    A++ +++G+L LY+
Sbjct: 165 VNMFLQSSTMDYIVSIIGVIVFTGLTAWDAQAIKRNLLMAPDAGESAQKIALLGSLSLYL 224

Query: 242 DFIQIFVHLLRFLGSRRD 259
           DFI +F++LLRF G+ RD
Sbjct: 225 DFINLFLYLLRFFGNNRD 242


>gi|197103611|ref|YP_002128988.1| hypothetical protein PHZ_c0145 [Phenylobacterium zucineum HLK1]
 gi|196477031|gb|ACG76559.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 275

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 101/266 (37%), Positives = 150/266 (56%), Gaps = 24/266 (9%)

Query: 1   MSDI-RNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFL------VNIL 53
           MSD  R Y R + +      ++D GLR++M+ VYN +ALGL V+  ++FL      V  L
Sbjct: 26  MSDFNRGYARTIPADRA-DMSVDAGLRSFMLGVYNKVALGLVVSAALAFLTGQYPPVRDL 84

Query: 54  ATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKM 113
              V PD               G L   + L  I  FAPL V +F    L + +  ++ +
Sbjct: 85  MYAVTPD---------------GRLAGMTMLGTIVAFAPLAVMLFGMFALRNATPRSSGI 129

Query: 114 MFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMG 173
           ++    ALIG  L  + L+YT  SI  TF ITA +FG LSL+GYTTK+DL   GSF+++G
Sbjct: 130 LYWTIVALIGAGLGVWTLIYTGGSIATTFLITATAFGGLSLFGYTTKKDLTGFGSFLLVG 189

Query: 174 AFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD-RYDVAYAERQS 232
             GL + S+VN+F+++S ++  +S +G+ IF+ L AYDTQ++K  Y +   + A     +
Sbjct: 190 LIGLVIASIVNIFLQNSMMNFLISVLGVFIFAGLIAYDTQRLKMTYYELGGNQAAMGVAT 249

Query: 233 VIGALMLYMDFIQIFVHLLRFLGSRR 258
             GAL LY++FI +F  LL+  G RR
Sbjct: 250 NYGALSLYINFINLFQFLLQLFGQRR 275


>gi|146310936|ref|YP_001176010.1| hypothetical protein Ent638_1278 [Enterobacter sp. 638]
 gi|145317812|gb|ABP59959.1| protein of unknown function UPF0005 [Enterobacter sp. 638]
          Length = 235

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 95/237 (40%), Positives = 136/237 (57%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M  GL +T   +F+    A T  P     + +  +  T FG       
Sbjct: 17  GLQTYMAQVYGWMTCGLLLT---AFIAWYAANT--PAVMMFVFSSKI--TFFG------- 62

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L +   L+  +  LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF 
Sbjct: 63  ----LIIAQLALVFVLSGLVQKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTFV 118

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +    FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++
Sbjct: 119 VAGGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIV 178

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D +   + +++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 179 FVGLTAYDTQKLKNIGEQIDVRDSSNLRKYAILGALTLYLDFINLFLMLLRIFGNRR 235


>gi|332186250|ref|ZP_08387995.1| uncharacterized UPF0005 family protein [Sphingomonas sp. S17]
 gi|332013618|gb|EGI55678.1| uncharacterized UPF0005 family protein [Sphingomonas sp. S17]
          Length = 216

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 93/231 (40%), Positives = 142/231 (61%), Gaps = 15/231 (6%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M+ VYN MA G+ +TGI++ L      +    AA + ++ G             PL+++ 
Sbjct: 1   MLSVYNYMASGVLLTGIVALLFAWGGAS--SPAAQVFMSGG-------------PLKYVI 45

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           +FAPLG    L++    +     +M+F  ++ ++GLSLS+ FLVY+  SI   FF TAA 
Sbjct: 46  MFAPLGFVFALSMGQSRMKTSTMQMLFWAFAVVMGLSLSTIFLVYSGASIAGAFFATAAG 105

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           F +LSLYGYTTKRDL   G+F+I+G  GL + SL+NLF++S  + L +S +G+++F+ LT
Sbjct: 106 FAALSLYGYTTKRDLSAFGTFLIIGLVGLIVASLINLFLQSGTMALVISFVGVLLFAGLT 165

Query: 209 AYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           AYDTQ+ K  Y +    +  +R  ++ AL LY+DFI +F+ +LR  GS RD
Sbjct: 166 AYDTQRTKSLYYEVRGTSMQDRVVIMSALSLYLDFINMFLFILRLTGSSRD 216


>gi|197118517|ref|YP_002138944.1| hypothetical protein Gbem_2135 [Geobacter bemidjiensis Bem]
 gi|197087877|gb|ACH39148.1| inner membrane protein of unknown function UPF0005 [Geobacter
           bemidjiensis Bem]
          Length = 224

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 90/239 (37%), Positives = 136/239 (56%), Gaps = 26/239 (10%)

Query: 20  TIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALM 79
           +I QG    M  VY  M  GL +T ++S     L T   P     I+   ++        
Sbjct: 12  SIAQG--GVMRGVYGWMGGGLALTALVS-----LMTASSPALLQAILGNRILF------- 57

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIV 139
                 +  +F  LG+ I ++  ++ +SA  A  +FLLY+A+ GL++SS F+ YTS SI 
Sbjct: 58  ------YALVFGELGLVIAISGAINRISATTASALFLLYAAVNGLTMSSIFVAYTSTSIA 111

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
            TF +T+  F ++SLYGY T+ DL   GSF+ MG  G+ + SLVN+F+ SS +   +S  
Sbjct: 112 STFLVTSGMFCAMSLYGYLTRSDLTSWGSFLFMGLVGVVIASLVNMFLHSSMLSWVLSVC 171

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           G+++F+ LTAYDTQKIK+  +         + +V+GAL LY+DFI +F+ +LR  G RR
Sbjct: 172 GVIVFTGLTAYDTQKIKQMGNA------GRKGAVLGALTLYLDFINMFLSMLRLFGDRR 224


>gi|329891283|ref|ZP_08269626.1| conserved hypothetical UPF0005 family protein [Brevundimonas
           diminuta ATCC 11568]
 gi|328846584|gb|EGF96148.1| conserved hypothetical UPF0005 family protein [Brevundimonas
           diminuta ATCC 11568]
          Length = 248

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 150/267 (56%), Gaps = 28/267 (10%)

Query: 1   MSDIRN-YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           MSD  N Y R +   +    ++D GLRA+M+ VYN +A+GL V G ++++     T   P
Sbjct: 1   MSDFNNGYARPLPQSADM--SVDAGLRAFMLGVYNKLAIGLVVAGALAYV-----TGNVP 53

Query: 60  DAASIIINR----GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMF 115
               ++  R     + LT  G ++  SPL  +F     G   F+     + SA    M++
Sbjct: 54  AVQQLLFARMDDGRIGLTMLGMIVQFSPLVMLF-----GSMFFM----KNPSAKGVNMLY 104

Query: 116 LLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAF 175
               A IG  L   FL YT+ S+  TFF+TAA+F  LSL GYTTK+DL  +G+F+IMG  
Sbjct: 105 WAVVATIGAGLGVLFLRYTNGSLASTFFVTAAAFAGLSLVGYTTKKDLTGMGTFLIMGVI 164

Query: 176 GLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY----SDRYDVAYAERQ 231
           GL + S+VN+FM+S  + L +S  G++IFS L AYDTQ++K  Y     D+  +  A   
Sbjct: 165 GLVIASIVNIFMQSGVMYLIISGAGVLIFSGLIAYDTQRLKMTYYALGGDKNAMGVATG- 223

Query: 232 SVIGALMLYMDFIQIFVHLLRFLGSRR 258
              GAL L+++FI +F  LL F+GSR 
Sbjct: 224 --FGALSLFINFINLFQFLLAFMGSRE 248


>gi|303236922|ref|ZP_07323501.1| putative membrane protein [Prevotella disiens FB035-09AN]
 gi|302483090|gb|EFL46106.1| putative membrane protein [Prevotella disiens FB035-09AN]
          Length = 242

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 90/256 (35%), Positives = 149/256 (58%), Gaps = 28/256 (10%)

Query: 12  NSGSGFGSTIDQGLRAY---------MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           N+  GF S  ++G +           M +VY  M + L +TGI+++ V         +A 
Sbjct: 4   NNYPGFESNHNRGYQELEMSRTFPMLMRKVYTWMTMALAITGIVAYGVG------TSEAM 57

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
            +++  G+           +PL  +   A LG+  +L+ R+  LS  +A + F++++AL 
Sbjct: 58  LMMLYNGM-----------APLI-VCGLAELGIVFYLSARIQKLSLMSATIWFIVFAALN 105

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GL++   F  YT  SI +TFFITA +FG++++ G TTK+DL  +G  + M   GL +  L
Sbjct: 106 GLTMGWIFAAYTMASIAKTFFITAGTFGAMAVIGTTTKKDLTKMGGILFMALIGLIIAGL 165

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAY-AERQSVIGALMLYM 241
           VNLF+ S+  +L +S +G++IF+ LTA+D QKIKE      D    A++ +++G+L LY+
Sbjct: 166 VNLFLHSTMFELIVSGLGVLIFTGLTAWDAQKIKEMVRMAPDAGESAQKIALLGSLSLYL 225

Query: 242 DFIQIFVHLLRFLGSR 257
           DFI +F++LLRF G+R
Sbjct: 226 DFINLFLYLLRFFGNR 241


>gi|193213902|ref|YP_001995101.1| hypothetical protein Ctha_0183 [Chloroherpeton thalassium ATCC
           35110]
 gi|193087379|gb|ACF12654.1| protein of unknown function UPF0005 [Chloroherpeton thalassium ATCC
           35110]
          Length = 237

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 119/183 (65%), Gaps = 1/183 (0%)

Query: 78  LMYTSPLRWI-FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK 136
           L++ +P+ +   I A  G+ + ++  ++ LS  AA  +F LYSAL G++L+S F+VY+  
Sbjct: 54  LVFGNPIVFFGLIIAEFGLVVGVSAAINRLSLAAATGLFFLYSALNGVTLASIFMVYSLG 113

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTM 196
           SI   F +TA +FG++SLYG TTKRDL  IGS   M   G+ +  +VN+F+ SS + L +
Sbjct: 114 SIGGVFLVTAGTFGAMSLYGLTTKRDLTKIGSLAFMALIGIIIAGVVNMFLHSSVLSLIV 173

Query: 197 SAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           S +GLV+F  LTAYDTQKIKE  +   D     + +V+GAL LY+DFI +F+ LLR  G 
Sbjct: 174 SLIGLVVFIGLTAYDTQKIKEMAAMTNDGESEGKVAVLGALSLYLDFINLFLILLRLFGG 233

Query: 257 RRD 259
            +D
Sbjct: 234 GKD 236


>gi|188994682|ref|YP_001928934.1| hypothetical protein PGN_0818 [Porphyromonas gingivalis ATCC 33277]
 gi|188594362|dbj|BAG33337.1| conserved hypothetical protein [Porphyromonas gingivalis ATCC
           33277]
          Length = 236

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 126/196 (64%), Gaps = 8/196 (4%)

Query: 71  MLTGFGALMYT----SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           ML    +L+YT    S L W  I A L +   L+ R+  +S + + ++F +YS L G++L
Sbjct: 42  MLVAKSSLIYTMIMNSGLLWGLIIAELALVFILSARIGKMSFFTSSLLFTIYSILNGVTL 101

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+VYT  SI  TFFITA  FG+++L+GY TK+DL   GS   M   GL L ++VNLF
Sbjct: 102 SSIFIVYTMTSIAATFFITAGMFGAMALWGYFTKKDLSKWGSIFFMLLIGLILATVVNLF 161

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKE--AYSDRYDVAYAERQ-SVIGALMLYMDF 243
           +RS A+    S +G++IF+ LTA+D  KIK+  A +  ++     R+ +++GAL LY+DF
Sbjct: 162 LRSGAMGFIFSIVGVIIFTGLTAFDVNKIKQMLAQTQGFEEGDVVRKVALMGALTLYLDF 221

Query: 244 IQIFVHLLRFLGSRRD 259
           I +F++LLRF G RRD
Sbjct: 222 INLFLYLLRFFG-RRD 236


>gi|253700702|ref|YP_003021891.1| hypothetical protein GM21_2081 [Geobacter sp. M21]
 gi|251775552|gb|ACT18133.1| protein of unknown function UPF0005 [Geobacter sp. M21]
          Length = 224

 Score =  145 bits (365), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 92/238 (38%), Positives = 139/238 (58%), Gaps = 26/238 (10%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           I QG    M  VY  M  GL +T ++S     L T   P          V+L    A++ 
Sbjct: 13  IAQG--GVMRGVYGWMGGGLALTALVS-----LITASSP----------VLLQ---AILG 52

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
              L +  +F  LG+ I ++  ++ +SA  A  +FL+Y+A+ GL++SS F+ YTS SI  
Sbjct: 53  NRILFYALVFGELGLVIAISGAINRISATTASALFLIYAAVNGLTMSSIFVAYTSTSIAS 112

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
           TF +T+  F ++SLYGY T+ DL   GSF+ MG  G+ + SLVN+F++SS +   +S  G
Sbjct: 113 TFLVTSGMFCAMSLYGYLTRSDLTSWGSFLFMGLVGVVIASLVNMFLQSSMLSWVLSVCG 172

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +++F+ LTAYDTQKIK+  +         + +V+GAL LY+DFI +F+ +LR  G RR
Sbjct: 173 VIVFTGLTAYDTQKIKQMGNT------GRKGAVLGALTLYLDFINMFLSMLRLFGDRR 224


>gi|119953323|ref|YP_945532.1| integral membrane protein [Borrelia turicatae 91E135]
 gi|119862094|gb|AAX17862.1| integral membrane protein [Borrelia turicatae 91E135]
          Length = 231

 Score =  145 bits (365), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 86/236 (36%), Positives = 141/236 (59%), Gaps = 21/236 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LMA+GL ++ I ++      T+ +P   +II              +T+P+ 
Sbjct: 15  NKFLAQVFGLMAIGLLISAIFAY-----TTSENPAMRAII--------------FTNPMS 55

Query: 86  WI-FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
           +I  I    G+   ++  +  +S+  A  +FL YSAL G++LSS F++YT  SI  TF I
Sbjct: 56  YIAMILVQFGLVYAISGAIEKISSGTATALFLGYSALTGVTLSSVFMIYTQSSIFYTFGI 115

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           T+ +F ++S YGYTT  DL  +GS+ IMG +G+ + S+ N+F RSS ++  +S +G+++F
Sbjct: 116 TSLTFLAMSFYGYTTSTDLTKMGSYFIMGLWGIIIASIFNIFFRSSGLNFLISILGVILF 175

Query: 205 SALTAYDTQKIKEAYSDRYD-VAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           + LTAYD Q I +      D      R +V+ +L LY+DFI +F++LLRFLG R+D
Sbjct: 176 TGLTAYDVQNISKMNRMLEDGTEIKSRMAVVASLKLYLDFINLFLYLLRFLGERKD 231


>gi|291085664|ref|ZP_06353660.2| putative membrane protein [Citrobacter youngae ATCC 29220]
 gi|291070591|gb|EFE08700.1| putative membrane protein [Citrobacter youngae ATCC 29220]
          Length = 214

 Score =  145 bits (365), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 120/192 (62%), Gaps = 9/192 (4%)

Query: 73  TGFGALMYTSPLRWIFIF----APLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
           + F  L+YT+    IF F    A L +   L+  +H LSA     +F+LYS L GL+LSS
Sbjct: 26  SAFMELLYTNR---IFFFGLVIAQLALVFVLSGMIHKLSAGVTTTLFMLYSVLTGLTLSS 82

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            F++YT+ SI  TF +T   FG +SLYGYTTKRDL   G+ + M   G+ L SLVN +++
Sbjct: 83  IFIIYTASSIASTFVVTGGMFGIMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLK 142

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           S A+   ++ +G+++F  LTAYDTQK+K      D  D +   + +++GAL LY+DFI +
Sbjct: 143 SEALMWAVTYIGVIVFVGLTAYDTQKLKNIGEQIDLRDSSNLRKYAILGALTLYLDFINL 202

Query: 247 FVHLLRFLGSRR 258
           F+ LLR  G+RR
Sbjct: 203 FLMLLRIFGNRR 214


>gi|303248181|ref|ZP_07334445.1| protein of unknown function UPF0005 [Desulfovibrio fructosovorans
           JJ]
 gi|302490445|gb|EFL50354.1| protein of unknown function UPF0005 [Desulfovibrio fructosovorans
           JJ]
          Length = 237

 Score =  144 bits (364), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 96/241 (39%), Positives = 140/241 (58%), Gaps = 27/241 (11%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFG-ALMYTSP 83
           L A+M  VY  M +GL VT   S              A ++ +  ++   FG  L+Y   
Sbjct: 18  LNAFMRGVYGWMCMGLLVTAAAS--------------AFVVSSPSILQAVFGNQLIYIG- 62

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L + + L   ++ LSA AA  MFLLYSAL G++LS  F++Y    I+  F 
Sbjct: 63  ----LIIAELAMVVGLAAAINRLSATAATSMFLLYSALNGVTLSVIFVIYAKAVIINAFL 118

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           ++A  FG++SLYG  TKRDL  +GSFM MG  G+ + S+VN+F +S+ +D  +S +G+++
Sbjct: 119 VSAGMFGAMSLYGLLTKRDLTSLGSFMFMGLIGIIIASIVNIFTKSAMMDFIISCVGVLV 178

Query: 204 FSALTAYDTQKIK----EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR-FLGSRR 258
           F  LTAYDTQK+K     A +D  D     R +++GAL LY+DFI +F+ +LR F GS R
Sbjct: 179 FIGLTAYDTQKLKVMGDMAPAD--DATAVRRGTILGALTLYLDFINLFLMMLRLFSGSNR 236

Query: 259 D 259
           +
Sbjct: 237 N 237


>gi|315498128|ref|YP_004086932.1| hypothetical protein Astex_1105 [Asticcacaulis excentricus CB 48]
 gi|315416140|gb|ADU12781.1| protein of unknown function UPF0005 [Asticcacaulis excentricus CB
           48]
          Length = 251

 Score =  144 bits (364), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 101/259 (38%), Positives = 152/259 (58%), Gaps = 16/259 (6%)

Query: 5   RNYQRVVNSGSGFGST----IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           R + R + +GSG G+T    +D  LR YM+ +YN M L L ++G ++FL    A      
Sbjct: 4   RGHSRDLFNGSG-GTTRTLALDADLRRYMMGIYNRMGLALLISGGVAFL----AAQSPGF 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            +++ +  G  ++G       + L W   FAPL + + L   +  +S   A+  F +++A
Sbjct: 59  ISAVYVMSGDRISGL------TGLGWGLAFAPLAMAMVLGFGVMRMSLATAQFSFWIFAA 112

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           ++GLSL+S  L YT  SI Q F ITA +FG  S +GYTTK+DL   G F++M   GL + 
Sbjct: 113 IMGLSLTSIVLAYTGASIAQAFLITAITFGLTSFWGYTTKQDLTRFGGFLMMAVIGLIVA 172

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQ-SVIGALML 239
           SLVNL ++SS + L +SA+G++IF+ALTA+DTQ++K  Y D  D      +  ++GAL L
Sbjct: 173 SLVNLLLQSSWLQLALSALGVLIFTALTAFDTQRLKGLYYDLSDQGETRGKIMILGALSL 232

Query: 240 YMDFIQIFVHLLRFLGSRR 258
           Y++ I IF  LL   G RR
Sbjct: 233 YINVINIFTSLLHLSGERR 251


>gi|325268681|ref|ZP_08135311.1| protein of hypothetical function UPF0005 [Prevotella multiformis
           DSM 16608]
 gi|324989209|gb|EGC21162.1| protein of hypothetical function UPF0005 [Prevotella multiformis
           DSM 16608]
          Length = 242

 Score =  144 bits (364), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 151/259 (58%), Gaps = 25/259 (9%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAY---MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           N+    N  S     ++   RA+   M +VY  MA+ L +TG++++          P   
Sbjct: 4   NFDNFTNVASSHEHDLEMS-RAFPTLMRKVYVWMAMALAITGVVAY-----GAGNSPALI 57

Query: 63  SII-INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
            ++ ++RG +L              I   A LG+  +++ R++ LS  +A + F+++SAL
Sbjct: 58  QMLYMSRGPLL--------------IAGLAELGIVWYVSARINRLSLVSATVWFIVFSAL 103

Query: 122 IGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS 181
            GL+L   F  +TS +I +TFFITA +FG+++L G TTK+DL  +G  + M   GL +  
Sbjct: 104 NGLTLGWIFAAFTSAAISKTFFITAGTFGAMALIGSTTKKDLTRMGGILFMALIGLIIAG 163

Query: 182 LVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAY-AERQSVIGALMLY 240
           LVN+F+RS+ +DL +S +G+++F+ LTA+D Q IK       D    A++ +++GAL LY
Sbjct: 164 LVNVFLRSTMMDLIVSGIGVLVFTGLTAWDAQTIKRNLLMAPDAGESAQKVALLGALSLY 223

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +F++LLRF G+ RD
Sbjct: 224 LDFINLFLYLLRFFGNSRD 242


>gi|222056382|ref|YP_002538744.1| protein of unknown function UPF0005 [Geobacter sp. FRC-32]
 gi|221565671|gb|ACM21643.1| protein of unknown function UPF0005 [Geobacter sp. FRC-32]
          Length = 231

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 81/170 (47%), Positives = 121/170 (71%), Gaps = 3/170 (1%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I   LG+   ++  ++ LSA AA  +F+LY+AL G+++S+ F VYT++SI  TF ITAA+
Sbjct: 65  ILGELGLVFAISGAINRLSATAASSLFILYAALNGVTMSAIFAVYTAESIGSTFVITAAT 124

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++S+YGY TKRDL  +GSF+ MG  G+ + S+VN+F +SSA    +SA+G+++F+ LT
Sbjct: 125 FGAMSIYGYVTKRDLTGMGSFLFMGLIGIVIASIVNIFTKSSAASWIISALGVIVFTGLT 184

Query: 209 AYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDT KIK   +     A   + +++GAL LY+DFI +F+ LLR LG+RR
Sbjct: 185 AYDTWKIKAMAASG---AEGRKPAILGALTLYLDFINLFLMLLRLLGNRR 231


>gi|327313132|ref|YP_004328569.1| hypothetical protein HMPREF9137_0849 [Prevotella denticola F0289]
 gi|326944414|gb|AEA20299.1| putative membrane protein [Prevotella denticola F0289]
          Length = 242

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 147/258 (56%), Gaps = 23/258 (8%)

Query: 6   NYQRVVNSGSGFGSTID--QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           N+    N  S     ++  +   A M +VY  MA+ L +TG++++          P    
Sbjct: 4   NFDNFTNVASSHERNLEMSRTFPALMRKVYVWMAMALAITGVVAY-----GAGSSPALIQ 58

Query: 64  II-INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
           ++ +N G +L              I   A LG+  ++  R+  LS  +A M F+++SA+ 
Sbjct: 59  MLYMNNGPLL--------------IAGLAELGIVWYVTARISRLSLVSATMWFIVFSAVN 104

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GL+L   F+VY   +I +TFFITA +FG+++L G TTK+DL  +G  + M   GL +  L
Sbjct: 105 GLTLGWIFVVYKIAAISKTFFITAGTFGAMALIGSTTKKDLTRMGGILFMALIGLIIAGL 164

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAY-AERQSVIGALMLYM 241
           VN+F+RS+ +D  +S +G+++F+ LTA+D Q IK       D    A++ +++G+L LY+
Sbjct: 165 VNIFLRSTMMDFIVSGIGVLVFTGLTAWDAQAIKRNLLMAPDAGESAQKIALLGSLSLYL 224

Query: 242 DFIQIFVHLLRFLGSRRD 259
           DFI +F++LLRF GS+RD
Sbjct: 225 DFINLFLYLLRFFGSKRD 242


>gi|322833777|ref|YP_004213804.1| hypothetical protein Rahaq_3083 [Rahnella sp. Y9602]
 gi|321168978|gb|ADW74677.1| protein of unknown function UPF0005 [Rahnella sp. Y9602]
          Length = 236

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 137/242 (56%), Gaps = 26/242 (10%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + G++AYM +VY  M  GL +T  +++       +      S + +  +   G       
Sbjct: 16  NTGIQAYMAQVYGWMFCGLLLTAFVAWY-----ASGSEKIMSFVFSSQITFFG------- 63

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                  I A L +   ++  ++ LS   A  +F+LYSAL GL+LSS FLVYT  SI  T
Sbjct: 64  ------LIIAQLALVFVISGMVNRLSGTVATGLFMLYSALTGLTLSSIFLVYTGDSIFGT 117

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F + A  FG++S+YGY TKRDL  IGS + M   GL L SLVN++++SS +   +S  G+
Sbjct: 118 FIVAAGMFGAMSVYGYVTKRDLTGIGSMLFMALIGLVLASLVNMWLKSSGLANIISYAGV 177

Query: 202 VIFSALTAYDTQKIKE-----AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           +IF  LTAYDTQK+K      +  DR +     + S++GAL LY+DFI +F+ LLR  G+
Sbjct: 178 LIFVGLTAYDTQKLKNMGAQLSADDRDNF---RKYSIVGALTLYLDFINLFLMLLRIFGN 234

Query: 257 RR 258
           RR
Sbjct: 235 RR 236


>gi|159046210|ref|YP_001541882.1| hypothetical protein Dshi_3668 [Dinoroseobacter shibae DFL 12]
 gi|157913969|gb|ABV95401.1| protein of unknown function UPF0005 [Dinoroseobacter shibae DFL 12]
          Length = 244

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 87/244 (35%), Positives = 138/244 (56%), Gaps = 25/244 (10%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GLR Y+  V+  M  GL    ++S LV      V P  A               L++ 
Sbjct: 19  DVGLRKYLTGVFAYMGGGL----VLSALVAFAVANVAPVTA---------------LIFG 59

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           +PL+W+ IFAPL + +F + R   LS  A + +F  ++AL+G+SL+S  LV+T  SIVQ 
Sbjct: 60  TPLKWVAIFAPLALVMFASFRFERLSVGALQGLFWGFAALMGVSLASALLVFTGTSIVQA 119

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F   +  F +++L+GYTTKRDL   GSF+++G  G+   S+VNLF+ S A+ + +S +G+
Sbjct: 120 FLSASIIFLTMALWGYTTKRDLSGWGSFLMIGLIGVIGASIVNLFLASGALAMAVSVIGV 179

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQS------VIGALMLYMDFIQIFVHLLRFLG 255
           ++F+ LTA D Q+++  Y    +      Q+      ++GAL LY++ I +F  LL   G
Sbjct: 180 IVFTGLTASDMQRLRNEYLAHCEQGGVATQANLGKLQIMGALSLYLNLINLFQMLLSLFG 239

Query: 256 SRRD 259
            R++
Sbjct: 240 QRQE 243


>gi|325851949|ref|ZP_08171057.1| putative membrane protein [Prevotella denticola CRIS 18C-A]
 gi|325484666|gb|EGC87581.1| putative membrane protein [Prevotella denticola CRIS 18C-A]
          Length = 242

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 147/258 (56%), Gaps = 23/258 (8%)

Query: 6   NYQRVVNSGSGFGSTID--QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           N+    N  S     ++  +   A M +VY  MA+ L +TG++++          P    
Sbjct: 4   NFDNFTNVASSHERDLEMSRTFPALMRKVYVWMAMALAITGVVAY-----GAGSSPALIQ 58

Query: 64  II-INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
           ++ +N G +L              I   A LG+  ++  R+  LS  +A M F+++SA+ 
Sbjct: 59  MLYMNNGPLL--------------IAGLAELGIVWYVTARISRLSLVSATMWFIVFSAVN 104

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GL+L   F+VY   +I +TFFITA +FG+++L G TTK+DL  +G  + M   GL +  L
Sbjct: 105 GLTLGWIFVVYKIAAISKTFFITAGTFGAMALIGSTTKKDLTRMGGILFMALIGLIIAGL 164

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAY-AERQSVIGALMLYM 241
           VN+F+RS+ +D  +S +G+++F+ LTA+D Q IK       D    A++ +++G+L LY+
Sbjct: 165 VNIFLRSTMMDFIVSGIGVLVFTGLTAWDAQAIKRNLLMALDAGESAQKIALLGSLSLYL 224

Query: 242 DFIQIFVHLLRFLGSRRD 259
           DFI +F++LLRF GS+RD
Sbjct: 225 DFINLFLYLLRFFGSKRD 242


>gi|303325473|ref|ZP_07355916.1| putative membrane protein [Desulfovibrio sp. 3_1_syn3]
 gi|302863389|gb|EFL86320.1| putative membrane protein [Desulfovibrio sp. 3_1_syn3]
          Length = 235

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 88/243 (36%), Positives = 139/243 (57%), Gaps = 20/243 (8%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           S +   + AYM +VY  M  GL +T ++++ V       D    +I+ N  VM+      
Sbjct: 11  SGVTSAVSAYMRQVYQWMTAGLALTTVVAYGVANSPAIRD----AILGNSLVMI------ 60

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
                   + I A  G+ I L+  +H +SA  A  +FLLYSAL G  LSS F++Y   SI
Sbjct: 61  --------LLIVAQFGMVIALSAAIHKMSAGTATGLFLLYSALTGAMLSSIFVIYPIASI 112

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
              F +T  +F ++S+YG  TKRDL  +G+F+ MG  G+ +  +VN+F++S+ +D  +S 
Sbjct: 113 ANAFLVTTGTFLAMSVYGTVTKRDLTTMGNFLFMGLIGIIIAMVVNIFLKSTMMDFIISC 172

Query: 199 MGLVIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           +G++IF+ LTAYDTQK++     +   D     R +++GAL LY+DFI +F+ +LR  G 
Sbjct: 173 LGVLIFTGLTAYDTQKLRRFGEAAPLDDGTAVRRGAIMGALTLYLDFINLFLMMLRLFGG 232

Query: 257 RRD 259
            R+
Sbjct: 233 NRN 235


>gi|258406254|ref|YP_003198996.1| hypothetical protein Dret_2134 [Desulfohalobium retbaense DSM 5692]
 gi|257798481|gb|ACV69418.1| protein of unknown function UPF0005 [Desulfohalobium retbaense DSM
           5692]
          Length = 235

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 92/263 (34%), Positives = 147/263 (55%), Gaps = 32/263 (12%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D RN     +S           + A+M  VY  M+ GL +T +++F V      +   
Sbjct: 1   MADFRNITATQSSAVA--------INAFMRGVYTWMSGGLLLTAVVAFGVINTPALIQTV 52

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
           A+    N  ++L              + I A LG+ + ++  +  LS   A  +F+LYS 
Sbjct: 53  AS----NPTILL--------------VLILAELGLVLTISAGISKLSGTMATSLFMLYSG 94

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L G++L+   L+YT  S+  TF I A  FG++SLYG TTK+DL   GSF+ MG  G+ L 
Sbjct: 95  LNGVTLAPILLLYTGASVAGTFVICAGMFGAMSLYGLTTKKDLTSWGSFLFMGLIGIVLA 154

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIK----EAYSDRYDVAYAERQSVIGA 236
           ++VN+F++S+ I+  +S +G+++F+ LTA+DTQ++K     A +D  D     R +++GA
Sbjct: 155 AVVNMFLQSAMIEFVISGVGVLVFTGLTAWDTQQLKTMGETAPAD--DATAVRRGTILGA 212

Query: 237 LMLYMDFIQIFVHLLRFLGSRRD 259
           L LY+DFI +F+ LLRF G  R+
Sbjct: 213 LRLYLDFINLFLMLLRFFGQMRE 235


>gi|152992996|ref|YP_001358717.1| hypothetical protein SUN_1409 [Sulfurovum sp. NBC37-1]
 gi|151424857|dbj|BAF72360.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 233

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 86/232 (37%), Positives = 138/232 (59%), Gaps = 24/232 (10%)

Query: 32  VYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP-LRWIFIF 90
           VY+ M +GL ++G+ +F+V               I+   +L     L++ +P + W+   
Sbjct: 22  VYHWMMIGLLISGLSAFMV---------------IHSAPLL----HLLFGNPYMIWVLFL 62

Query: 91  APLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFG 150
             LG+ I ++  ++ +    A+++F+L+S + G++L+S FL+YT  SIV TFFI AA+FG
Sbjct: 63  IELGLVIAISAGINKMDISTARILFILFSVVDGMTLASIFLIYTEASIVTTFFIAAATFG 122

Query: 151 SLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAY 210
            +SLYGY T  DL   GS +  G  G+ +  +VN F++S   +  +S +G++IF  LTAY
Sbjct: 123 VMSLYGYFTDTDLSSWGSLLFAGLIGIIIALVVNFFLQSPMFEWWISVIGVIIFVGLTAY 182

Query: 211 DTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           DTQKIK   EA +   D     R +++GAL LY+DFI +FV +L F G+ R+
Sbjct: 183 DTQKIKAMGEAMAGD-DAQSLSRVAIVGALALYLDFINLFVMMLEFFGNERN 233


>gi|34540578|ref|NP_905057.1| hypothetical protein PG0795 [Porphyromonas gingivalis W83]
 gi|34396891|gb|AAQ65956.1| membrane protein, putative [Porphyromonas gingivalis W83]
          Length = 236

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 86/196 (43%), Positives = 127/196 (64%), Gaps = 8/196 (4%)

Query: 71  MLTGFGALMYT---SP-LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           ML    +L+YT   +P L W  I A L +   L+ R+  +S + + ++F +YS L G++L
Sbjct: 42  MLVAKSSLIYTMIMNPGLLWGLIIAELALVFILSARIGKMSFFTSSLLFTIYSILNGVTL 101

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+VYT  SI  TFFITA  FG+++L+GY TK+DL   GS   M   GL L ++VNLF
Sbjct: 102 SSIFIVYTMTSIAATFFITAGMFGAMALWGYFTKKDLSKWGSIFFMLLIGLILATVVNLF 161

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKE--AYSDRYDVAYAERQ-SVIGALMLYMDF 243
           +RS A+    S +G++IF+ LTA+D  KIK+  A +  ++     R+ +++GAL LY+DF
Sbjct: 162 LRSGAMGFIFSIVGVIIFTGLTAFDVNKIKQMLAQTQGFEEGDVVRKVALMGALTLYLDF 221

Query: 244 IQIFVHLLRFLGSRRD 259
           I +F++LLRF G RRD
Sbjct: 222 INLFLYLLRFFG-RRD 236


>gi|15896086|ref|NP_349435.1| YccA family membrane protein [Clostridium acetobutylicum ATCC 824]
 gi|15025874|gb|AAK80775.1|AE007780_9 Conserved membrane protein, YccA family [Clostridium acetobutylicum
           ATCC 824]
 gi|325510240|gb|ADZ21876.1| Conserved membrane protein, YccA family [Clostridium acetobutylicum
           EA 2018]
          Length = 231

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 140/241 (58%), Gaps = 23/241 (9%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD-AASIIINRGVMLTGFGALMY 80
           +Q  R+++ +VY  M L L  T  ++     LA +  P    ++ INR            
Sbjct: 10  NQEARSFIQQVYMWMTLALLTTAGVA-----LAVSTSPSLIETLFINR------------ 52

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
              L ++ I A + +  FL+ R++ +S+  A  +F +YS + G +LS  FLVY   SI  
Sbjct: 53  --SLFFVLILAEVLIVAFLSRRINKMSSQVATAIFFVYSVVNGFTLSWIFLVYDLGSISS 110

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            FFITA +FG++  YGY TK+DL  IG+  +MG  GL L S+VN+F+ +      +S +G
Sbjct: 111 VFFITAGTFGAMCAYGYFTKKDLTSIGNICLMGLVGLILASIVNIFIMNDMFSFIISFIG 170

Query: 201 LVIFSALTAYDTQKIKE-AYSDRY--DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           +++F A+TAYDTQ+IK  A S  Y  DV  + + S++GAL LY+DFI +F+++LR  G +
Sbjct: 171 VILFVAITAYDTQRIKAMALSSSYSGDVEASAKGSILGALTLYLDFINLFIYILRLFGRK 230

Query: 258 R 258
           R
Sbjct: 231 R 231


>gi|329114803|ref|ZP_08243560.1| hypothetical protein APO_1601 [Acetobacter pomorum DM001]
 gi|326695934|gb|EGE47618.1| hypothetical protein APO_1601 [Acetobacter pomorum DM001]
          Length = 258

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 147/245 (60%), Gaps = 11/245 (4%)

Query: 18  GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
            + +D GLRAYM+RVYN MA GL +TGI+++   ++A T    + S +  + V + G G 
Sbjct: 20  AANLDAGLRAYMLRVYNWMASGLLLTGIVAY---VIANT----SLSHLFFQVVQVPG-GL 71

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           +   + L  + + +PL   + ++  L+ LS   A+ +F  + A +G S+++ F++YT  S
Sbjct: 72  VPRPTLLGDVAMLSPLAFVLVMSFGLNRLSLQGAQALFWAFCATMGASMANIFVIYTDTS 131

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           IV+ F +TA  F + SL+GY TK +L    SF++MG FGL +  LVNLF++S A+    S
Sbjct: 132 IVRVFLVTACMFAATSLWGYVTKANLLRFSSFLMMGLFGLLIAGLVNLFLKSPALYYVYS 191

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFL 254
            +G+ IF+A +A+D Q+I+  Y         E   ++SV  AL LY++FI +F  LL+F+
Sbjct: 192 IVGVFIFTAFSAFDAQRIRVTYPQLAAYEGPEMTAKRSVYDALSLYLNFINLFQFLLQFM 251

Query: 255 GSRRD 259
           G R  
Sbjct: 252 GVRNS 256


>gi|189461469|ref|ZP_03010254.1| hypothetical protein BACCOP_02125 [Bacteroides coprocola DSM 17136]
 gi|189431803|gb|EDV00788.1| hypothetical protein BACCOP_02125 [Bacteroides coprocola DSM 17136]
          Length = 233

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 93/234 (39%), Positives = 143/234 (61%), Gaps = 20/234 (8%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A M  VY  M L L +TG +S  V          A S         T    +M  S   W
Sbjct: 18  ALMRSVYTWMTLALVITGFVSMYV----------AKS--------YTLLSVIMQNSMAFW 59

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
             I A LG+  +L+ R++ +S   A ++F++YS L G++L+  FL+YT  SI  TFF+TA
Sbjct: 60  GLIIAELGLVWYLSARINKMSFTTATVLFIVYSILNGVTLAFIFLIYTMSSIATTFFVTA 119

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
            +FG ++L+GY TK+DL  IGS  IMG  G+ + S+VN+F+ +S +DL +S +G+++F  
Sbjct: 120 GTFGVMALFGYVTKKDLTRIGSLCIMGVIGIIIASVVNMFLHNSMMDLIISCIGVLLFVG 179

Query: 207 LTAYDTQKIKEAYS-DRYDV-AYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           LTAYD+QKIK+  + D  +V    ++ +++GA+ LY+DFI +F++LLR LG R+
Sbjct: 180 LTAYDSQKIKQLLTADDIEVNETTQKIALMGAMTLYLDFINLFLYLLRLLGDRK 233


>gi|187918401|ref|YP_001883964.1| integral membrane protein [Borrelia hermsii DAH]
 gi|119861249|gb|AAX17044.1| integral membrane protein [Borrelia hermsii DAH]
          Length = 231

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 140/236 (59%), Gaps = 21/236 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LMA+GL ++ I ++      TT +                  A+++T+P+ 
Sbjct: 15  NKFLAQVFGLMAIGLLISAIFAY------TTSENQIMK-------------AIIFTNPMS 55

Query: 86  WI-FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
           +I  +    G+   ++  +  +S+  A  +FL YSAL G++LSS F++YT  SI  TF I
Sbjct: 56  YIAMLLVQFGLVYAISGAIEKISSSTATALFLGYSALTGVTLSSVFMIYTQGSIFYTFGI 115

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           T+ +F ++S YGYTT  DL  +GS+ IMG +G+ + S+ N+F RSS ++  +S +G+++F
Sbjct: 116 TSLTFLAMSFYGYTTSTDLTKMGSYFIMGLWGIIIASIFNIFFRSSGLNFLISILGVILF 175

Query: 205 SALTAYDTQKIKEAYSDRYD-VAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           + LTAYD Q I +      D      R +V+ +L LY+DFI +F++LLRFLG RRD
Sbjct: 176 TGLTAYDVQNISKMNRMLEDGTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRD 231


>gi|218777992|ref|YP_002429310.1| hypothetical protein Dalk_0132 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218759376|gb|ACL01842.1| protein of unknown function UPF0005 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 235

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 139/238 (58%), Gaps = 21/238 (8%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           + A++  VYN M +GL +TG++++     AT   P    +I N   +  G          
Sbjct: 16  VNAFVASVYNWMFIGLTLTGVLAY-----ATFQVPALTKLIFNTPGVFIGL--------- 61

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
               I A L +   L+ R+ ++ A  A  MF++YSAL GL++S  F VY   +I   FF 
Sbjct: 62  ----IIAELALVFILSSRITTMKAGTATGMFVVYSALNGLTMSFIFAVYAKTAIFGAFFA 117

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TA +F + S+YG+ TK+DL  +G FM MG  G+ + S+VN+F+ S+A+   ++ + + IF
Sbjct: 118 TAGTFAACSVYGWVTKKDLTSMGGFMFMGLIGVIIASVVNIFLASTALYWAITYLTIAIF 177

Query: 205 SALTAYDTQKIKE-AYSDRYDV-AYAERQ-SVIGALMLYMDFIQIFVHLLRFLGSRRD 259
             LTAYDTQKIKE A +   D+ A A R+ +++GAL LY+DFI +F+ +LR  G  RD
Sbjct: 178 VGLTAYDTQKIKEMALTQPEDIGASAVRKGAIMGALHLYLDFINLFLMMLRLFGGGRD 235


>gi|197103337|ref|YP_002128715.1| hypothetical protein PHZ_p0197 [Phenylobacterium zucineum HLK1]
 gi|196480613|gb|ACG80140.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 250

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 93/239 (38%), Positives = 137/239 (57%), Gaps = 10/239 (4%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           +D GLR++M+ VYN +ALGL ++ ++++L     T++ P    ++      LT  G    
Sbjct: 21  VDAGLRSFMVGVYNKVALGLVLSAVLAYL-----TSMVPPVRDLMFR----LTPDGRFAG 71

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            + +  +  FAPL V +     +   +A  A  ++    ALIG SL    LVYT  S+  
Sbjct: 72  YTLIGMVVAFAPLVVLLGSMFAMRQPTARGASALYWTVCALIGASLGVLGLVYTGASLAS 131

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
           TF ITAA+FG+LSL+GYTTK+DL  IGSF+++G  GL + SLV +F         +SA G
Sbjct: 132 TFLITAAAFGALSLFGYTTKKDLTGIGSFLLVGLIGLVIASLVQMFWNPPGFSFVISAAG 191

Query: 201 LVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++IF+ L AYDTQ++K  Y +   D A     +  GAL LY++FI +F  LL   G RR
Sbjct: 192 VLIFAGLIAYDTQRLKLTYYELGGDQAALGAATSYGALSLYLNFINLFQFLLSLFGQRR 250


>gi|268590292|ref|ZP_06124513.1| putative membrane protein [Providencia rettgeri DSM 1131]
 gi|291314200|gb|EFE54653.1| putative membrane protein [Providencia rettgeri DSM 1131]
          Length = 235

 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 90/239 (37%), Positives = 138/239 (57%), Gaps = 21/239 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + G++A+M +VY  M +GL +T  +++       +V       I    ++  G       
Sbjct: 16  NTGVQAFMSQVYGWMTVGLLLTAFVAWY------SVSSGLYYTIATNKILFFG------- 62

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                  I A LG+ + ++  L  +S  AA  MF+LYS L GL++S     YT +S+  T
Sbjct: 63  ------MIIAELGLVMGISFLLQKISGMAATGMFMLYSLLTGLTISVILAAYTGESVAGT 116

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F ITA  FG+LS YGYTTKR L  +G+F+ M   G+ + SLVN++++S+ +   ++  G+
Sbjct: 117 FVITAVMFGALSFYGYTTKRSLTGMGNFLFMALIGIVVASLVNIWLQSTMMYWVITYGGV 176

Query: 202 VIFSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++F+ALTAYDTQK+KE  S  D  D     + S++GAL LY+DFI +F+ LLR  G RR
Sbjct: 177 LLFAALTAYDTQKLKEMGSQIDEDDRETMRKYSIMGALSLYLDFINLFLMLLRIFGDRR 235


>gi|256830925|ref|YP_003159653.1| hypothetical protein Dbac_3162 [Desulfomicrobium baculatum DSM
           4028]
 gi|256580101|gb|ACU91237.1| protein of unknown function UPF0005 [Desulfomicrobium baculatum DSM
           4028]
          Length = 234

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 102/257 (39%), Positives = 152/257 (59%), Gaps = 27/257 (10%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N+Q V  +      T  Q    ++  VYN M+LGLG+T ++++ V   ATT  P  A  I
Sbjct: 2   NFQTVSQT-----RTDVQATNLFLRGVYNWMSLGLGLTAVVAYAV---ATT--PAIAQAI 51

Query: 66  INRGVMLTGFGALMYTSPLR-WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGL 124
                         + +P+  W  I A  G+ + ++  +H +SA+ A  +FLLYSAL G 
Sbjct: 52  --------------FANPIIFWGLIIAQFGLVLAISGAVHRMSAFTATGLFLLYSALNGA 97

Query: 125 SLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN 184
           +LSS  +VYT+ SI + F +    F ++S+YG TTK+DL   GSF+ MG  G+ + S+VN
Sbjct: 98  TLSSILMVYTAASIFKAFIVCTGMFAAMSVYGATTKKDLTGWGSFLFMGLIGIIIASIVN 157

Query: 185 LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIK--EAYSDRYDVAYAERQSVIGALMLYMD 242
           +FM SSA+D  +S +G++IF+ LTAYDTQK+K     +   D     R +++GAL LY+D
Sbjct: 158 IFMASSALDFVISGIGVLIFTGLTAYDTQKLKVMGESAPMDDTVAVRRGTILGALTLYLD 217

Query: 243 FIQIFVHLLRFLGSRRD 259
           FI +F+ LLRF GS R+
Sbjct: 218 FINLFLFLLRFFGSSRN 234


>gi|239909125|ref|YP_002955867.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
 gi|239798992|dbj|BAH77981.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
          Length = 239

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 133/238 (55%), Gaps = 21/238 (8%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           + A+M  VY  M LGL VT   S  V        P     +    ++  G          
Sbjct: 20  VNAFMRGVYGWMCLGLLVTAAASVFV-----VSSPALMQAVFGNQILFFGL--------- 65

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
               I A L + + L+  ++ LSA  A  +F+LYSAL G++LS+ F+VY   +I + F +
Sbjct: 66  ----IIAELALVVGLSAAINRLSAGTASGLFMLYSALNGVTLSAIFVVYAQATIFKAFLV 121

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           T   FG++SLYG  TKRDL  +GSF+ MG  G+ + SLVN+F +S+  D  +S +G+++F
Sbjct: 122 TGGMFGAMSLYGLLTKRDLTGMGSFLFMGLIGIVIASLVNMFTKSAMADFIISCVGVLVF 181

Query: 205 SALTAYDTQKIK--EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR-FLGSRRD 259
           + LTAYDTQK+K     +   D     R +++GAL LY+DFI +F+ +LR F G  RD
Sbjct: 182 TGLTAYDTQKLKVMGEMAPADDATAVRRGTILGALTLYLDFINLFLMMLRLFGGGNRD 239


>gi|295112219|emb|CBL28969.1| Integral membrane protein, interacts with FtsH [Synergistetes
           bacterium SGP1]
          Length = 239

 Score =  142 bits (357), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 133/232 (57%), Gaps = 23/232 (9%)

Query: 31  RVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFI- 89
           RVY  MA+GL +T + ++ V                + G ++  F    Y SP+  I + 
Sbjct: 27  RVYQWMAIGLILTAVTAYGVA---------------SNGTLMRVF----YGSPMPLIVVA 67

Query: 90  FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASF 149
            A LG+   L+  +  +SA AA  +F++YS L GL  S   L+Y  +S+   FF TA  F
Sbjct: 68  VATLGLVFALSAGIRRISAGAASALFVIYSVLNGLLCSGVLLIYAQESVYAAFFSTAGMF 127

Query: 150 GSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTA 209
             +S+YG  T+RDL  +GSF+ MG FGL + +LVNLF+RS+ ++   S +G+++F  LTA
Sbjct: 128 AVMSVYGLYTRRDLTSLGSFLYMGLFGLIISALVNLFVRSTMVEFVSSIIGVIVFLGLTA 187

Query: 210 YDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           YDTQ I+   +   D  D     + +V+GAL LY+DFI IF++LLR  G RR
Sbjct: 188 YDTQAIRRMGDEIEDGEDGVTIRKVAVLGALSLYLDFINIFLYLLRLFGKRR 239


>gi|258541193|ref|YP_003186626.1| hypothetical protein APA01_00890 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632271|dbj|BAH98246.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256635328|dbj|BAI01297.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256638383|dbj|BAI04345.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256641437|dbj|BAI07392.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256644492|dbj|BAI10440.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256647547|dbj|BAI13488.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256650600|dbj|BAI16534.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653591|dbj|BAI19518.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 258

 Score =  142 bits (357), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 90/245 (36%), Positives = 146/245 (59%), Gaps = 11/245 (4%)

Query: 18  GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
            + +D GLRAYM+RVYN MA GL +TGI+++   ++A T    + S +  + V + G G 
Sbjct: 20  AANLDAGLRAYMLRVYNWMASGLLLTGIVAY---VIANT----SLSHLFFQVVQVPG-GL 71

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           +   + L  + + +PL   + ++  L+ LS   A+ +F  + A +G S ++ F++YT  S
Sbjct: 72  VPRPTLLGDVAMLSPLAFVLVMSFGLNRLSLQGAQALFWAFCAAMGASTANIFVIYTDTS 131

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           IV+ F +TA  F + SL+GY TK +L    SF++MG FGL +  LVNLF++S A+    S
Sbjct: 132 IVRVFLVTACMFAATSLWGYVTKANLLRFSSFLMMGLFGLLIAGLVNLFLKSPALYYVYS 191

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFL 254
            +G+ IF+A +A+D Q+I+  Y         E   ++SV  AL LY++FI +F   L+F+
Sbjct: 192 IVGVFIFTAFSAFDAQRIRVTYPQLAAYEGPEMTAKRSVYDALSLYLNFINLFQFFLQFM 251

Query: 255 GSRRD 259
           G+R  
Sbjct: 252 GARNS 256


>gi|149920702|ref|ZP_01909167.1| hypothetical protein PPSIR1_01924 [Plesiocystis pacifica SIR-1]
 gi|149818489|gb|EDM77938.1| hypothetical protein PPSIR1_01924 [Plesiocystis pacifica SIR-1]
          Length = 255

 Score =  142 bits (357), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 91/257 (35%), Positives = 141/257 (54%), Gaps = 25/257 (9%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           NY   + +G+     +  G+  +M RV   MA G+G+TG+ +FLV    T V+       
Sbjct: 21  NYAPGMQAGARPSPELASGVEQFMTRVNAWMAAGVGLTGLTAFLVAQSPTLVN------- 73

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                        ++ + L W+ + AP+ +   +  R+  +S  AA   FL+YSAL G+S
Sbjct: 74  ------------AIFGTGLFWVAVLAPVILVFVIASRVQKMSPAAATATFLVYSALNGMS 121

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L+  F VY+  +I   F ITA ++GSL+L+G+ TKRDL   G F+ M   GL + S+  +
Sbjct: 122 LAFIFFVYSLGTIASVFAITAVTYGSLALWGFATKRDLSGWGRFLFMALVGLIVSSIAFM 181

Query: 186 FMR---SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           F+     S + L  + +G+++F+ALTAYDTQKIK+ Y            +++GAL LY+D
Sbjct: 182 FIPGVMGSTMYLVYNVIGVLVFAALTAYDTQKIKQIYLVN---GGGGNLAILGALTLYLD 238

Query: 243 FIQIFVHLLRFLGSRRD 259
           FI +F+ LLR  G  RD
Sbjct: 239 FINLFMFLLRLFGGGRD 255


>gi|85058888|ref|YP_454590.1| hypothetical protein SG0910 [Sodalis glossinidius str. 'morsitans']
 gi|84779408|dbj|BAE74185.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 236

 Score =  141 bits (356), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 138/241 (57%), Gaps = 24/241 (9%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           +  ++ +M +VY  M  GL +T  +++          P     I +    LT FG     
Sbjct: 16  NSAVQPFMAQVYGWMTCGLLLTAFVAWY-----AARTPALLQFIFSS--QLTFFG----- 63

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                  I A L +   ++  ++ LS   A  +F+LYS L GL+L+S F+VYT+ SI  T
Sbjct: 64  ------LIIAQLALVFVISGMVNRLSGAVATSLFMLYSVLTGLTLASIFIVYTASSIAST 117

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F +TA  FG+++LYGYTTKRDL   G+ + M   G+ L SLVN++++S+A+   ++ +G+
Sbjct: 118 FVVTAGMFGAMTLYGYTTKRDLSSFGNLLFMALIGIVLASLVNIWLKSTALMWAVTYIGV 177

Query: 202 VIFSALTAYDTQKIKEAYS----DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           V+F  LTAYDTQK+K   +    D  D     + S++GAL LY+DFI +F+ LLR  G+R
Sbjct: 178 VVFVGLTAYDTQKLKNMGAQLSLDNKD--QFRKYSIVGALSLYLDFINLFLMLLRIFGNR 235

Query: 258 R 258
           R
Sbjct: 236 R 236


>gi|261343452|ref|ZP_05971097.1| membrane protein [Providencia rustigianii DSM 4541]
 gi|282568598|gb|EFB74133.1| membrane protein [Providencia rustigianii DSM 4541]
          Length = 235

 Score =  141 bits (356), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 145/258 (56%), Gaps = 29/258 (11%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D RN   V N+ +G        ++A+M +VY  M +GL +T  +++       ++     
Sbjct: 5   DQRNDSLVQNASTG--------VQAFMSQVYGWMTVGLLLTAFVAWY------SLSSGLF 50

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
             I    V+  G              I A LG+ + L+  L  +S   A  MF+LY+ L 
Sbjct: 51  VTIATNKVLFFGM-------------IIAELGLVMGLSFLLPKMSGAIATGMFMLYALLT 97

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GL++S    VYT +S+V TF ITA  FG+LS YGYTTKR L  +G+F+ M   GL + SL
Sbjct: 98  GLTISVILAVYTGESVVGTFIITAVMFGALSFYGYTTKRSLTGMGNFLFMALIGLVVASL 157

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLY 240
           VN++++SS +   ++  G+++F+ALTAYDTQK+KE     ++ D     + S++GAL LY
Sbjct: 158 VNIWLQSSMMYWVITYGGVLLFAALTAYDTQKLKEMGEQINQDDRENMRKYSIMGALSLY 217

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DFI +F+ LLR  G RR
Sbjct: 218 LDFINLFLMLLRIFGDRR 235


>gi|282879267|ref|ZP_06288014.1| inner membrane family protein [Prevotella buccalis ATCC 35310]
 gi|281298611|gb|EFA91033.1| inner membrane family protein [Prevotella buccalis ATCC 35310]
          Length = 238

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 94/258 (36%), Positives = 145/258 (56%), Gaps = 23/258 (8%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           ++ +  R++    G   ++     A M +VY  M L L +TGI ++              
Sbjct: 2   EVNDLDRLIREQEG---SLSLAFPALMRKVYVWMTLALVLTGITAY-------------- 44

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
            +  +  +M+T F     T  + W  I A L + I ++  ++ LS   A ++F+LYS L 
Sbjct: 45  GVASSPSLMMTIF----QTPAIMWGLIIAELAIVIAISAAINRLSLTTATLLFVLYSVLN 100

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G + S  F VYT  SI   FFITA +FG ++ YGY TKRDL   G  ++M   GL + +L
Sbjct: 101 GATFSLIFAVYTMSSIANVFFITAGTFGVMAAYGYFTKRDLSSWGKLLLMALIGLIIATL 160

Query: 183 VNLFM-RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAY-AERQSVIGALMLY 240
           VN+F+ +SS  DL +S  G++IF  LTAYDTQKIK+  + + D+   A++ +++GAL LY
Sbjct: 161 VNVFLVKSSGFDLILSYAGVLIFVGLTAYDTQKIKQMLAMQTDMGEGAQKVALLGALSLY 220

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DFI +F++LLR  G R 
Sbjct: 221 LDFINLFLYLLRIFGRRE 238


>gi|148550821|ref|YP_001260260.1| hypothetical protein Swit_5385 [Sphingomonas wittichii RW1]
 gi|148503240|gb|ABQ71493.1| protein of unknown function UPF0005 [Sphingomonas wittichii RW1]
          Length = 241

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 84/237 (35%), Positives = 138/237 (58%), Gaps = 19/237 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GLR +MI +Y  MALGL +TG+++F V       +P                   ++ 
Sbjct: 23  DAGLRNHMIGIYRNMALGLALTGLVAFGVASTPALYEP-------------------IFG 63

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           +PL+W+ IFAPL   + L+  LH +SA  A+  + +++ ++G+S++S FL++T +SI   
Sbjct: 64  TPLKWVAIFAPLAFVLLLSFGLHQMSAAMAQTAYFVFAGVMGISMASIFLMFTGESIALA 123

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FF  AA F ++SL+GYTT  DL      +++G   +   S+V LF+ SS + +  S  G+
Sbjct: 124 FFTAAAVFAAMSLWGYTTGADLSRWAPILMVGLLAVVAASIVTLFLGSSTLQMLFSIAGI 183

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           V+F+ LTA+DTQ+++  Y        A + +++GAL LY++ I +F  LL F+G RR
Sbjct: 184 VVFTGLTAWDTQRLRNEYYAYAGQEEAGKLAIVGALSLYLNLINLFQLLLTFMGQRR 240


>gi|203284444|ref|YP_002222184.1| hypothetical protein BDU_540 [Borrelia duttonii Ly]
 gi|203287978|ref|YP_002222993.1| hypothetical protein BRE_543 [Borrelia recurrentis A1]
 gi|201083887|gb|ACH93478.1| conserved hypothetical integral membrane protein [Borrelia duttonii
           Ly]
 gi|201085198|gb|ACH94772.1| conserved hypothetical integral membrane protein [Borrelia
           recurrentis A1]
          Length = 231

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 144/236 (61%), Gaps = 21/236 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++  V+ LM++GL ++ I ++       T   +A   II          A+++T+P+ 
Sbjct: 15  NKFLAHVFGLMSVGLLISAIFAY-------TTSENA---IIR---------AIIFTNPMS 55

Query: 86  WI-FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
           +I  I    G    ++  ++ +S+  A  +FL+YSAL G++LSS F++YT  SI  TF I
Sbjct: 56  YIAIILIQFGFVYAISGAINRISSGTATALFLMYSALTGVTLSSIFMIYTQGSIFYTFGI 115

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           T+ +F ++S YG+TT  DL  +GS+ +MG +G+ + S++N+F RSS ++  +S +G+++F
Sbjct: 116 TSLTFLAMSFYGHTTSTDLTKMGSYFMMGLWGIIIASILNMFFRSSGLNFLISILGVILF 175

Query: 205 SALTAYDTQKIKEAYSDRYD-VAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           + LTAYD Q I +  +   D      R +V+ +L LY+DFI +F++LLRFLG RRD
Sbjct: 176 TGLTAYDVQNISKMDNMLEDGTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRD 231


>gi|301167689|emb|CBW27272.1| putative transmembrane protein [Bacteriovorax marinus SJ]
          Length = 236

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 137/243 (56%), Gaps = 22/243 (9%)

Query: 20  TIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALM 79
           +I +    +M  VY  M+ G+ +T  +SF V     +   +  S+II    +  G     
Sbjct: 12  SISEENARFMSGVYKWMSFGIILTSFISFYV-----SQSKELVSLIIGNKFIFYGL---- 62

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIV 139
                    + A LG   +L+ ++ ++S+ AA +++LLY+AL GL+LS  FL+YTS+SI 
Sbjct: 63  ---------LIAQLGAVFYLSAKVKTISSMAATIIYLLYAALTGLTLSLIFLIYTSESIQ 113

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS---SAIDLTM 196
             F +TA SF  LSL+GY TKRDLGPIG+F  M  +G+    ++ +F  S   S      
Sbjct: 114 SAFILTAFSFAGLSLFGYVTKRDLGPIGTFCHMALWGMIGFGILTIFFPSLMTSGASKIY 173

Query: 197 SAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVI-GALMLYMDFIQIFVHLLRFLG 255
              G++IFS LTAYDTQKIK +     +    +R+  I GAL LY+DFI +F+ +LR +G
Sbjct: 174 GICGVLIFSGLTAYDTQKIKSSNIIGNEGTDEDRKETIYGALTLYLDFINLFLSILRLMG 233

Query: 256 SRR 258
            R+
Sbjct: 234 RRK 236


>gi|218510374|ref|ZP_03508252.1| hypothetical protein RetlB5_24744 [Rhizobium etli Brasil 5]
          Length = 163

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 105/164 (64%), Gaps = 19/164 (11%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D+GLR +M+RVYN M LGL +TGI++F+V        P                   ++ 
Sbjct: 19  DEGLRQHMLRVYNYMGLGLVITGIVAFIVGSTPALYVP-------------------IFG 59

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           SPL+W+ + APL    F + R+ ++SA  A++ F  + A++GLSL+S FLV+T  SI QT
Sbjct: 60  SPLKWVVMLAPLAFVFFFSFRIQTMSASTAQITFWAFCAVMGLSLASVFLVFTKTSIAQT 119

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           FFITAA FG+ SLYGYTTKRDL  +GSF++MG FG+ +  +VN+
Sbjct: 120 FFITAAMFGTTSLYGYTTKRDLSRMGSFLMMGLFGIIIAGIVNI 163


>gi|283852305|ref|ZP_06369576.1| protein of unknown function UPF0005 [Desulfovibrio sp. FW1012B]
 gi|283572262|gb|EFC20251.1| protein of unknown function UPF0005 [Desulfovibrio sp. FW1012B]
          Length = 237

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 90/239 (37%), Positives = 136/239 (56%), Gaps = 23/239 (9%)

Query: 25  LRAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           + A+M  VY  M LGL +T G  +F V+       P     +    ++  G         
Sbjct: 18  VNAFMRGVYGWMCLGLLLTAGASAFTVS------SPAMMQAVFGNQILFFGL-------- 63

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A  G+ I ++  ++ LSA AA  +FLLYSAL G++L++ F VY   +I   FF
Sbjct: 64  -----IIAEFGLVIGISAAINRLSAGAASGLFLLYSALNGITLAAIFAVYAKAAIFNAFF 118

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +T   FG++SLYG  TK+DL   GSF+ MG  G+ + S++N+F +S+ +D  +S +G+++
Sbjct: 119 VTGGMFGAMSLYGLLTKKDLTSFGSFLFMGLVGIVIASVINIFTKSAMMDFIISCVGVLV 178

Query: 204 FSALTAYDTQKIK--EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR-FLGSRRD 259
           F  LTAYDTQK+K     +   D     R +++GAL LY+DFI +F+ +LR F GS RD
Sbjct: 179 FLGLTAYDTQKLKVMGEMAPADDATAVRRGTILGALTLYLDFINLFLMMLRLFSGSNRD 237


>gi|302344623|ref|YP_003809152.1| hypothetical protein Deba_3205 [Desulfarculus baarsii DSM 2075]
 gi|301641236|gb|ADK86558.1| protein of unknown function UPF0005 [Desulfarculus baarsii DSM
           2075]
          Length = 241

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 86/249 (34%), Positives = 135/249 (54%), Gaps = 20/249 (8%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA-SIIINRGVM 71
           +G        Q + A+M RVYN M LGL ++G++++ V      ++ DAA S+ I+    
Sbjct: 10  AGEAISDRQTQIIGAFMRRVYNWMTLGLALSGVVAWWV------MNSDAALSVFIDA--- 60

Query: 72  LTGFGALMYTSP--LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
                    T P  + W  I    G+ I L+  +   S   A  +F  Y+AL G++L   
Sbjct: 61  --------QTGPTMMFWAAIIGEFGLVIALSAGIRRFSPTTAMALFTAYAALNGVTLGIV 112

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
            L +T  S+ + F ITA +FG  S++  TTK+DL   GSF+ MG  G+ + S+VN+F  S
Sbjct: 113 MLAFTGASVAKAFLITAGTFGVTSIWASTTKKDLSAWGSFLFMGLIGIIIASVVNIFFES 172

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
             +D  +S +G+ +F  LTAYDTQ+++    +  +     + ++ GAL LY+DFI +F+ 
Sbjct: 173 PMMDWIISVVGVGLFVGLTAYDTQRLRAMVLEAANEVTVSKMAIFGALQLYLDFINLFLM 232

Query: 250 LLRFLGSRR 258
           LLR  G RR
Sbjct: 233 LLRLFGDRR 241


>gi|293397175|ref|ZP_06641449.1| integral membrane protein [Serratia odorifera DSM 4582]
 gi|291420646|gb|EFE93901.1| integral membrane protein [Serratia odorifera DSM 4582]
          Length = 214

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 113/172 (65%), Gaps = 2/172 (1%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A L +   ++  ++ LS   A  +F+LYSAL GL+LSS F+VYT  SI  TF +TA  
Sbjct: 43  IIAQLALVFVISGMVNRLSGAVATSLFMLYSALTGLTLSSIFIVYTYSSIASTFVVTAGM 102

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S+A+   ++ +G+V+F  LT
Sbjct: 103 FGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSTALMWAITYIGVVVFVGLT 162

Query: 209 AYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K      +  D     + +++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 163 AYDTQKLKAMGEQLNPDDKDGFRKYAIVGALTLYLDFINLFLMLLRIFGNRR 214


>gi|310822412|ref|YP_003954770.1| hypothetical protein STAUR_5171 [Stigmatella aurantiaca DW4/3-1]
 gi|309395484|gb|ADO72943.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 236

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 89/240 (37%), Positives = 134/240 (55%), Gaps = 26/240 (10%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           + +  RA+M RVY  M  GL +TG+ +        TV  +A   ++N+            
Sbjct: 21  VQESQRAFMSRVYGWMFAGLMLTGVTALY------TVSNEA---LLNQ------------ 59

Query: 81  TSPLRWI--FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
              L+W    + A LGV + L+     LS   A  +FL YSAL G++LS +FL+YT+ SI
Sbjct: 60  --VLQWRMGLLLAELGVVLALSFLAPRLSGPVAAALFLGYSALTGMTLSIYFLIYTAGSI 117

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            Q   +T   FG+LSLYG  TK+DL    +F+ MG  G+ L  + N+F+RS  +    + 
Sbjct: 118 GQALLLTGGVFGALSLYGTLTKKDLSAWAAFLFMGLVGVLLAGVANIFIRSEGMSFVTAC 177

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             +++F+ LTAYDTQK+++ ++     + A   SV+GAL LY+DFI +F+ LLR  G RR
Sbjct: 178 ACVIVFAGLTAYDTQKLRQMHAAT-GYSSAATISVVGALTLYLDFINLFLALLRLFGRRR 236


>gi|94987252|ref|YP_595185.1| integral membrane protein, interacts with FtsH [Lawsonia
           intracellularis PHE/MN1-00]
 gi|94731501|emb|CAJ54864.1| Integral membrane protein, interacts with FtsH [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 237

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 115/174 (66%), Gaps = 2/174 (1%)

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
           I   A + + + L+  +  LS+ AA ++F+LYS L+G  LSS  +VYT  S+VQ F  TA
Sbjct: 64  ILAIAVIALPLVLSTMISRLSSTAATLLFILYSLLMGAFLSSVLVVYTGTSVVQAFVTTA 123

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
            +F ++S+YG  TKRDL  +GSF+ MG  GL +  +VN+F++S  ++  +SA+G++IF+ 
Sbjct: 124 GTFAAMSIYGTVTKRDLTSMGSFLTMGLIGLIIAMVVNIFLKSPMMEFIISAIGVLIFTG 183

Query: 207 LTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           LTAYDTQKI+     +   D     R +++GAL LY+DFI +F+ +LR +G RR
Sbjct: 184 LTAYDTQKIRTFGENAPLNDSLAIRRGALLGALTLYLDFINLFLMMLRLMGDRR 237


>gi|315497417|ref|YP_004086221.1| hypothetical protein Astex_0374 [Asticcacaulis excentricus CB 48]
 gi|315415429|gb|ADU12070.1| protein of unknown function UPF0005 [Asticcacaulis excentricus CB
           48]
          Length = 249

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 146/244 (59%), Gaps = 16/244 (6%)

Query: 20  TIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALM 79
           ++D GLR++M+ VYN MALGL +TG +++     A    P+    I N    +T  G L 
Sbjct: 18  SVDAGLRSFMLGVYNKMALGLLLTGALAW-----AAANVPE----ITNLMFRVTADGRLA 68

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIV 139
             + + ++  FAP+ + +     +   +  +  +++ L  ALIGLS  + FLVYT  S+ 
Sbjct: 69  GYTIMGYVISFAPVVILLGSGFVMRQPTVASTSILYWLVVALIGLSTGANFLVYTGGSLA 128

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
            TFF+TAA+FG+LSLYGYTTKRD+   G F+ M   GL + S+VNLF++SS +   +S +
Sbjct: 129 STFFVTAAAFGALSLYGYTTKRDMSGWGKFLFMAVIGLIIASVVNLFLQSSMLYFIVSGL 188

Query: 200 GLVIFSALTAYDTQKIKEAY----SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           G++IFSAL A++TQ +K  Y     +   +A A      GAL LY+ FI +F  LL F+G
Sbjct: 189 GVLIFSALIAFETQNLKHTYYQLGGNEAGMAMATNY---GALSLYISFINLFQFLLAFMG 245

Query: 256 SRRD 259
            RRD
Sbjct: 246 VRRD 249


>gi|89053719|ref|YP_509170.1| hypothetical protein Jann_1228 [Jannaschia sp. CCS1]
 gi|88863268|gb|ABD54145.1| protein of unknown function UPF0005 [Jannaschia sp. CCS1]
          Length = 252

 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 96/263 (36%), Positives = 147/263 (55%), Gaps = 23/263 (8%)

Query: 6   NYQRVVNSG-SGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASI 64
            YQ + + G +G  + IDQGLRA+M +VY  M++GL +T          A   +P     
Sbjct: 3   EYQTMRSQGMAGSAAEIDQGLRAHMNKVYGTMSIGLLIT-----FAAAWAVGANPAILQY 57

Query: 65  IINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGL 124
           + +     TG       + L WI +FAPLG+       +   SA AA+  F  ++A++G+
Sbjct: 58  LFS---FETG-----GPTILGWIAMFAPLGMIFAFGAVITKASAAAAQTFFYAFAAVMGI 109

Query: 125 SLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN 184
           S++  F VYT  SIVQ F +T+ +F  LS +GY TKRD+   G+F+IMG  G  +L L++
Sbjct: 110 SIAYIFAVYTGASIVQAFLVTSIAFAGLSTWGYVTKRDISGWGAFLIMGLIGGIVLMLLS 169

Query: 185 LFMRS------SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVIG 235
             + +         DL +SA+ L++F+ LTAY TQ IK+ Y D     D  +  + +++G
Sbjct: 170 FALSAFWGIVIPGFDLALSALLLLVFAGLTAYHTQAIKQDYVDHAQHGDSEWLAKSAIMG 229

Query: 236 ALMLYMDFIQIFVHLLRFLGSRR 258
           AL LYM FI +F+ +L FLG+R 
Sbjct: 230 ALNLYMSFINMFLIILSFLGNRE 252


>gi|212712162|ref|ZP_03320290.1| hypothetical protein PROVALCAL_03244 [Providencia alcalifaciens DSM
           30120]
 gi|212685209|gb|EEB44737.1| hypothetical protein PROVALCAL_03244 [Providencia alcalifaciens DSM
           30120]
          Length = 235

 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 95/258 (36%), Positives = 145/258 (56%), Gaps = 29/258 (11%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D RN   V N+ +G        ++A+M +VY  M +GL +T  +++       ++     
Sbjct: 5   DQRNDSLVQNASTG--------VQAFMSQVYGWMTVGLLLTAFVAWY------SLSSGLF 50

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
             I    V+  G              I A LG+ + L+  L  +S   A  MF+LY+ L 
Sbjct: 51  FTIATNKVLFFGM-------------IIAELGLVMGLSFLLPKMSGAIATGMFMLYALLT 97

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GL++S    VYT +S+V TF ITA  FG+LS +GYTTKR L  +G+F+ M   GL + SL
Sbjct: 98  GLTISVILAVYTGESVVGTFIITAVMFGALSFFGYTTKRSLTGMGNFLFMALIGLVVASL 157

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLY 240
           VN++++SS +   ++  G+++F+ALTAYDTQK+KE     ++ D     + S++GAL LY
Sbjct: 158 VNIWLQSSMMYWVITYGGVLLFAALTAYDTQKLKEMGEQINQDDRENMRKYSIMGALSLY 217

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DFI +F+ LLR  G RR
Sbjct: 218 LDFINLFLMLLRIFGDRR 235


>gi|302381646|ref|YP_003817469.1| hypothetical protein Bresu_0531 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192274|gb|ADK99845.1| protein of unknown function UPF0005 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 249

 Score =  139 bits (349), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 99/270 (36%), Positives = 150/270 (55%), Gaps = 32/270 (11%)

Query: 1   MSDIRN-YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLV-NILAT--- 55
           MSD RN Y     + +     +D GLR++M+ VYN +ALGL V G +++L  N+ A    
Sbjct: 1   MSDFRNGYSTPAPAHADM--AVDAGLRSFMLGVYNKLALGLLVAGGLAYLTGNVPAVQQL 58

Query: 56  --TVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKM 113
                PD         + +T  G ++   P+  +F     G   F+     + +A    M
Sbjct: 59  FFAPTPDGR-------IGMTMLGMIVQFLPIVLLF-----GSMFFM----KNPTARGVNM 102

Query: 114 MFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMG 173
           ++    A IG  +   FL YT  S+  TFF+TAASFG+LSL GYTTK+DL  +GSF+IMG
Sbjct: 103 LYWAVVASIGAGMGILFLRYTGGSLASTFFVTAASFGALSLVGYTTKKDLTAMGSFLIMG 162

Query: 174 AFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAER--- 230
             GL + S+VN+FM+S  + L +S +G++IF+ L A+DTQ++K  Y   Y +   E    
Sbjct: 163 VIGLIIASIVNIFMQSGTLYLIISGLGVLIFAGLIAFDTQRLKMTY---YQLGGNEAAMG 219

Query: 231 -QSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
             +  GAL L+++F+ +F  LL F+G  R+
Sbjct: 220 VATGFGALSLFINFVNLFQFLLAFMGGNRN 249


>gi|255533663|ref|YP_003094035.1| hypothetical protein Phep_3782 [Pedobacter heparinus DSM 2366]
 gi|255346647|gb|ACU05973.1| protein of unknown function UPF0005 [Pedobacter heparinus DSM 2366]
          Length = 249

 Score =  138 bits (347), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 117/183 (63%), Gaps = 7/183 (3%)

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + L WI  FAPLG+ + ++  L+ LS  A   +F+LYS L GLSLS   LVYTS S++  
Sbjct: 68  TTLGWIATFAPLGLVLLMSAGLNRLSYGALVGVFVLYSVLTGLSLSFILLVYTSTSVLSC 127

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F   A  FG +++ GYTT  DL   G  +++G  GL + S+VN+F++S+   L M+ +G+
Sbjct: 128 FIGAAGIFGIMAIMGYTTNIDLSKFGPILMIGVVGLIIASVVNMFIQSANFSLFMAFIGI 187

Query: 202 VIFSALTAYDTQKIK------EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
            IF+ALTAYD QK+K      EA   + D A  ++ +++GAL LY+DF+ IF++LLR  G
Sbjct: 188 AIFTALTAYDVQKLKRIGEGLEANGAQMD-ADTKKLAIMGALSLYLDFLNIFIYLLRIFG 246

Query: 256 SRR 258
            RR
Sbjct: 247 DRR 249


>gi|332188342|ref|ZP_08390068.1| uncharacterized UPF0005 family protein [Sphingomonas sp. S17]
 gi|332011655|gb|EGI53734.1| uncharacterized UPF0005 family protein [Sphingomonas sp. S17]
          Length = 213

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 81/230 (35%), Positives = 134/230 (58%), Gaps = 19/230 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M+ +Y  MALGL +TG+++ LV        P                   ++ +PL+W+ 
Sbjct: 1   MLGIYRTMALGLVLTGLVASLVASTPALYQP-------------------IFNTPLKWVV 41

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           + APL   +F + R+  +SA  A++ F  ++A++GLSL+S FLV+T  SI   FF  AA 
Sbjct: 42  MLAPLAFVLFFSFRVEQMSANTARIAFYSFAAIMGLSLASVFLVFTGTSIALAFFSAAAL 101

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           F ++ L+GYTT  DL    +F+++G  G+ + SL+NLF+ S  +   +S +G+++F+ LT
Sbjct: 102 FATMCLWGYTTNVDLSRWSTFLMVGLVGVIIASLINLFLASDTLQFAVSIIGVLVFTGLT 161

Query: 209 AYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           A+D+Q++K  Y         E+ +V+GAL LY+D I +F  LL  +G R+
Sbjct: 162 AWDSQRLKSQYFAYAGTESGEKLAVMGALSLYLDLINLFQLLLNLIGERQ 211


>gi|323699004|ref|ZP_08110916.1| protein of unknown function UPF0005 [Desulfovibrio sp. ND132]
 gi|323458936|gb|EGB14801.1| protein of unknown function UPF0005 [Desulfovibrio desulfuricans
           ND132]
          Length = 244

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 84/236 (35%), Positives = 133/236 (56%), Gaps = 11/236 (4%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           L A+M  VY  M+ GLG+T +++F     AT   P     + N   +      +   + L
Sbjct: 18  LNAFMRGVYGWMSAGLGLTALVAF-----ATLTVPA----LTNLAFVYNPQTGMYAPTML 68

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
             I + A  G+  F++ ++ +++   A  +F+ +SAL G SL+     YT+ S+V TF  
Sbjct: 69  PMIALLAAFGMVFFMSFKISTMNPSTATGLFMAFSALNGFSLAPILFAYTTASVVTTFIT 128

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TA  FG++S+YG  TK+DL   GS + MG  G+ +  +VN+F++S  +   +S +G++IF
Sbjct: 129 TAGMFGAMSVYGMVTKKDLTSWGSLLFMGLIGIIIAMVVNMFLQSPGMSFAISVLGVIIF 188

Query: 205 SALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             LTAYDTQK+K         D A   R +++GAL LY+DF  +F+ LLR +G RR
Sbjct: 189 VGLTAYDTQKLKTMGETVPLGDTAAVRRGTILGALTLYLDFYNLFLMLLRLMGDRR 244


>gi|260909707|ref|ZP_05916401.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260636132|gb|EEX54128.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 238

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 89/256 (34%), Positives = 143/256 (55%), Gaps = 23/256 (8%)

Query: 5   RNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASI 64
           ++  R++    G    +     A M +VY  M L L +TG+ ++ V       +    S+
Sbjct: 4   QDLDRLIREKEG---ALSLAFPALMRKVYVWMTLALIITGVTAYGV----AHSEVLMQSV 56

Query: 65  IINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGL 124
             +RG+               W  + A LG+   ++  +  LS   A ++F+LYSAL G 
Sbjct: 57  YESRGIF--------------WALLLAELGLVYGISRFIDRLSLTTATLLFILYSALNGA 102

Query: 125 SLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN 184
           +LS  FL Y++  I + FFITA +FG ++ +GY TK DL  +G  +IM   GL + SLVN
Sbjct: 103 TLSVIFLAYSADVITKVFFITAGTFGVMAAFGYFTKADLTGLGKLLIMALVGLIIASLVN 162

Query: 185 -LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAY-AERQSVIGALMLYMD 242
            L ++SS+ DL +S +G+++F  LTAYD+QKIK   +   D+   A++ +++G+L LY+D
Sbjct: 163 LLLLKSSSFDLILSYIGVLVFVGLTAYDSQKIKRMLAQAEDMGEGAQKTALMGSLTLYLD 222

Query: 243 FIQIFVHLLRFLGSRR 258
           FI +F++LLR  G  R
Sbjct: 223 FINLFLYLLRIFGRER 238


>gi|254420620|ref|ZP_05034344.1| Uncharacterized protein family UPF0005, putative [Brevundimonas sp.
           BAL3]
 gi|196186797|gb|EDX81773.1| Uncharacterized protein family UPF0005, putative [Brevundimonas sp.
           BAL3]
          Length = 249

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 147/270 (54%), Gaps = 32/270 (11%)

Query: 1   MSDIRN-YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLV-NILATT-- 56
           MSD  N Y R +   +    ++D GLR +M+ VYN +ALGL V   ++++  N+ A    
Sbjct: 1   MSDFNNGYARPLPQTADM--SVDAGLRGFMLGVYNKLALGLVVAAALAYVTGNVPAVQQL 58

Query: 57  ---VDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKM 113
              V PD         V LT  G ++  SPL  +F     G   F+     + +A    +
Sbjct: 59  LFGVTPDGR-------VGLTMLGMIVQFSPLVLLF-----GSMFFM----KNPTAKGVNL 102

Query: 114 MFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMG 173
           ++    A IG  L   FL YT  S+  TF +TAA+FG LSL GYTTK+DL  +G+F+I G
Sbjct: 103 LYWAVVASIGAGLGVLFLRYTGASLASTFLVTAAAFGGLSLVGYTTKKDLTAMGTFLIFG 162

Query: 174 AFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY----SDRYDVAYAE 229
             GL +  +VN+FM+S  + L +S +G++IF+ L AYDTQ++K  Y     D+  +  A 
Sbjct: 163 VIGLIVAMIVNMFMQSGTLYLIISGLGVLIFAGLIAYDTQRLKMTYYALGGDQNAMGVAT 222

Query: 230 RQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                GAL L+++F+ +F  LL F+G  R+
Sbjct: 223 G---FGALSLFINFVNLFQFLLAFMGGNRN 249


>gi|294672963|ref|YP_003573579.1| hypothetical protein PRU_0181 [Prevotella ruminicola 23]
 gi|294472084|gb|ADE81473.1| putative membrane protein [Prevotella ruminicola 23]
          Length = 239

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 83/233 (35%), Positives = 132/233 (56%), Gaps = 19/233 (8%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A M +VY  M L L +TG+ ++               +  + G++     AL   S L W
Sbjct: 25  ALMRKVYVWMTLALVLTGVTAY--------------GVATSPGIL----TALYSNSVLLW 66

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
             + A   +   ++  ++ LS   A ++F+LYS + G   SS F+VYT  SI   FFITA
Sbjct: 67  GLVIAEFAIVFGVSAAINRLSLTTATLLFVLYSVINGALFSSIFIVYTMSSIASVFFITA 126

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
            +F  ++L GYTTK DL  +G  + M   G+ + ++VN+F++SS +++ +S +G++IF  
Sbjct: 127 GTFAVMALIGYTTKTDLSSMGKILFMALIGIIIATVVNIFLKSSGLEMIVSYLGVLIFVG 186

Query: 207 LTAYDTQKIKEAYSDRYDVAY-AERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           LTAYD+QKIK       D    A++ +++GAL LY+DFI +F++LLR  G R 
Sbjct: 187 LTAYDSQKIKNMLLMAPDAGEAAQKMALLGALTLYLDFINLFIYLLRIFGRRE 239


>gi|149277448|ref|ZP_01883589.1| membrane protein [Pedobacter sp. BAL39]
 gi|149231681|gb|EDM37059.1| membrane protein [Pedobacter sp. BAL39]
          Length = 250

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 76/183 (41%), Positives = 113/183 (61%), Gaps = 6/183 (3%)

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + L WI  FAPLG+ + ++  L  LS  A   +F+LYSAL G+SLS   L+YTS S++  
Sbjct: 68  TTLGWIATFAPLGLVLLMSAGLSRLSYTALIGVFILYSALTGVSLSFILLIYTSASVITC 127

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F   A  FG ++  GYTT  DL   G  +++G  GL + S+ N+F++S +  L M+ +G+
Sbjct: 128 FAAAAGIFGIMAFLGYTTDVDLSKFGPILMVGVVGLIIASVANMFIQSESFSLFMAFVGI 187

Query: 202 VIFSALTAYDTQKIK------EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
            IF+ALTAYD QK+K      E    +   A  ++ +++GAL LY+DF+ IF++LLR  G
Sbjct: 188 AIFTALTAYDVQKLKRIGAGLEESGAQIQDADTKKLAIMGALSLYLDFLNIFIYLLRIFG 247

Query: 256 SRR 258
            RR
Sbjct: 248 DRR 250


>gi|288800217|ref|ZP_06405675.1| membrane protein [Prevotella sp. oral taxon 299 str. F0039]
 gi|288332430|gb|EFC70910.1| membrane protein [Prevotella sp. oral taxon 299 str. F0039]
          Length = 237

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 142/233 (60%), Gaps = 19/233 (8%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A M +VY  M L L +TG+ ++ V          A+S     G++ T    L  +  L W
Sbjct: 23  ALMRKVYVWMTLALIITGVTAYGV----------ASS----PGLIYT----LTSSEYLFW 64

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
             +   LG+  F++ R+ +LS   A ++F++YS L G+++S  FLVYT  SI   FFITA
Sbjct: 65  GCLLGELGLVYFISSRIMNLSLTTATLLFIVYSILNGVTMSFIFLVYTMSSIANVFFITA 124

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
            +FG +SL GYTT+RDL  +G  ++M   GL + S+ N+FM+S  + L +S +G+V+F  
Sbjct: 125 GTFGVMSLIGYTTRRDLSKMGQLLMMALVGLIIASVANIFMKSDTLSLMVSYIGVVLFVG 184

Query: 207 LTAYDTQKIKEAYSDRYDVAY-AERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           LTA+DTQKIK   +   D+   A++ +++GAL LY+DF+ +F++LLR LG R 
Sbjct: 185 LTAWDTQKIKRMLAQADDITEDAQKIALLGALTLYLDFVNLFLYLLRLLGKRN 237


>gi|319760475|ref|YP_004124413.1| hypothetical protein BVAF_345 [Candidatus Blochmannia vafer str.
           BVAF]
 gi|318039189|gb|ADV33739.1| putative membrane protein [Candidatus Blochmannia vafer str. BVAF]
          Length = 236

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 86/236 (36%), Positives = 142/236 (60%), Gaps = 20/236 (8%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           ++ ++ +V+  M+ GL +T  +++      T+  P    ++ +  ++  G    +  S L
Sbjct: 19  IQPFISQVFGWMSCGLLLTAFVAW-----YTSKSPVVLQLLFSNQIIFFG----LVISQL 69

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
             +F+ +  G+ I LN  L       A  +F+LYS L GL+LSS F++YT+ SI  TF +
Sbjct: 70  ALVFVLS--GMVIKLNGSL-------ATTLFMLYSVLTGLTLSSVFILYTTSSISSTFLV 120

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           T+  FG+++LYGYTTKRDL   G+ ++M   G+ L SLVNL+++++AI   ++ +G+++F
Sbjct: 121 TSGMFGAMTLYGYTTKRDLSSFGNLLLMALIGIMLASLVNLWVKNTAIMWIITYVGVLVF 180

Query: 205 SALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             LTAYD QKIK   A     D     + S+IGAL LY+DFI +F+ ++R  G+RR
Sbjct: 181 VGLTAYDMQKIKSIGASLSIEDQDQFRKYSIIGALTLYLDFINLFLMMVRIFGNRR 236


>gi|33519803|ref|NP_878635.1| putative permease [Candidatus Blochmannia floridanus]
 gi|33504148|emb|CAD83410.1| integral membrane protein interacts with FtsH [Candidatus
           Blochmannia floridanus]
          Length = 236

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 81/236 (34%), Positives = 138/236 (58%), Gaps = 20/236 (8%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           ++ Y+ +V+  M+ GL +T  +++      T++ P    ++ +  ++  G          
Sbjct: 19  IQPYISQVFGWMSCGLLLTAFVAW-----YTSITPAVLQLLFSNQIIFFGL--------- 64

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
               I + L +   L+  +  LS   A  +F+LYS L GL+LSS F++YTS SI  TF +
Sbjct: 65  ----IISQLALVFTLSGMVTRLSGSLATTLFMLYSVLTGLTLSSIFILYTSSSISGTFIV 120

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           T+  FG++++YGYTTK+DL  +G+ + MG  G+ L SLVN+++++  I   ++ +G+++F
Sbjct: 121 TSGMFGAMTVYGYTTKKDLSSLGNLLFMGLIGMVLASLVNIWLKNPTIMWIITYIGVILF 180

Query: 205 SALTAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             LTAYD QKIK   S     D     + S+IGAL LY+DFI +F+ ++R  G++R
Sbjct: 181 VGLTAYDMQKIKSIGSSLSIEDQDQFRKYSIIGALTLYLDFINLFMMMIRIFGNKR 236


>gi|295133948|ref|YP_003584624.1| hypothetical protein ZPR_2103 [Zunongwangia profunda SM-A87]
 gi|294981963|gb|ADF52428.1| membrane protein [Zunongwangia profunda SM-A87]
          Length = 242

 Score =  135 bits (341), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 84/241 (34%), Positives = 132/241 (54%), Gaps = 19/241 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + + QG  AY+ +V+N M L L +TG+ +F           +  ++I +  ++  G    
Sbjct: 20  AQLKQGQTAYINKVFNWMCLALLITGVTAFF-----AAGSQELMNLIFSNKLVFYGL--- 71

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
                     +   + +  ++   +  LS   A  +F+LYS L G++LS   LV+TS SI
Sbjct: 72  ----------LIGEVLLVGYIGANIQKLSTATATALFILYSVLNGVTLSFILLVFTSASI 121

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
             TFF+TA +FG++S YGY TKRDL  IG+   M   G+ + S+VN+F  +  +   ++ 
Sbjct: 122 ATTFFVTAGTFGAMSAYGYFTKRDLTSIGNLCFMALIGIIIASIVNIFFFNEILYWVITY 181

Query: 199 MGLVIFSALTAYDTQKIKEAY-SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            G++IF  LTAYDTQKIK  Y +   D       +++GAL LY+DFI +F+ LLR  G R
Sbjct: 182 AGVLIFVGLTAYDTQKIKRMYRAGMEDSDIGHNLALMGALRLYLDFINMFLFLLRIFGDR 241

Query: 258 R 258
           +
Sbjct: 242 K 242


>gi|115379432|ref|ZP_01466533.1| stationary phase anti-death Family (SAD), acetate uptake
           [Stigmatella aurantiaca DW4/3-1]
 gi|115363571|gb|EAU62705.1| stationary phase anti-death Family (SAD), acetate uptake
           [Stigmatella aurantiaca DW4/3-1]
          Length = 208

 Score =  135 bits (340), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 118/199 (59%), Gaps = 10/199 (5%)

Query: 69  GVMLTGFGALMYTSP-------LRWI--FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
           G+MLTG  AL   S        L+W    + A LGV + L+     LS   A  +FL YS
Sbjct: 11  GLMLTGVTALYTVSNEALLNQVLQWRMGLLLAELGVVLALSFLAPRLSGPVAAALFLGYS 70

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           AL G++LS +FL+YT+ SI Q   +T   FG+LSLYG  TK+DL    +F+ MG  G+ L
Sbjct: 71  ALTGMTLSIYFLIYTAGSIGQALLLTGGVFGALSLYGTLTKKDLSAWAAFLFMGLVGVLL 130

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
             + N+F+RS  +    +   +++F+ LTAYDTQK+++ ++     + A   SV+GAL L
Sbjct: 131 AGVANIFIRSEGMSFVTACACVIVFAGLTAYDTQKLRQMHAAT-GYSSAATISVVGALTL 189

Query: 240 YMDFIQIFVHLLRFLGSRR 258
           Y+DFI +F+ LLR  G RR
Sbjct: 190 YLDFINLFLALLRLFGRRR 208


>gi|303241028|ref|ZP_07327538.1| protein of unknown function UPF0005 [Acetivibrio cellulolyticus
           CD2]
 gi|302591453|gb|EFL61191.1| protein of unknown function UPF0005 [Acetivibrio cellulolyticus
           CD2]
          Length = 234

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 136/254 (53%), Gaps = 28/254 (11%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           NY   ++  S   S         M RV+  M +GL VTG+ +     L T   P    II
Sbjct: 8   NYDNAIDRKSALASQ--------MARVFGWMFIGLMVTGLTA-----LFTATSPAMLRII 54

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                  T FG ++      W           F++ R   +    A   F+LYS L GL+
Sbjct: 55  YTG--RFTIFGLMILELVFVW-----------FISSRAMKMEYGVAAAAFILYSILNGLT 101

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LSS F  YT KSI   FF++A  FG +S+YG  TK DL  +GS  IMG  GL ++S+VN+
Sbjct: 102 LSSIFFAYTFKSIALAFFMSAGFFGFMSVYGMITKTDLTSLGSLFIMGLVGLIIVSIVNI 161

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQ-SVIGALMLYMDFI 244
           F+ +  +   +S +G+ IF  LTAYD+QKIK+  S R+     ER  +++GAL+LY+DFI
Sbjct: 162 FLHNPTLYWIISFVGVAIFLGLTAYDSQKIKDI-SIRFTGTEKERNVAIVGALILYLDFI 220

Query: 245 QIFVHLLRFLGSRR 258
            +F+++LR LG R+
Sbjct: 221 NLFLYILRILGKRK 234


>gi|332662975|ref|YP_004445763.1| hypothetical protein Halhy_0991 [Haliscomenobacter hydrossis DSM
           1100]
 gi|332331789|gb|AEE48890.1| protein of unknown function UPF0005 [Haliscomenobacter hydrossis
           DSM 1100]
          Length = 235

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 86/235 (36%), Positives = 131/235 (55%), Gaps = 25/235 (10%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           +M +V+  M++ L +TG++++ V     +  P     +                   R+I
Sbjct: 22  FMTKVFGWMSVALAITGVVAYFV-----SNSPQILQFVFGN----------------RFI 60

Query: 88  FIFAPLGVFI---FLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
           F    +G  +   +L+  +  +SA  A M+FLLYS L GL+LS  FL+YTS SI  TF I
Sbjct: 61  FFGLLIGELLLVGYLSAAVMRMSADMATMVFLLYSVLNGLTLSFVFLIYTSTSIAGTFLI 120

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TA +F ++S YGY TK DL   GS + M   GL + S+VN+F+RS  +   ++  G++IF
Sbjct: 121 TAGTFAAMSAYGYFTKNDLTKAGSLLFMALIGLVIASIVNIFLRSPLMYWIITYAGILIF 180

Query: 205 SALTAYDTQKIKE-AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             LTAYDTQKIK              +++++GAL LY+DFI +F+ LLR  G+R+
Sbjct: 181 VGLTAYDTQKIKNMNIIGNEGTEEDHKEAIMGALTLYLDFINLFIMLLRLFGNRK 235


>gi|300726238|ref|ZP_07059691.1| membrane protein [Prevotella bryantii B14]
 gi|299776435|gb|EFI72992.1| membrane protein [Prevotella bryantii B14]
          Length = 238

 Score =  135 bits (339), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 84/256 (32%), Positives = 140/256 (54%), Gaps = 22/256 (8%)

Query: 5   RNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASI 64
           +   R++N  S     +     A M +VY  M L L +T + ++          P   + 
Sbjct: 4   KELYRMINERSW---NVSLAFPALMRKVYIWMTLALVITAVTAY-----GVATSPALMTT 55

Query: 65  IINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGL 124
           I    ++  G              I A L +   ++  ++ LS   A +MF+ YS + G 
Sbjct: 56  IFTNKILFFGL-------------IIAELALVWGISGAINRLSLATATLMFIAYSVINGA 102

Query: 125 SLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN 184
           +LS  F  +++ +IV+TF +TA +FG++SL GY TK+DL  +G  + M   G+ + ++VN
Sbjct: 103 TLSVIFAAFSTTAIVKTFVVTAGTFGTMSLVGYFTKKDLTSMGKLLFMALIGIIIATIVN 162

Query: 185 LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYA-ERQSVIGALMLYMDF 243
           +F+ SS +DL +S +G++IF  LTAYDTQKIK   S   D +   ++ +++G+L LY+DF
Sbjct: 163 MFIASSGLDLIISYLGVLIFVGLTAYDTQKIKHMLSMAPDASEQMQKYALLGSLTLYLDF 222

Query: 244 IQIFVHLLRFLGSRRD 259
           I +F++LLR  GS R+
Sbjct: 223 INLFLYLLRIFGSNRN 238


>gi|167471049|ref|ZP_02335753.1| hypothetical protein YpesF_25027 [Yersinia pestis FV-1]
          Length = 223

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 89/233 (38%), Positives = 134/233 (57%), Gaps = 23/233 (9%)

Query: 18  GSTIDQ---GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           GS +++   G++AYM +VY  M  GL +T ++++           +  SII         
Sbjct: 9   GSIVERAGSGIQAYMAQVYGWMTCGLLLTAVVAWYA--------ANTPSIIF-------- 52

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
             AL     L +  I A LG+   ++  ++ LS  AA  +F+LYSAL GL+LSS  ++YT
Sbjct: 53  --ALQSNQILFFGLIIAQLGLVFVISGMVNRLSGTAATSLFMLYSALTGLTLSSILIMYT 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI  TF I A  FG++S YGYTTKRDL  +GS + MG  G+ L SLVN++++S A+  
Sbjct: 111 GASIASTFVICAGMFGAMSFYGYTTKRDLSGMGSMLFMGLIGIILASLVNIWLKSPALMW 170

Query: 195 TMSAMGLVIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQ 245
            ++ +G+++F  LTAYDTQK+K   A  D  +     + S++GA   Y+DFI 
Sbjct: 171 VVTYIGVLVFVGLTAYDTQKLKNLGAQLDVNEKDSFRKCSLVGASTGYLDFIN 223


>gi|323343961|ref|ZP_08084188.1| protein of hypothetical function UPF0005 [Prevotella oralis ATCC
           33269]
 gi|323095780|gb|EFZ38354.1| protein of hypothetical function UPF0005 [Prevotella oralis ATCC
           33269]
          Length = 238

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 85/258 (32%), Positives = 143/258 (55%), Gaps = 22/258 (8%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           +    ++V+    G   ++     A M +VY  M + L +TG+ ++         +    
Sbjct: 2   NAEELEKVIREKEG---SMSLAFPALMRKVYVWMTMALVITGLTAY-----GVASNTQLM 53

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
             I +  V L G              I A L +   ++  ++ LS   A ++F+LYSA  
Sbjct: 54  MAIWSHQVFLFGL-------------IIAELAMVFAISAAINRLSLTMATLLFILYSAFN 100

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G++LS+ F+VY+   I + FFITA +FG+++ YGY TKRDL  IG  + M   GL + ++
Sbjct: 101 GVTLSAIFVVYSPVIITKVFFITAGTFGAMAAYGYFTKRDLTSIGRLLFMALIGLIIATV 160

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDV-AYAERQSVIGALMLYM 241
           VNLF++S+A DL +S +G+++F  LTA+D+QKIK   + +  +   A + +++GAL LY+
Sbjct: 161 VNLFLKSAAFDLILSYIGVLVFVGLTAWDSQKIKRMLAMQTSMDENAMKIALLGALSLYL 220

Query: 242 DFIQIFVHLLRFLGSRRD 259
           DFI +F++LLR  G   +
Sbjct: 221 DFINLFLYLLRIFGRSNN 238


>gi|257457384|ref|ZP_05622555.1| inner membrane protein YbhL [Treponema vincentii ATCC 35580]
 gi|257445306|gb|EEV20378.1| inner membrane protein YbhL [Treponema vincentii ATCC 35580]
          Length = 239

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 134/237 (56%), Gaps = 30/237 (12%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLV---NILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           ++  VY  M   L ++GI +F V   N LAT +                 FG+       
Sbjct: 27  FITAVYGWMVAALAISGIAAFAVFNSNALATFI-----------------FGS------- 62

Query: 85  RWIF---IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           R+ F   I A   + + L+  +  +S  AA   F++YS + GL+LSS   VYT  SIV+ 
Sbjct: 63  RFTFMGLIIAEFALVVILSAGIRKMSFAAAAASFVIYSIINGLTLSSVLFVYTGTSIVRI 122

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F ITA  FG++S+YG TTK +L   G +++M   GL + SLVN+FMRSS++D  +S + +
Sbjct: 123 FVITALMFGAMSIYGATTKNNLQSAGKYLMMAVIGLIIASLVNIFMRSSSLDWLISFVTV 182

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            +F+ LTAYDTQKI EA     +    ++ ++IGAL LY+DF+ IF+ LLR  G RR
Sbjct: 183 GVFTGLTAYDTQKITEAARYAQNNEGFKKVAIIGALELYLDFVNIFLSLLRLFGKRR 239


>gi|162147821|ref|YP_001602282.1| hypothetical protein GDI_2037 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161786398|emb|CAP55980.1| putative membrane protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 210

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 130/211 (61%), Gaps = 17/211 (8%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA- 61
           D R   R   +G+  G+ IDQGLRAYM+RVYN MA GL +TG +++LV   A T    A 
Sbjct: 6   DFRTMTRPAGAGTDAGA-IDQGLRAYMLRVYNWMASGLVLTGTVAYLV---ANTSLRAAF 61

Query: 62  -ASIIINRGVML--TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
            A+++   GV +  TG G L          + APLG  + +++ ++ LS  A + +F L+
Sbjct: 62  FAAVMTPSGVAVRPTGLGMLA---------MIAPLGFVLVMSLGVNRLSRQAVQALFWLF 112

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
            A++G SLSS  L +T  S+V+ FF+TA +F ++S++GY T+ DL   GSF++MG FGL 
Sbjct: 113 CAVMGASLSSILLTFTGVSVVRVFFVTAGTFSAMSIWGYVTRTDLTRFGSFLLMGLFGLV 172

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTA 209
           +  LVN+F+ SSA+ +  S +G+ IF  L A
Sbjct: 173 IAGLVNMFLHSSALYMLYSVVGVFIFVGLAA 203


>gi|302337819|ref|YP_003803025.1| protein of unknown function UPF0005 [Spirochaeta smaragdinae DSM
           11293]
 gi|301635004|gb|ADK80431.1| protein of unknown function UPF0005 [Spirochaeta smaragdinae DSM
           11293]
          Length = 234

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 71/163 (43%), Positives = 107/163 (65%), Gaps = 3/163 (1%)

Query: 99  LNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYT 158
           L+ R++ +SA +A + F  Y+ L G++LS  FL YT ++I   FF TAA+FG +SL+  T
Sbjct: 72  LSARINKMSASSATLAFAGYAVLNGITLSIVFLAYTGQTIALAFFTTAATFGGMSLWALT 131

Query: 159 TKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE- 217
           TKRDL  +G +++MG +G+ + +L+N F++S  +   +S +G+ +F  LTAYDTQ IK  
Sbjct: 132 TKRDLSGLGHYLMMGLWGVLIATLINFFLKSPTVYYMISYIGIAVFLGLTAYDTQIIKRW 191

Query: 218 --AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             AY +  D     + S++GAL LY+DFI IF+ LLR  G RR
Sbjct: 192 NAAYGNSVDEEGYVKISIMGALKLYLDFINIFLFLLRIFGRRR 234


>gi|313203021|ref|YP_004041678.1| hypothetical protein Palpr_0534 [Paludibacter propionicigenes WB4]
 gi|312442337|gb|ADQ78693.1| protein of unknown function UPF0005 [Paludibacter propionicigenes
           WB4]
          Length = 232

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 84/234 (35%), Positives = 135/234 (57%), Gaps = 19/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           + + +RVY+ M++ L +TG++++      T   P+  S+I   G     +G ++    L 
Sbjct: 17  KRFFVRVYSWMSMALIITGLVAY-----RTANSPEILSLIF--GERFVFYGLMILELVLV 69

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            + + A           ++ +SA  A ++F+LYS L G++LS+ F V+T+ SI   FFI 
Sbjct: 70  GVLVGA-----------INKMSAITATIVFILYSVLNGVTLSAIFFVFTADSIANVFFIA 118

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F ++S YGY TK DL  IG+ + M   GL + SLVN+F++S  +    S  G++IF 
Sbjct: 119 AGTFAAMSAYGYFTKSDLTKIGNILFMALIGLVIASLVNMFLKSEMLYWISSYAGVLIFV 178

Query: 206 ALTAYDTQKIKE-AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            L AYDTQK+K+       D    ++ ++IGAL LY+DFI +F++LLR  G RR
Sbjct: 179 GLIAYDTQKLKKLNIIGNEDTDEGKKVAIIGALTLYLDFINLFLYLLRIFGKRR 232


>gi|288929422|ref|ZP_06423267.1| membrane protein [Prevotella sp. oral taxon 317 str. F0108]
 gi|288329524|gb|EFC68110.1| membrane protein [Prevotella sp. oral taxon 317 str. F0108]
          Length = 238

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 85/256 (33%), Positives = 145/256 (56%), Gaps = 23/256 (8%)

Query: 5   RNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASI 64
           +++ R++    G    +     A M +VY  M L L +TG+ ++ V           + +
Sbjct: 4   QDFDRLIREKEG---ALSLAFPALMRKVYVWMTLALIITGVTAYGVA---------HSEV 51

Query: 65  IINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGL 124
           +I++         +  +  +  + I A L +   ++  ++ LS   A ++F+LYSAL G 
Sbjct: 52  LISQ---------MFESRAVFMVLIIAELALVFGISRFINRLSLTTATLLFILYSALNGA 102

Query: 125 SLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN 184
           +LS  FL Y++  I +TFFITA +FG+++L+GY TK DL  +G  ++M   G+ + S+ N
Sbjct: 103 TLSVIFLAYSASVITKTFFITAGTFGTMALFGYFTKADLSGLGKILLMALVGIIIASIAN 162

Query: 185 -LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDV-AYAERQSVIGALMLYMD 242
            LF +S   DL +S +G+++F  LTAYD+QKIKE      D    A++ +++G+L LY+D
Sbjct: 163 LLFFKSGMFDLIVSYIGVLVFVGLTAYDSQKIKEMLMRAEDADENAQKMALMGSLTLYLD 222

Query: 243 FIQIFVHLLRFLGSRR 258
           FI +F++LLR  G  R
Sbjct: 223 FINLFLYLLRIFGRER 238


>gi|71892121|ref|YP_277853.1| putative transport protein [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
 gi|71796227|gb|AAZ40978.1| putative transport protein [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
          Length = 236

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 146/257 (56%), Gaps = 27/257 (10%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
            + R  N+ S     ++  ++ Y+++V+  M+ GL +T  +++       +  P    ++
Sbjct: 3   QFPRFQNTAS---EQVNNAIQPYILQVFGWMSCGLLLTAFVAWYA-----SRTPAILQLL 54

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
            +  ++   F +L          I   L +   L+  +  LS   A  +F+LYS L GL+
Sbjct: 55  FSNQII---FFSL----------IIGQLALVFVLSGMVTRLSGSLATTLFMLYSMLTGLT 101

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LSS F++YT+ SI   F +T+  FG+++LYGYTTKRDL   G+ + M   G+ L S+VNL
Sbjct: 102 LSSVFILYTTSSISSAFVVTSGMFGAMTLYGYTTKRDLSSFGNLLFMALIGIVLASMVNL 161

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYS----DRYDVAYAERQSVIGALMLYM 241
           +++++A+   ++ +G++IF  LTAYDTQK+K   +    D  D     + S+IGAL LY+
Sbjct: 162 WLKNTALMWLITYIGVIIFVGLTAYDTQKLKSIGASLSIDNQD--QFRKYSIIGALTLYL 219

Query: 242 DFIQIFVHLLRFLGSRR 258
           DFI +F+ ++R  G+RR
Sbjct: 220 DFINLFLMIVRIFGNRR 236


>gi|258649258|ref|ZP_05736727.1| membrane protein [Prevotella tannerae ATCC 51259]
 gi|260850443|gb|EEX70312.1| membrane protein [Prevotella tannerae ATCC 51259]
          Length = 236

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 139/261 (53%), Gaps = 32/261 (12%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA 61
            ++ NY    +  + F         A M  VY  MAL L +TG+M+  V        P  
Sbjct: 4   KNVVNYTSTASRPAAFA--------ALMRDVYAWMALALSLTGLMAMFV-----VQQPQL 50

Query: 62  ASIII-NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
             +I  NR V    +G L+           A +G+ ++L+  L  +S   A ++F+LYS 
Sbjct: 51  VQLIFANRFVF---YGLLL-----------AEVGLVMYLSACLMEMSFAKAGILFVLYSI 96

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L G +LS  F VYT++SI  TFF+TA  FG+L+L G   KRDL   G F+ M   GL + 
Sbjct: 97  LNGATLSCVFFVYTTESIAVTFFVTAGMFGALALLGTFIKRDLSSFGRFLYMALIGLIIA 156

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGAL 237
           S+VNLF  SS +    +  G+ IF  LT YDT+KI+E    Y +  +   + + ++IG+L
Sbjct: 157 SVVNLFFASSTLYWITTYAGVFIFIGLTVYDTKKIRELLYLYGEERN-EESMKMALIGSL 215

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY+DFI +F++LLR  G RR
Sbjct: 216 QLYLDFINLFLYLLRIFGRRR 236


>gi|302345908|ref|YP_003814261.1| hypothetical protein HMPREF0659_A6203 [Prevotella melaninogenica
           ATCC 25845]
 gi|302149169|gb|ADK95431.1| putative membrane protein [Prevotella melaninogenica ATCC 25845]
          Length = 240

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 82/232 (35%), Positives = 142/232 (61%), Gaps = 19/232 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M +VY  MA+ L +TG++++           ++ ++I    ++  G G L+         
Sbjct: 27  MRKVYVWMAMALAITGVIAYGAG--------NSPALI---QLLYMGRGPLLVAG------ 69

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
               +G+  +L+ R+  LS  AA + F+ ++AL GL+L   F  ++S +I +TFFITA +
Sbjct: 70  -LVEVGIVWYLSSRIDRLSLVAATVWFIAFAALNGLTLGWIFAAFSSAAIAKTFFITAGT 128

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG+++L G TTK+DL  +G  + M   GL +  LVN+F++S+  DL +S +G+++F+ LT
Sbjct: 129 FGAMALIGSTTKKDLTKMGGILFMALIGLIIAGLVNIFLKSTMFDLIVSGIGVLVFTGLT 188

Query: 209 AYDTQKIKEAYSDRYDVAY-AERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           A+D QKIK+      D    A++ +++G+L LY+DFI +F++LLRFLG+ R+
Sbjct: 189 AWDAQKIKQNLRMAPDAGEGAQKVALLGSLSLYLDFINLFLYLLRFLGNNRN 240


>gi|288803983|ref|ZP_06409405.1| membrane protein [Prevotella melaninogenica D18]
 gi|288333553|gb|EFC72006.1| membrane protein [Prevotella melaninogenica D18]
          Length = 232

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 83/232 (35%), Positives = 141/232 (60%), Gaps = 19/232 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M +VY  MA+ L +TG++++           ++ ++I     +  G G L+         
Sbjct: 19  MRKVYVWMAMALAITGVIAYGAG--------NSPALI---QFLYMGRGPLLVAG------ 61

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
               +G+  +L+ R+  LS  AA + F+ ++AL GL+L   F  ++S +I +TFFITA +
Sbjct: 62  -LVEVGIVWYLSSRIDRLSLVAATIWFIAFAALNGLTLGWIFAAFSSAAIAKTFFITAGT 120

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG+++L G TTK+DL  +G  + M   GL +  LVN+F++SS  DL +S +G+++F+ LT
Sbjct: 121 FGAMALIGSTTKKDLTKMGGILFMALIGLIIAGLVNIFLKSSMFDLIVSGIGVLVFTGLT 180

Query: 209 AYDTQKIKEAYSDRYDVAY-AERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           A+D QKIK+      D    A++ +++G+L LY+DFI +F++LLRFLG+ R+
Sbjct: 181 AWDAQKIKQNLRMAPDAGEGAQKVALLGSLSLYLDFINLFLYLLRFLGNNRN 232


>gi|77917917|ref|YP_355732.1| hypothetical protein Pcar_0302 [Pelobacter carbinolicus DSM 2380]
 gi|77544000|gb|ABA87562.1| hypothetical protein Pcar_0302 [Pelobacter carbinolicus DSM 2380]
          Length = 234

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 87/224 (38%), Positives = 128/224 (57%), Gaps = 25/224 (11%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
            A+  +VYN MA GL V+ I++ L               + +R +M   FG        R
Sbjct: 19  EAFFPKVYNWMAAGLAVSAIVALLT--------------VYSRTMMQLVFGN-------R 57

Query: 86  WIF---IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
            +F   + A L + + L+  +  LSA AA   FLLYSAL G++L++ F++YT  SI  TF
Sbjct: 58  LVFYGLLIAELLLVVTLSGAIRRLSAAAATGFFLLYSALSGVTLAAIFVLYTQSSIASTF 117

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA +FG++S+YG+ T+RDL   GSF+ MG  G  L S+VN+FM+S  I    +  G++
Sbjct: 118 LVTAGTFGAMSIYGHVTRRDLTSWGSFLFMGLIGFLLASVVNIFMQSEMIYWVSTYCGIL 177

Query: 203 IFSALTAYDTQKIKE-AYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           IF  LTAYDTQK+K  A     +     + +++GAL LY+DFI 
Sbjct: 178 IFVGLTAYDTQKLKVLAMGGFANGEERHKMAILGALRLYLDFIN 221


>gi|304382498|ref|ZP_07364993.1| protein of hypothetical function UPF0005 [Prevotella marshii DSM
           16973]
 gi|304336329|gb|EFM02570.1| protein of hypothetical function UPF0005 [Prevotella marshii DSM
           16973]
          Length = 237

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 90/234 (38%), Positives = 137/234 (58%), Gaps = 21/234 (8%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP-LR 85
           A M +VY  M+L L +TGI ++          P           ++T F    YT+  L 
Sbjct: 23  ALMRKVYVWMSLALIITGITAY-----GVASSPG----------LITAF----YTNQMLM 63

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           W  + A   +   L+  L+ LS   A ++F++YS L G+  SS FLVYT  S+   FFIT
Sbjct: 64  WGVVIAEFALVFALSAALNRLSLSVATLLFVVYSVLNGVMFSSIFLVYTMSSVANVFFIT 123

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F +++ YGY TK DL  +G ++ M   GL + ++VN+F+ SS + L +S  G++IF 
Sbjct: 124 AGTFAAMAAYGYFTKSDLTTLGKYLFMALIGLVIATVVNIFVGSSMLSLVISYAGVLIFV 183

Query: 206 ALTAYDTQKIKEAYSDRYDV-AYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            LTAYD+QKIK+  + + D    A++ ++ GAL LY+DFI +F++LLR LG+RR
Sbjct: 184 GLTAYDSQKIKQMLAQQVDADETAQKVALFGALTLYLDFINLFLYLLRLLGNRR 237


>gi|329847494|ref|ZP_08262522.1| hypothetical UPF0005 family protein [Asticcacaulis biprosthecum
           C19]
 gi|328842557|gb|EGF92126.1| hypothetical UPF0005 family protein [Asticcacaulis biprosthecum
           C19]
          Length = 247

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 141/242 (58%), Gaps = 19/242 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GLR +M+ VY  +A+GL VTG ++++++ +    D       + +G  +T     M  
Sbjct: 20  DMGLRNFMLGVYAKLAMGLLVTGTLAWVISNVPAVRD----YFFVMQGDRVTNL--TMLG 73

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
              RW    APL V I   + + + S   + +++     LIG+S + +FL+Y    I   
Sbjct: 74  QIARW----APL-VIILATMFIRTFSPATSGLLYWTIVTLIGVSGAMWFLIYQLGDIANI 128

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMG 200
           FFITA++FG+LSLYGYTTKR+L   G F+ MGA+G+F+L L N LF ++    + ++A+G
Sbjct: 129 FFITASAFGALSLYGYTTKRNLSGWGIFLFMGAWGVFILMLGNALFFQNELFRVAIAAIG 188

Query: 201 LVIFSALTAYDTQKIKEAY----SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           ++IF+A TA+DTQ +K +Y     ++  +A A     IGAL  Y++FI +F  LL   G 
Sbjct: 189 VLIFAAFTAFDTQNLKMSYYQIGGNQTAMAVATN---IGALNFYLNFINMFQLLLSIFGG 245

Query: 257 RR 258
           RR
Sbjct: 246 RR 247


>gi|229496385|ref|ZP_04390102.1| inner membrane protein YbhL [Porphyromonas endodontalis ATCC 35406]
 gi|229316704|gb|EEN82620.1| inner membrane protein YbhL [Porphyromonas endodontalis ATCC 35406]
          Length = 248

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 83/231 (35%), Positives = 131/231 (56%), Gaps = 21/231 (9%)

Query: 31  RVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIF 90
           +V+  MA  LG+T + +FLV     + +    +I++NR +M              W    
Sbjct: 35  KVFYWMAGALGLTALTAFLVY----SSESMMMTILMNRWLM--------------WGLFI 76

Query: 91  APLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFG 150
           A LG+ + L+  +H +S   A +M  +YS L G++LS  FLVYT  SI   F I+A  F 
Sbjct: 77  AELGLVMGLSAAIHKVSFSTAVLMMAVYSVLNGVTLSVIFLVYTYSSIAMAFVISAGMFA 136

Query: 151 SLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAY 210
            +++ G  TKRDL    S ++M   GL + S+VNLF+ SS ++  +S +G+V+F+ LT Y
Sbjct: 137 VMAIVGTVTKRDLSSWRSILLMALVGLIIASVVNLFLHSSTMEWIISLVGVVLFAILTVY 196

Query: 211 DTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           DTQKI+    ++  +   E   + +++G+L LY+DFI IF+ +LR LG  R
Sbjct: 197 DTQKIRRLLIEKNGLVSEEGMHKIALLGSLELYLDFINIFLFVLRLLGGNR 247


>gi|86160399|ref|YP_467184.1| hypothetical protein Adeh_3983 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85776910|gb|ABC83747.1| protein of unknown function UPF0005 [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 236

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 90/233 (38%), Positives = 128/233 (54%), Gaps = 21/233 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R +M  VY  M LGLGVT     LV     + +    +I+ NR ++  G           
Sbjct: 25  RRFMSAVYRWMTLGLGVTA----LVATAVASSETLLLAIVGNR-ILFYGL---------- 69

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
              + A L + I+++  ++ L A AA  +FLLYSAL G +LS   LVYT  S+   F  T
Sbjct: 70  ---VIAELALVIWISAAVNRLPAVAAGGLFLLYSALNGATLSVVLLVYTGASVGIAFLTT 126

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F ++S+YG  T+RDL   GSF+ MG  G+ + SL NLF RS  +   +S  G+++F+
Sbjct: 127 AGTFAAMSVYGTVTRRDLTGWGSFLFMGLIGIVIASLANLFFRSDMVSWVVSCAGVLVFT 186

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            LTAYDTQK++           A    V GAL LY+DF+ +F+ LLR  G+RR
Sbjct: 187 GLTAYDTQKLRAYAR---AGGGAAAAPVSGALSLYLDFVNLFLSLLRLFGNRR 236


>gi|320334405|ref|YP_004171116.1| hypothetical protein Deima_1803 [Deinococcus maricopensis DSM
           21211]
 gi|319755694|gb|ADV67451.1| protein of unknown function UPF0005 [Deinococcus maricopensis DSM
           21211]
          Length = 230

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 133/234 (56%), Gaps = 22/234 (9%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           +R+++ R Y+ M  GL +T  +++ V       +PD    I   G +L          PL
Sbjct: 17  VRSFIGRTYSWMTAGLALTAAIAYFVG-----RNPDLMVSIGRSGFLL----------PL 61

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
                   LG+ +FL+     +SA  A ++F+ YSA+ GL+    F  YT+  +   F  
Sbjct: 62  ------VQLGIVMFLSFLAPRVSATVAGLLFMAYSAVTGLTFGVIFQFYTASDVTAAFLT 115

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TA +FG++S +G+ T+R+L P+G+F++    GL + S+VN+F+  S ++L +SA+G+++F
Sbjct: 116 TAGTFGAMSAFGFLTRRNLAPMGTFLMFALIGLIIASIVNIFIGGSTLNLIISAVGVLLF 175

Query: 205 SALTAYDTQKIKE-AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + LTAYDTQ ++  A     D    E+ ++ GAL LY++FI +F+ +LR   SR
Sbjct: 176 AGLTAYDTQMLRNMALQGFGDAHTQEKGAIYGALTLYLNFINMFLFILRLFSSR 229


>gi|197124477|ref|YP_002136428.1| hypothetical protein AnaeK_4095 [Anaeromyxobacter sp. K]
 gi|196174326|gb|ACG75299.1| protein of unknown function UPF0005 [Anaeromyxobacter sp. K]
          Length = 236

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 90/233 (38%), Positives = 128/233 (54%), Gaps = 21/233 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R +M  VY  M LGLGVT     LV     + +    +I+ NR ++  G           
Sbjct: 25  RRFMSAVYRWMTLGLGVTA----LVATAVASSETLLLAIVGNR-ILFYGL---------- 69

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
              I A L + I+++  ++ L A AA  +FLLYSA+ G +LS   LVYT  S+   F  T
Sbjct: 70  ---ILAELALVIWISAAVNRLPAAAAGGLFLLYSAINGATLSVVLLVYTGASVGIAFLTT 126

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F ++S+YG  T+RDL   GSF+ MG  G+ + SL NLF RS  +   +S  G+++F+
Sbjct: 127 AGTFAAMSVYGTVTRRDLTGWGSFLFMGLIGIVIASLANLFFRSDMVSWVVSCAGVLVFT 186

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            LTAYDTQK++           A    V GAL LY+DF+ +F+ LLR  G+RR
Sbjct: 187 GLTAYDTQKLRAYAR---AGGGAAAAPVSGALSLYLDFVNLFLSLLRLFGNRR 236


>gi|15805918|ref|NP_294617.1| hypothetical protein DR_0893 [Deinococcus radiodurans R1]
 gi|15214376|sp|Q9RVX8|Y893_DEIRA RecName: Full=Uncharacterized protein DR_0893
 gi|6458614|gb|AAF10471.1|AE001942_3 conserved hypothetical protein [Deinococcus radiodurans R1]
          Length = 231

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 84/241 (34%), Positives = 131/241 (54%), Gaps = 23/241 (9%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
            T+DQ +R +M R Y+ MA GL +T  +++L      T   +               G  
Sbjct: 14  KTLDQ-VRTFMARTYSWMAAGLALTAGVAYL------TAQNE---------------GLA 51

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           M  + LR   + A L +   L++    LSA  A  +F+ Y+AL GL+ S+    Y+  ++
Sbjct: 52  MQVASLRLPLMLAQLALVFVLSMFAQRLSAAVAGALFVGYAALTGLTFSALLFAYSPAAV 111

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F ++A +FG +S+ G+  K+DL  +G F +    GL +  LVNLF+ SSA+ L +S 
Sbjct: 112 ITAFAVSAGTFGLMSVAGFVIKKDLSAMGRFFLFAVLGLVVAMLVNLFVGSSALSLGISM 171

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +G+ +F+ LTAYDTQ ++           AER S+ GAL LY+DFI IF+ LL  +G+ R
Sbjct: 172 IGVFLFAGLTAYDTQMLRNLALSGISGEQAERASINGALALYLDFINIFLFLLN-IGNSR 230

Query: 259 D 259
           D
Sbjct: 231 D 231


>gi|317504064|ref|ZP_07962067.1| protein of hypothetical function UPF0005 [Prevotella salivae DSM
           15606]
 gi|315664806|gb|EFV04470.1| protein of hypothetical function UPF0005 [Prevotella salivae DSM
           15606]
          Length = 265

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 99/150 (66%), Gaps = 1/150 (0%)

Query: 110 AAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSF 169
           A  +MF LYS L G  LS  F+VY   +I++TFFITA  F S + YGY TK+DL   G F
Sbjct: 116 ATTLMFALYSVLTGAILSFIFVVYAPTAIIKTFFITAGMFVSTAAYGYFTKKDLSNWGGF 175

Query: 170 MIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE 229
           + M   GL L  +VN+F++SS++D  +S +G+++F  LT +D+Q IK   ++  DV+ A 
Sbjct: 176 LTMALLGLILALVVNMFLKSSSLDYIISIVGVIVFVGLTIWDSQTIKRQLAEMPDVSEAS 235

Query: 230 RQ-SVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++ +V GAL LY+DFI +F++LLR  G  R
Sbjct: 236 QKLAVCGALSLYLDFINLFLYLLRIFGRDR 265


>gi|254292462|ref|YP_003058485.1| hypothetical protein Hbal_0086 [Hirschia baltica ATCC 49814]
 gi|254040993|gb|ACT57788.1| protein of unknown function UPF0005 [Hirschia baltica ATCC 49814]
          Length = 244

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/266 (31%), Positives = 146/266 (54%), Gaps = 32/266 (12%)

Query: 4   IRNYQRVVNSGSGFGS-TIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           + N+    N+G+G    ++D GLR++M+ +YN MALGL ++ +++ +V  +     P   
Sbjct: 1   MSNFPYSQNAGAGAADMSVDAGLRSFMLGIYNKMALGLVISAVLAMVVGTV-----PAVT 55

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
           ++++               +PL ++  F PL +    +  + + S     +++    AL+
Sbjct: 56  AVVLG--------------TPLYYVVAFGPLAILFGSSFMMKNPSPTGTAVVYWSVVALL 101

Query: 123 GLSLSSFFLVYTS-----KSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           G+ + +    Y        ++ + FF+TA +FG LSL+GYTTK+DL   G+F+IMG  G+
Sbjct: 102 GMGMGALVYRYAGIPDGFTTVAKAFFVTATAFGGLSLFGYTTKKDLSGFGTFLIMGLIGI 161

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY----SDRYDVAYAERQSV 233
            + S+VN+FM+SS +   +S  G++IFS LTAYDTQ++K  Y     D   +A A     
Sbjct: 162 IIASIVNMFMQSSMMSFIISVGGVLIFSGLTAYDTQRLKHTYYALGGDSRSMAVATNY-- 219

Query: 234 IGALMLYMDFIQIFVHLLRFLGSRRD 259
            GAL LY++FI +F  +L  +G   D
Sbjct: 220 -GALSLYLNFINLFQFILALMGGGDD 244


>gi|220919206|ref|YP_002494510.1| protein of unknown function UPF0005 [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219957060|gb|ACL67444.1| protein of unknown function UPF0005 [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 236

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 90/233 (38%), Positives = 127/233 (54%), Gaps = 21/233 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R +M  VY  M LGLGVT     LV     + +    +I+ NR ++  G           
Sbjct: 25  RRFMSAVYRWMTLGLGVTA----LVATAVASSETLLLAIVGNR-ILFYGL---------- 69

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
              I   L + I+++  ++ L A AA  +FLLYSA+ G +LS   LVYT  S+   F  T
Sbjct: 70  ---ILGELALVIWISAAVNRLPAAAAGGLFLLYSAINGATLSVVLLVYTGASVGIAFLTT 126

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F ++S+YG  T+RDL   GSF+ MG  G+ + SL NLF RS  I   +S  G+++F+
Sbjct: 127 AGTFAAMSVYGTVTRRDLTGWGSFLFMGLIGIVIASLANLFFRSDMISWVVSCAGVLVFT 186

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            LTAYDTQK++           A    V GAL LY+DF+ +F+ LLR  G+RR
Sbjct: 187 GLTAYDTQKLRAYAR---AGGGAAAAPVSGALSLYLDFVNLFLSLLRLFGNRR 236


>gi|332298561|ref|YP_004440483.1| protein of unknown function UPF0005 [Treponema brennaborense DSM
           12168]
 gi|332181664|gb|AEE17352.1| protein of unknown function UPF0005 [Treponema brennaborense DSM
           12168]
          Length = 230

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 125/217 (57%), Gaps = 5/217 (2%)

Query: 43  TGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVR 102
           TG+ S++V  LA  +    A +     V+L+      +  P   I +   L +  +L+ R
Sbjct: 19  TGVYSWMV--LALAISAACAYVTATNTVLLSFIFGNAFVFP---ILVLGELALVFWLSAR 73

Query: 103 LHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRD 162
           +  +SA AA   F+ YS L G++LSS  LVY+  SIV+ F ITA  F  +S+YG  TK D
Sbjct: 74  IGKMSAGAAAAAFVAYSVLNGITLSSVVLVYSGASIVRVFLITAGMFACMSVYGRVTKSD 133

Query: 163 LGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR 222
           L   G +++M  FG+ + S+VN+F RSS +D  +S + + +F+ LTAYDTQK+    +  
Sbjct: 134 LRSAGRYLMMAVFGILIASVVNVFTRSSGLDWILSLVTVGVFTGLTAYDTQKLYRISAQA 193

Query: 223 YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            +     + ++IGAL LY+DF+ +F+ LLR  G  ++
Sbjct: 194 DESELFAKVAIIGALELYLDFVNVFLALLRLFGKSKN 230


>gi|226356647|ref|YP_002786387.1| hypothetical protein Deide_16610 [Deinococcus deserti VCD115]
 gi|226318637|gb|ACO46633.1| Conserved hypothetical protein; putative membrane protein
           [Deinococcus deserti VCD115]
          Length = 228

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 126/235 (53%), Gaps = 21/235 (8%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           +R +M R Y+ MA GL +T  +++L     T  +   A                M    L
Sbjct: 15  VRTFMARTYSWMAAGLALTAGVAYL-----TAQNETLA----------------MQVMAL 53

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
           R   I A L +   L++    LS+  A M+F+ Y+AL GL+ S+    Y+  +++  F  
Sbjct: 54  RLPLILAQLALVFVLSMFAQRLSSAVAGMLFIGYAALTGLTFSALLFAYSPTAVITAFAT 113

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TA +FG +S+ G+  K+DL  +G F +    GL +  +VNLF+ SSA+ L +S +G+++F
Sbjct: 114 TAGTFGLMSVAGFVIKKDLSAMGRFFMFAVLGLIVAMIVNLFVASSALTLGISIVGVLVF 173

Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           + LTAYDTQ ++           AER ++ GAL LY+DFI +F+ +LR  G  RD
Sbjct: 174 AGLTAYDTQMLRNLALSGVTGEQAERAAINGALALYLDFINMFLFILRLFGGSRD 228


>gi|295691510|ref|YP_003595203.1| hypothetical protein Cseg_4175 [Caulobacter segnis ATCC 21756]
 gi|295433413|gb|ADG12585.1| protein of unknown function UPF0005 [Caulobacter segnis ATCC 21756]
          Length = 250

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 98/263 (37%), Positives = 148/263 (56%), Gaps = 18/263 (6%)

Query: 1   MSDI-RNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D  R Y R + +      ++D GLR++M+ VYN +ALGL ++  ++FL     T+   
Sbjct: 1   MNDFNRGYARSIPADRA-DMSVDAGLRSFMLGVYNKVALGLLLSAGLAFL-----TSAYQ 54

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
             AS++     +LT  G L   + L  +  FAPL + +     + + +A ++ +++    
Sbjct: 55  PVASLL----YVLTPDGRLAGFTMLGTVIRFAPLAMMLVAMFAMRNPTARSSGILYWALV 110

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           A +G  L  + L YT  S+  TF ITA +FG LSL+GYTTK+DL   GSF+IMG  GL L
Sbjct: 111 ASMGAGLGVWLLAYTGASVAATFLITAIAFGGLSLFGYTTKKDLTGFGSFLIMGLIGLVL 170

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY----SDRYDVAYAERQSVIG 235
            SLV +F     +   +S +G+ IF+ L AYDTQ++K  Y     D+  +A A      G
Sbjct: 171 ASLVQMFFPMPGLGFIISILGVFIFAGLIAYDTQRLKMTYYQLGGDQQSMAVATNY---G 227

Query: 236 ALMLYMDFIQIFVHLLRFLGSRR 258
           AL LY++FI +F  LL  +GSRR
Sbjct: 228 ALSLYLNFINLFQFLLSIMGSRR 250


>gi|320537870|ref|ZP_08037785.1| hypothetical protein HMPREF9554_02539 [Treponema phagedenis F0421]
 gi|320145289|gb|EFW36990.1| hypothetical protein HMPREF9554_02539 [Treponema phagedenis F0421]
          Length = 234

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 87/234 (37%), Positives = 131/234 (55%), Gaps = 20/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           + ++  VY  M   L ++G  +FLV      ++ +AA + I  G  L  FG         
Sbjct: 20  QRFLAAVYGWMVAALAISGFSAFLV------INSEAALLFI-FGNKLVFFG--------- 63

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
              I A + +   L+  +  +S   A + F+ YS L G++LS+ F +YT  SI + F  T
Sbjct: 64  --LIIAEVLLVAGLSAGIRKISFTTAALAFIGYSILNGITLSAIFFIYTGGSITRIFLTT 121

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A  F  +S+YG TT  DL   G ++IM   GL + SLVN+F+RSS+ D  +S + + +F+
Sbjct: 122 ALMFSVMSIYGMTTNTDLNSAGRYLIMAVIGLVIASLVNMFLRSSSFDWLLSFITVGVFT 181

Query: 206 ALTAYDTQKIKE-AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            LTAYD+QKI + +   R D AY  + ++IGAL LY+DFI IF+ LLR  G +R
Sbjct: 182 GLTAYDSQKILQISQHARQDDAY-RKVALIGALKLYLDFINIFLALLRLFGKKR 234


>gi|94984645|ref|YP_604009.1| hypothetical protein Dgeo_0538 [Deinococcus geothermalis DSM 11300]
 gi|94554926|gb|ABF44840.1| protein of unknown function UPF0005 [Deinococcus geothermalis DSM
           11300]
          Length = 228

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 128/238 (53%), Gaps = 24/238 (10%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           +R +M R Y+ MA GL +T  +++L     T  +   A+ ++                 L
Sbjct: 12  VRTFMARTYSWMAAGLALTAGVAYL-----TAQNEALAAQVMG----------------L 50

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
           R   + A L +   L++    LS+  A ++F+ Y+AL GL+ SS  L Y+  ++   F  
Sbjct: 51  RMPLVLAQLAIVFVLSLAAQRLSSAVAGILFIAYAALTGLTFSSLLLAYSPSAVTAAFLT 110

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TA +F ++S+ G   KRDL  +G F +    GL +  +VNLF+ SSA+ L +S +G+++F
Sbjct: 111 TAGTFAAMSVAGLVIKRDLSALGRFFLFAVLGLLIAMIVNLFVASSALTLGISIVGVLLF 170

Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR---FLGSRRD 259
           + LTAYDTQ ++           AER ++ GAL LY+DFI +F+ +LR   F GS  D
Sbjct: 171 AGLTAYDTQMLRTLALSGVSGELAERAAINGALALYLDFINMFLFILRLFGFAGSSDD 228


>gi|312890122|ref|ZP_07749665.1| protein of unknown function UPF0005 [Mucilaginibacter paludis DSM
           18603]
 gi|311297399|gb|EFQ74525.1| protein of unknown function UPF0005 [Mucilaginibacter paludis DSM
           18603]
          Length = 243

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/187 (37%), Positives = 112/187 (59%), Gaps = 10/187 (5%)

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
           TG G L+  SPL ++ I         ++  ++ LS     ++F+ ++AL G+S+S   L+
Sbjct: 66  TGLGTLVMFSPLAFVLI---------MSYGMNKLSYPILAVLFICFAALFGMSISYILLM 116

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT+ S++  F   +  FG +++ GYTT +DL   GS MIMG  G+ + SLVN+F++S  +
Sbjct: 117 YTASSVLGVFVTASVVFGVMAVAGYTTDQDLTKFGSLMIMGLIGIVIASLVNMFLKSEQL 176

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKE-AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLL 251
              +S +G+ +F  LTAYD QK+K    S+ Y  A   +  ++GAL LY+DFI +F+ LL
Sbjct: 177 GYIISYIGVAVFVGLTAYDVQKLKRIGASEEYGDATKSKLVLMGALTLYLDFINLFLMLL 236

Query: 252 RFLGSRR 258
           R  G RR
Sbjct: 237 RIFGRRR 243


>gi|213583584|ref|ZP_03365410.1| hypothetical protein SentesTyph_21168 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 234

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 87/237 (36%), Positives = 125/237 (52%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T   +F+    A T  P     + +  +   G         
Sbjct: 16  GLQTYMAQVYGWMTVGLLLT---AFIAWYAANT--PAVMMFVFSSKITFFGL-------- 62

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L +   L+  +H LSA  A  +F+LYSAL G  +  +F         Q   
Sbjct: 63  -----IIAQLALVFVLSGLVHKLSAGMATTLFMLYSALTGFDVIQYFYRLHLFLHRQHVC 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
                FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V+
Sbjct: 118 GDGGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVVV 177

Query: 204 FSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K      D  D A   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 FVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|330997501|ref|ZP_08321350.1| hypothetical protein HMPREF9442_02449 [Paraprevotella xylaniphila
           YIT 11841]
 gi|329570532|gb|EGG52256.1| hypothetical protein HMPREF9442_02449 [Paraprevotella xylaniphila
           YIT 11841]
          Length = 237

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 83/233 (35%), Positives = 130/233 (55%), Gaps = 22/233 (9%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M  VY  M   L +TG+ +  V   AT +      I+ N+ V L                
Sbjct: 24  MRNVYRWMTFALAITGLTAACVAGNATLMQF----ILGNQAVFLG--------------L 65

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A L V   L  R+  LS   A ++F+LYS L G++LS+ FLVY   SI  TFF+TA +
Sbjct: 66  IIAELVVAFTLIGRVSKLSFTNASLLFILYSILTGVTLSTIFLVYEIGSIASTFFVTAGT 125

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SL GY T +DL  +G+++IM   GL + ++ N F+ S+ +D  ++   +++F  LT
Sbjct: 126 FGTMSLVGYFTHKDLSKMGTYLIMALIGLIIATIANWFIASTTLDWGITYALVLVFVGLT 185

Query: 209 AYDTQKIKEAYSDR---YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQKIK    +     D +  ++ +++G+  LY+DF+ +F+ LL+ LG R+
Sbjct: 186 AYDTQKIKAMLREHGMGLDES-TQKLALMGSFTLYLDFLNLFLQLLKILGKRK 237


>gi|281356793|ref|ZP_06243284.1| protein of unknown function UPF0005 [Victivallis vadensis ATCC
           BAA-548]
 gi|281316920|gb|EFB00943.1| protein of unknown function UPF0005 [Victivallis vadensis ATCC
           BAA-548]
          Length = 239

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 86/262 (32%), Positives = 140/262 (53%), Gaps = 27/262 (10%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D R+Y+R   + +  G         ++ RV+  M  GL +T  +S+ +   A +   D
Sbjct: 1   MND-RSYER---APAAIGQEAQLTQAGFVNRVFGWMTGGLALTAGISYAI---ANSTMQD 53

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
              +I NRG  L     L+    L          + I L+  ++ +S++ A + F L++A
Sbjct: 54  --FVIQNRGAFL----GLLIVEVL----------LVIGLSAAINKISSFVAGLGFALFAA 97

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L G++LS  F+ Y   +I +TFF T+  FG +  +GY TK+DL  IG    M  +GL + 
Sbjct: 98  LNGVTLSWIFMAYEPAAIYRTFFTTSLMFGGVGAFGYVTKKDLSGIGGMCGMALWGLIVA 157

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIK----EAYSDRYDVAYAERQSVIGA 236
            L+N+F  +S   L +S  G+V+F+ LTA+D QKIK         ++D    ++ ++ GA
Sbjct: 158 MLINMFWANSTFSLLISICGVVLFTGLTAWDMQKIKLMSLAVGEGQFDAETGKKVAIFGA 217

Query: 237 LMLYMDFIQIFVHLLRFLGSRR 258
           L LY+DFI +F+ LLR  G+RR
Sbjct: 218 LELYLDFINLFLFLLRIFGNRR 239


>gi|295698756|ref|YP_003603411.1| stationary phase anti-death Family [Candidatus Riesia pediculicola
           USDA]
 gi|291156995|gb|ADD79440.1| stationary phase anti-death Family [Candidatus Riesia pediculicola
           USDA]
          Length = 241

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 132/245 (53%), Gaps = 31/245 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           G++ Y+  VY  M++ L +T  +SF      T  + +    I+N                
Sbjct: 18  GVQFYIANVYGWMSVSLLLTAFVSF-----YTIRNDNIIFFILNN--------------- 57

Query: 84  LRWIFIFAPLGVFIFLNV----RLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIV 139
            +WIF        I +N+     LH + + +A  + +LYS + G+++S    VYT  SIV
Sbjct: 58  -KWIFFLIFFAEIILVNILTSSALHKIDSNSATTLLMLYSLMTGITISLPLFVYTGISIV 116

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
           +TFFIT+  FG+L++YGY TK+ L  + SF+     G+ L+S +N++++++ +   ++  
Sbjct: 117 RTFFITSIMFGALAIYGYKTKKSLNFLSSFLFTSIIGIVLISFLNIWLKNTGLSFFINFA 176

Query: 200 GLVIFSALTAYDTQKIKEAYSDRY------DVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
           G++ FS L AYD QK+KE  S+        D    ++ SV+GAL LY+DF+ +F+  L+ 
Sbjct: 177 GVLTFSGLVAYDNQKLKEMGSNLIFQNLLDDKDNMKKHSVVGALTLYLDFVNLFLFFLQI 236

Query: 254 LGSRR 258
            G R+
Sbjct: 237 NGERK 241


>gi|118580557|ref|YP_901807.1| hypothetical protein Ppro_2141 [Pelobacter propionicus DSM 2379]
 gi|118503267|gb|ABK99749.1| protein of unknown function UPF0005 [Pelobacter propionicus DSM
           2379]
          Length = 232

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 100/158 (63%), Gaps = 3/158 (1%)

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
            +   L +   L+  ++ LS  AA ++FL YSAL GL+LS  FLVYT+ SI  TF I+A 
Sbjct: 64  LMIGELAMVAVLSAAINRLSGSAATLLFLGYSALNGLTLSVIFLVYTADSIGSTFLISAG 123

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
            FG++S+YG+ T RDL   GSF+ MG  G+ + S+VN+F+ S A+    S +G++IF+ L
Sbjct: 124 MFGAMSVYGHLTSRDLTSWGSFLFMGLIGIVIASIVNIFLASDAVSWITSGIGVLIFTGL 183

Query: 208 TAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           TAYD+ KIK   +         + +++GAL LY+DFI 
Sbjct: 184 TAYDSWKIKALAAQGQT---GRKPAILGALTLYLDFIN 218


>gi|310780224|ref|YP_003968556.1| protein of unknown function UPF0005 [Ilyobacter polytropus DSM
           2926]
 gi|309749547|gb|ADO84208.1| protein of unknown function UPF0005 [Ilyobacter polytropus DSM
           2926]
          Length = 234

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 85/253 (33%), Positives = 137/253 (54%), Gaps = 23/253 (9%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
           +R+ N        IDQ +   +  V+  M LGL VT         LAT++      +++N
Sbjct: 3   ERMQNRSYISTEEIDQLVTKKIAGVFGWMVLGLFVT---------LATSIFTLTNPVLLN 53

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
                     L Y     + FI   L +   L++R++ +S   ++ +FL YSAL G++LS
Sbjct: 54  ----------LAY--KYMFAFIIGELALVFILSMRVYHMSTAKSRALFLFYSALNGITLS 101

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
              +VYT  SI+ TF    A F  +++YGYTTK DL   G+ + +G   L ++S+VN+F+
Sbjct: 102 LIAIVYTGVSILYTFAGAMAIFLIMAIYGYTTKEDLSKFGNLLKVGLISLIIVSVVNIFL 161

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           +S  +   +S MG++IF  L  YD  +IK     +   D++  ++ S+IGAL LY+DFI 
Sbjct: 162 KSPTLYWIISYMGVLIFIGLIGYDVNRIKNNITVAVSQDISVVDKVSIIGALALYLDFIN 221

Query: 246 IFVHLLRFLGSRR 258
           +F++LLR  G +R
Sbjct: 222 LFLYLLRIFGKKR 234


>gi|332880894|ref|ZP_08448564.1| hypothetical protein HMPREF9074_04345 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332681068|gb|EGJ53995.1| hypothetical protein HMPREF9074_04345 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 237

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 83/233 (35%), Positives = 129/233 (55%), Gaps = 22/233 (9%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M  VY  M   L +TG+ +  V   AT +      I+ N+ V L                
Sbjct: 24  MRNVYRWMTFALAITGLTAACVAGNATLMQF----ILGNQAVFLG--------------L 65

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A L V   L  R+  LS   A ++F+LYS L G +LS+ FLVY   SI  TFF+TA +
Sbjct: 66  IIAELVVAFTLIGRVSKLSFTNASLLFILYSILTGATLSTIFLVYEIGSIASTFFVTAGT 125

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SL GY T +DL  +G+++IM   GL + ++ N F+ S+ +D  ++   +++F  LT
Sbjct: 126 FGAMSLVGYFTHKDLSKMGTYLIMALIGLIIATIANWFIASTTLDWGITYALVLVFVGLT 185

Query: 209 AYDTQKIKEAYSDR---YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQKIK    +     D +  ++ +++G+  LY+DF+ +F+ LL+ LG R+
Sbjct: 186 AYDTQKIKVMLREHGMGLDES-TQKLALMGSFTLYLDFLNLFLQLLKILGKRK 237


>gi|330836755|ref|YP_004411396.1| hypothetical protein Spico_0789 [Spirochaeta coccoides DSM 17374]
 gi|329748658|gb|AEC02014.1| protein of unknown function UPF0005 [Spirochaeta coccoides DSM
           17374]
          Length = 236

 Score =  121 bits (304), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 133/239 (55%), Gaps = 24/239 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R+ +  VY  M  GLGVT ++++LV        P   SII++   +  G           
Sbjct: 17  RSLIRNVYVWMTAGLGVTAVVAYLV-----AATPAIMSIILSNQFLFFGI---------- 61

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
              + A L +  +L+ RL ++    A   F+ Y+ L G+ +S+ F V+T  SI   FF T
Sbjct: 62  ---VIAELALVFYLSSRLKTMDVGKAVASFIGYAILNGVLMSTLFYVFTGGSIAIAFFTT 118

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
             +FG +S++   TKRDL   G +  M  +GL + SL+N+F+ S  +   +S +G+++F 
Sbjct: 119 TVAFGGMSVFAMLTKRDLRGFGYYFSMALWGLIIASLINMFLGSQTMYYIISFVGIIVFL 178

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQ----SVIGALMLYMDFIQIFVHLLRFLGS-RRD 259
            LTA+DTQ++++  +++Y     E +    S+I AL LY++FI IF+++LRF+G  RRD
Sbjct: 179 GLTAWDTQRLRDV-NEQYGTTMTEEEYTKISIISALSLYLNFINIFLYILRFMGVMRRD 236


>gi|154496419|ref|ZP_02035115.1| hypothetical protein BACCAP_00708 [Bacteroides capillosus ATCC
           29799]
 gi|150274502|gb|EDN01579.1| hypothetical protein BACCAP_00708 [Bacteroides capillosus ATCC
           29799]
          Length = 238

 Score =  121 bits (304), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 109/171 (63%), Gaps = 2/171 (1%)

Query: 91  APLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFG 150
           A + V + L+ R+HSLS  AA+ +F  Y+AL G++ S +F+++   S+V  F +TA  FG
Sbjct: 68  AQIAVVLVLSARIHSLSVPAARFLFFAYAALTGVTFSVYFILFDVASLVLVFGVTALYFG 127

Query: 151 SLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS-SAIDLTMSAMGLVIFSALTA 209
           +++ +GY TK DL  I + ++ G   L +  L+++F+    A+D     +G+ IF   TA
Sbjct: 128 AMAAFGYATKADLSRIRTVLMGGLIFLVVFGLISMFIPGLQALDRIYCLIGIAIFLGFTA 187

Query: 210 YDTQKIKEAYSDR-YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           YDTQKIK+ ++   +D   A + SV  AL LY+DFI +F++LLRFLG RR+
Sbjct: 188 YDTQKIKDLHAYYGHDPEMAAKASVFAALQLYLDFINLFLYLLRFLGRRRN 238


>gi|326790194|ref|YP_004308015.1| hypothetical protein Clole_1087 [Clostridium lentocellum DSM 5427]
 gi|326540958|gb|ADZ82817.1| protein of unknown function UPF0005 [Clostridium lentocellum DSM
           5427]
          Length = 174

 Score =  121 bits (304), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 102/172 (59%), Gaps = 1/172 (0%)

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
           +F  A + V I L+ R H +S+ AAK  F++YS L G++LS+ F+VY   +I   F +TA
Sbjct: 2   LFAIAEVVVVIALSARAHKMSSLAAKGWFVVYSVLNGITLSAIFVVYEIGAIGYAFLVTA 61

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
             F  +++YGY TK DL  IGS  +M  FGL + + V  F+ +    + +  + + IF  
Sbjct: 62  GVFAVMTIYGYVTKTDLSKIGSLFVMALFGLLIATFVGSFINTPGYTMALMYVTVFIFIG 121

Query: 207 LTAYDTQKIKE-AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           L  +DTQKIK+ AY+           S++GAL LY+DFI IF+ L+R  GSR
Sbjct: 122 LIGWDTQKIKQYAYAQADSNGALANASILGALTLYLDFINIFISLVRIFGSR 173


>gi|325970921|ref|YP_004247112.1| hypothetical protein SpiBuddy_1093 [Spirochaeta sp. Buddy]
 gi|324026159|gb|ADY12918.1| protein of unknown function UPF0005 [Spirochaeta sp. Buddy]
          Length = 236

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 83/215 (38%), Positives = 118/215 (54%), Gaps = 21/215 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R  +  VY  M  GLG+T +++F V          A++  + R ++    G L+      
Sbjct: 17  RTILKNVYLWMTAGLGLTALVAFFV----------ASNPSLLRALVGNTLGFLL------ 60

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
              +     +  +L+ RL  +S  +A   FL YSAL G+ LS+ F VY    I +TFF T
Sbjct: 61  --IVVGQFALVFYLSARLDRMSQSSAIGAFLAYSALNGIMLSTLFAVYAGVVIYKTFFTT 118

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A  FG +SLY  TTKRDL  IGS+++MG +GL + SL+N+F RSS +D  +S +G+ IF 
Sbjct: 119 ALMFGGMSLYAMTTKRDLNKIGSYLVMGLWGLIIASLINMFFRSSGLDYLISFIGVGIFL 178

Query: 206 ALTAYDTQKI---KEAYSDRYDVAYAERQSVIGAL 237
            LTA+DTQKI    E Y    D     + S+IGAL
Sbjct: 179 GLTAWDTQKIIRMNEQYGSAIDEETFTKLSIIGAL 213


>gi|213618997|ref|ZP_03372823.1| hypothetical protein SentesTyp_22030 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
          Length = 173

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 72/172 (41%), Positives = 101/172 (58%), Gaps = 2/172 (1%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A L +   L+  +H LSA  A  +F+LYSAL G  +  +F         Q        
Sbjct: 2   IIAQLALVFVLSGLVHKLSAGMATTLFMLYSALTGFDVIQYFYRLHLFLHRQHVCGDGGM 61

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V+F  LT
Sbjct: 62  FGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVVVFVGLT 121

Query: 209 AYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K      D  D A   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 122 AYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR 173


>gi|29653567|ref|NP_819259.1| integral membrane protein [Coxiella burnetii RSA 493]
 gi|154707608|ref|YP_001425206.1| integral membrane protein [Coxiella burnetii Dugway 5J108-111]
 gi|165918653|ref|ZP_02218739.1| putative membrane protein [Coxiella burnetii RSA 334]
 gi|29540829|gb|AAO89773.1| integral membrane protein [Coxiella burnetii RSA 493]
 gi|154356894|gb|ABS78356.1| integral membrane protein [Coxiella burnetii Dugway 5J108-111]
 gi|165917681|gb|EDR36285.1| putative membrane protein [Coxiella burnetii RSA 334]
          Length = 239

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 107/176 (60%), Gaps = 5/176 (2%)

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           F  +++T  L +  I A     I L      L+A  A ++++LY+ L G++LS     YT
Sbjct: 52  FNKIVHTPGLFFGLIIAQFAAVIGLTWLNQRLTATLAALIYVLYTVLTGVTLSVVLYAYT 111

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF---MRSSA 191
            +++     +T+ +F  LS +GY TKRDLGPIG+F IMG FG+  + L+  F   +RS  
Sbjct: 112 KQNVFDALAVTSVAFLGLSAFGYVTKRDLGPIGTFCIMGLFGMIGMMLLAFFIPGLRSDT 171

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALMLYMDFIQ 245
           + LT+SA+G+++FS LTAYDTQ+IK +Y  S  +      + +V GALMLY+DFI 
Sbjct: 172 MQLTISAIGVLVFSGLTAYDTQRIKLSYLQSGGWGEGQQLKAAVNGALMLYLDFIN 227


>gi|161831282|ref|YP_001596163.1| hypothetical protein COXBURSA331_A0308 [Coxiella burnetii RSA 331]
 gi|161763149|gb|ABX78791.1| putative membrane protein [Coxiella burnetii RSA 331]
          Length = 239

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 107/176 (60%), Gaps = 5/176 (2%)

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           F  +++T  L +  I A     I L      L+A  A ++++LY+ L G++LS     YT
Sbjct: 52  FNKIVHTPGLFFGLIIAQFAAVIGLTWLNQRLTATLAALIYVLYTVLTGVTLSVVLYAYT 111

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF---MRSSA 191
            +++     +T+ +F  LS +GY TKRDLGPIG+F IMG FG+  + L+  F   +RS  
Sbjct: 112 KQNVFDALAVTSVAFLGLSAFGYVTKRDLGPIGTFCIMGLFGMIGMMLLAFFIPGLRSDT 171

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALMLYMDFIQ 245
           + LT+SA+G+++FS LTAYDTQ+IK +Y  S  +      + +V GALMLY+DFI 
Sbjct: 172 MQLTISAIGVLVFSGLTAYDTQRIKLSYLQSGGWGEGQQLKAAVNGALMLYLDFIN 227


>gi|153208156|ref|ZP_01946584.1| putative membrane protein [Coxiella burnetii 'MSU Goat Q177']
 gi|212218049|ref|YP_002304836.1| integral membrane protein [Coxiella burnetii CbuK_Q154]
 gi|120576169|gb|EAX32793.1| putative membrane protein [Coxiella burnetii 'MSU Goat Q177']
 gi|212012311|gb|ACJ19691.1| integral membrane protein [Coxiella burnetii CbuK_Q154]
          Length = 239

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 107/176 (60%), Gaps = 5/176 (2%)

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           F  +++T  L +  I A     I L      L+A  A ++++LY+ L G++LS     YT
Sbjct: 52  FNKIVHTPGLFFGLIIAQFAAVIGLTWLNQRLTATLAALIYVLYTVLTGVTLSVVLYAYT 111

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF---MRSSA 191
            +++     +T+ +F  LS +GY TKRDLGPIG+F IMG FG+  + L+  F   +RS  
Sbjct: 112 KQNVFDALAVTSVAFLGLSAFGYVTKRDLGPIGTFCIMGLFGMIGIMLLAFFIPGLRSDT 171

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALMLYMDFIQ 245
           + LT+SA+G+++FS LTAYDTQ+IK +Y  S  +      + +V GALMLY+DFI 
Sbjct: 172 MQLTISAIGVLVFSGLTAYDTQRIKLSYLQSGGWGEGQQLKAAVNGALMLYLDFIN 227


>gi|313898490|ref|ZP_07832027.1| putative membrane protein [Clostridium sp. HGF2]
 gi|312956872|gb|EFR38503.1| putative membrane protein [Clostridium sp. HGF2]
          Length = 233

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 125/234 (53%), Gaps = 20/234 (8%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           L+ + +R +  M LGL VT   +F V         D    I             M  +PL
Sbjct: 18  LQKHAVRTFGWMTLGLLVTTATAFAV------YSTDLIYYIYT-----------MRFAPL 60

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
             I I A  GV I L  RL  +SA +AK++FL YS L G++ S+  LVY   ++   F +
Sbjct: 61  --ILIAAQFGVVIALGARLMKMSATSAKILFLAYSMLTGITFSTLALVYLPGTLAMAFLM 118

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           T   FGSL++ GYTTK +L   G  +      L +  ++ +FM +    + MSA+GL+IF
Sbjct: 119 TTVYFGSLAVIGYTTKMNLLRFGPILFGSLLALIITEVIMMFMGADTSTMLMSAIGLLIF 178

Query: 205 SALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + LTAYD QK+K  Y+    D    ++ S+  A  LY+DFI IF+++LRF+G+R
Sbjct: 179 TGLTAYDAQKMKALYASYEGDEEMLKKLSIYSAFELYLDFINIFLYILRFVGNR 232


>gi|302874688|ref|YP_003843321.1| hypothetical protein Clocel_1813 [Clostridium cellulovorans 743B]
 gi|307690700|ref|ZP_07633146.1| hypothetical protein Ccel74_21271 [Clostridium cellulovorans 743B]
 gi|302577545|gb|ADL51557.1| protein of unknown function UPF0005 [Clostridium cellulovorans
           743B]
          Length = 227

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 85/240 (35%), Positives = 136/240 (56%), Gaps = 29/240 (12%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLV---NILATTVDPDAASIIINRGVMLTGFGALMYT 81
           +  Y+ +VY  M + L +T ++++ V   N L   +  +  +III            ++ 
Sbjct: 12  VNTYLTKVYGFMTIALIITSLVAYAVSTSNTLMYAIYGNRFNIII------------LFV 59

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
             +  +   + LG       R+ +L++ +A   F+LYS + GL++S  F+VY S +I   
Sbjct: 60  CQIALVIAISRLGT------RISTLASTSA---FILYSIINGLTISYIFIVYASTTIFSA 110

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM-RSSAIDLTMSAMG 200
           FF+TA +F ++SLYGY TK+DL  IG    M   G+ L SLVN F+ +SS  D+ +S + 
Sbjct: 111 FFVTAGTFAAMSLYGYVTKKDLTTIGRLGFMALIGIILASLVNGFLIKSSGFDIVISIVS 170

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR-FLGSRRD 259
           +++F  L AYDTQK+K+ Y   Y        ++IGAL LY+DFI +F+++LR F GS RD
Sbjct: 171 VIVFIGLIAYDTQKLKQLYYQGYG---TTNIALIGALTLYLDFINLFLNILRLFGGSSRD 227


>gi|229365476|dbj|BAH57984.1| hypothetical protein [Acetobacter lovaniensis]
          Length = 179

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 106/174 (60%), Gaps = 3/174 (1%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           + +PL   + ++  L+ LS   A+ +F  + A +G S+++ F++YT  SIV+ F +TA  
Sbjct: 4   LLSPLAFVLVMSFGLNRLSLQGAQALFWAFCAAMGASMANIFVIYTDTSIVRVFLVTACM 63

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           F + SL+GY TK +L    SF++MG FGL +  LVNLF++S A+    S +G+ IF+A +
Sbjct: 64  FAATSLWGYVTKANLLRFSSFLMMGLFGLLIAGLVNLFLKSPALYYVYSIVGVFIFTAFS 123

Query: 209 AYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           A+D Q+I+  Y         E   ++SV  AL LY++FI +F  LL+F+G R  
Sbjct: 124 AFDAQRIRVTYPQLAAYEGPEMTAKRSVYDALSLYLNFINLFQFLLQFMGVRNS 177


>gi|327403035|ref|YP_004343873.1| hypothetical protein Fluta_1037 [Fluviicola taffensis DSM 16823]
 gi|327318543|gb|AEA43035.1| protein of unknown function UPF0005 [Fluviicola taffensis DSM
           16823]
          Length = 242

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 108/177 (61%), Gaps = 1/177 (0%)

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           S L ++ IF+P+G+ +     ++ LS      +F +YS LIG ++SS FL Y+  SIV T
Sbjct: 65  SILYYVVIFSPIGIALLFQTMINRLSFPLLFGLFSIYSILIGFAISSIFLRYSMGSIVTT 124

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F +TA +FG +++ GY TK DL  +GS + M   G+F+ S+VN F+ SS +   +S +G+
Sbjct: 125 FGVTAGTFGVMAIMGYVTKADLTKMGSILYMAFIGIFIASIVNFFLDSSGLGYLISILGV 184

Query: 202 VIFSALTAYDTQKIKE-AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           ++F+ LTAY  Q++K+ A+          + +++G   LY+ FI +F+ LLR  G R
Sbjct: 185 IVFTGLTAYHMQQLKKFAHDSEMSADDKNKMALLGGFTLYVLFINLFLSLLRLFGGR 241


>gi|261367282|ref|ZP_05980165.1| membrane protein [Subdoligranulum variabile DSM 15176]
 gi|282570885|gb|EFB76420.1| membrane protein [Subdoligranulum variabile DSM 15176]
          Length = 238

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 91/261 (34%), Positives = 136/261 (52%), Gaps = 31/261 (11%)

Query: 5   RNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASI 64
           +NY  +  + S FG+     L  YM + +  M  GL VT    F V I            
Sbjct: 3   QNYNDISYAESPFGT-----LSQYMTKTFGWMFAGLLVT----FAVGI------------ 41

Query: 65  IINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGL 124
               G + +G   L  ++ L ++   A L +   L+ R+  +    A  +F  Y+ L G+
Sbjct: 42  ----GTVTSGLVWLFASTGLIFLTAIAELVMVFVLSARITHIQPGTATGLFFGYAVLNGV 97

Query: 125 SLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV- 183
           +LS+ FLVY   S+V  F + A  FG +++YG TT+RDL   G  +  G   + + SLV 
Sbjct: 98  NLSTIFLVYDVGSLVLAFLVGAVYFGVMAVYGATTRRDLTGWGPKLFAGLIAMLVCSLVG 157

Query: 184 NLF----MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALM 238
           +LF    +R   +DL + A+GL+IF  LTAYDTQ +K  Y+    D A   + S+IGAL 
Sbjct: 158 SLFSLFGVRFGLMDLVLCAIGLLIFMGLTAYDTQMLKHHYAYFGGDAAMLHKASIIGALN 217

Query: 239 LYMDFIQIFVHLLRFLGSRRD 259
           LY+DFI IF+++LR +G R D
Sbjct: 218 LYLDFINIFLYILRMVGRRND 238


>gi|212213272|ref|YP_002304208.1| integral membrane protein [Coxiella burnetii CbuG_Q212]
 gi|212011682|gb|ACJ19063.1| integral membrane protein [Coxiella burnetii CbuG_Q212]
          Length = 239

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 105/176 (59%), Gaps = 5/176 (2%)

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           F  +++T  L +  I A     I L      L+A  A ++++LY+ L G +LS     YT
Sbjct: 52  FNKIVHTPGLFFGLIIAQFAAVIGLTWLNQRLTATLAALIYVLYTVLTGATLSVVLYAYT 111

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF---MRSSA 191
            +++     +T+ +F  LS +GY TKRDLGPIG+F IMG FG+  + L+  F   +RS  
Sbjct: 112 KQNVFDALAVTSVAFLGLSAFGYVTKRDLGPIGTFCIMGLFGMIGMMLLAFFIPGLRSDT 171

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALMLYMDFIQ 245
           + LT+SA+G+++FS LTAYDTQ+IK +   S  +      + +V GALMLY+DFI 
Sbjct: 172 MQLTISAIGVLVFSGLTAYDTQRIKLSCLQSGGWGEGQQLKAAVNGALMLYLDFIN 227


>gi|309775942|ref|ZP_07670934.1| putative membrane protein [Erysipelotrichaceae bacterium 3_1_53]
 gi|308916224|gb|EFP61972.1| putative membrane protein [Erysipelotrichaceae bacterium 3_1_53]
          Length = 233

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 69/177 (38%), Positives = 106/177 (59%), Gaps = 3/177 (1%)

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           +PL  I + A  GV I L  RL  +SA  AK++FL YS L G++ S+  +VY   ++   
Sbjct: 58  TPL--ILLIAQFGVVIALGARLMKMSATGAKVLFLAYSMLTGITFSTLAVVYLPGTLAIA 115

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F +T   FGSL++ GYTTK +L   G  +      L +  ++ +FM +    + +SA+GL
Sbjct: 116 FLMTTVYFGSLAVIGYTTKMNLLRFGPILFGSLLALIITEVIMMFMGADTSTMLISAIGL 175

Query: 202 VIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           +IF+ LTAYD QK+K  Y+    D    ++ S+  A  LY+DFI IF+++LRF+G+R
Sbjct: 176 LIFTGLTAYDAQKMKALYASYEGDEEMLKKLSIYSAFELYLDFINIFLYILRFIGNR 232


>gi|332653053|ref|ZP_08418798.1| putative membrane protein [Ruminococcaceae bacterium D16]
 gi|332518199|gb|EGJ47802.1| putative membrane protein [Ruminococcaceae bacterium D16]
          Length = 239

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 103/165 (62%), Gaps = 6/165 (3%)

Query: 99  LNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYT 158
           L+ R+  +S  +A+MMFL++SAL+G++ S++  +Y   SIV  F  TA  FG+L+ YG+ 
Sbjct: 77  LSARIEKMSVASAQMMFLVFSALMGVTASTWLYLYQLTSIVFIFLATALYFGALAAYGHF 136

Query: 159 TKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS-SAIDLTMSAMGLVIFSALTAYDTQKIKE 217
           T R L    S ++ G   L L  +++LF+   +A D  +S  G+ IF   TAYDTQ+I+E
Sbjct: 137 TNRSLAGYKSILLSGLIFLILFGVLSLFIPGMTAFDSMISLFGIAIFLGYTAYDTQRIRE 196

Query: 218 AYSDRYDVAYA---ERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            Y   Y   Y    E+ S+  AL LYMDFI +F++LLRFLG +RD
Sbjct: 197 FY--YYYCGYPDMMEKASIFSALQLYMDFINLFLYLLRFLGRQRD 239


>gi|328948178|ref|YP_004365515.1| hypothetical protein Tresu_1310 [Treponema succinifaciens DSM 2489]
 gi|328448502|gb|AEB14218.1| protein of unknown function UPF0005 [Treponema succinifaciens DSM
           2489]
          Length = 236

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 70/177 (39%), Positives = 105/177 (59%), Gaps = 5/177 (2%)

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
           I   A +G+ + L   +  +S   AK++F+LYSAL GL++S+ F  YT+ SI   F   A
Sbjct: 60  ILCIAEIGLVVGLTSSIRKISVANAKLLFILYSALNGLTISTIFFTYTASSIAICFVSAA 119

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN--LFM---RSSAIDLTMSAMGL 201
           A F  +SLYG  TK DL   G +++M   G+ + SL+N  LF+    S+  D  +S   +
Sbjct: 120 AMFFGMSLYGLKTKSDLTTAGRYLMMALLGIIIASLLNGILFLFGAGSTMFDWLISVASV 179

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           V+F+ LTAYD+QKI    S   +    ++ ++ GAL LY+DFI IF+ LLR  G+R+
Sbjct: 180 VVFTGLTAYDSQKIMRISSSADNSDSFKKIAIYGALELYLDFINIFLSLLRLFGNRK 236


>gi|297517083|ref|ZP_06935469.1| hypothetical protein EcolOP_05531 [Escherichia coli OP50]
          Length = 183

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/186 (39%), Positives = 108/186 (58%), Gaps = 18/186 (9%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++     A  ++     +  NR V L G         
Sbjct: 16  GLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMEL----LFTNR-VFLIGL-------- 62

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF 
Sbjct: 63  -----IIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++
Sbjct: 118 VTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIV 177

Query: 204 FSALTA 209
           F  LTA
Sbjct: 178 FVGLTA 183


>gi|332296292|ref|YP_004438215.1| protein of unknown function UPF0005 [Thermodesulfobium narugense
           DSM 14796]
 gi|332179395|gb|AEE15084.1| protein of unknown function UPF0005 [Thermodesulfobium narugense
           DSM 14796]
          Length = 232

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 87/229 (37%), Positives = 139/229 (60%), Gaps = 22/229 (9%)

Query: 32  VYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFA 91
           V+  M LGL  TG++S+LV       +      I++  ++  G  AL + +         
Sbjct: 25  VFTWMFLGLLFTGVISYLV-----ASNDSILRFILSNPILFYGIIALQFAAV-------- 71

Query: 92  PLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGS 151
                I L+  +  L A  A+ +F+LYS L G++ S+ F++YTS SI  TFF+TA SFG 
Sbjct: 72  -----ITLSAAITKLPAEVAEFIFILYSTLTGVTFSTLFVIYTSSSIASTFFVTAISFGV 126

Query: 152 LSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYD 211
           ++L GYTTK DL  +G+FM+ G   + +  ++N+F+ SSA+ L +S +G+++F  LTAYD
Sbjct: 127 MALLGYTTKADLTKMGTFMMAGLIAIIIGFIINIFLHSSALVLLLSVVGVIVFLGLTAYD 186

Query: 212 TQKIKEAY-SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            QK+K+ Y +  +D     +++V+GAL LY+DFI +F+ LL  +G+RRD
Sbjct: 187 MQKLKKIYAAGLFD---ERKETVLGALTLYLDFINLFLMLLNIMGNRRD 232


>gi|304320628|ref|YP_003854271.1| integral membrane protein [Parvularcula bermudensis HTCC2503]
 gi|303299530|gb|ADM09129.1| integral membrane protein [Parvularcula bermudensis HTCC2503]
          Length = 239

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 85/240 (35%), Positives = 125/240 (52%), Gaps = 22/240 (9%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMS-FLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           D+GLR YM+ VYN M++G+ VT ++  F +   A        S I   GV+  GF     
Sbjct: 20  DEGLRRYMLGVYNYMSMGVAVTALVGLFFMTNRAAFEFASGLSFIPFIGVLALGF----- 74

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
                    FAP  +F       H   AY A +   L+  LIG  ++++        IV+
Sbjct: 75  ---------FAPKMIFNGSTAMAHG--AYWAYVG--LWGLLIGPVVAAYAGAGLGLEIVK 121

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            FFIT + F + S+YGYTTK+DL P G F+ M + G  +  +VN F++S      +S MG
Sbjct: 122 AFFITVSIFAATSIYGYTTKKDLAPWGKFLFMASIGFLVAIVVNFFLQSEMFSYLIS-MG 180

Query: 201 LVIF-SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +V+  SA+TAY+TQ ++  Y      A  +R S+ GA  LY  F+ +F+H+L  LG  RD
Sbjct: 181 VVLLVSAITAYETQMVRNLYVAGAGEA-NQRASIFGAFALYGSFVTLFIHILNLLGMTRD 239


>gi|160915437|ref|ZP_02077648.1| hypothetical protein EUBDOL_01445 [Eubacterium dolichum DSM 3991]
 gi|158432557|gb|EDP10846.1| hypothetical protein EUBDOL_01445 [Eubacterium dolichum DSM 3991]
          Length = 251

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 127/240 (52%), Gaps = 22/240 (9%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + GLR ++   +  M +GL  + +++ LV+                    LT    ++Y+
Sbjct: 32  ESGLRRHVAHTFLWMTIGLLTSALVALLVS--------------------LTDLVWVIYS 71

Query: 82  SPLR-WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
           S    WI + A  GV I L  R+ S+    A+++FL Y+ L G++ S+    Y   +I  
Sbjct: 72  SSWTPWILLIAQFGVVIALAARITSMKPSMARILFLAYAILTGVTFSTLGFAYDLGTIGA 131

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            F ITA  FG L+  G TTK +L   G  +++G F L +  L+ +   ++   +  +A+G
Sbjct: 132 AFLITAVYFGCLAFIGLTTKINLLRFGPILMIGLFALIVCELLLMLFGANTNTMVFAALG 191

Query: 201 LVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           L++F+ +TAYD QK+K  Y+  + D    +R S+  A  LY+DFI IF+++L+FLG R D
Sbjct: 192 LLLFTGITAYDAQKMKVLYTQYQGDEVMLKRLSIYSAFDLYLDFINIFLYVLQFLGDRND 251


>gi|281425118|ref|ZP_06256031.1| putative membrane protein [Prevotella oris F0302]
 gi|281400962|gb|EFB31793.1| putative membrane protein [Prevotella oris F0302]
          Length = 289

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 132/240 (55%), Gaps = 19/240 (7%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           + +   A M +VY  M L L ++GI+++ V        P+   +I    ++   +G ++ 
Sbjct: 67  LSEAFPALMRKVYLWMTLALAISGIVAYGV-----ATSPNLLYLIYTNQLVF--WGLIIT 119

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
              L W          I  ++   + S  A  +MF  ++AL G +LS  F+++   +I++
Sbjct: 120 ELVLVWK---------ISGSIWKENRSLAATTLMFATFAALNGATLSYIFILFAPTAIIK 170

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
           TFFIT+ +F   S YGY TK+DL   GSF+ M   GL +  + N+F +SS +D  +S  G
Sbjct: 171 TFFITSGTFAVTSAYGYFTKKDLSKWGSFLFMALGGLIIALVANIFFKSSMLDFIISIAG 230

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAY-AERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +++F  LT +D+Q IK   +   D++  +++ ++ GAL LY+DFI +F++LLR  G  RD
Sbjct: 231 VLLFVGLTIWDSQNIKRQLAVAPDMSETSQKIALCGALDLYLDFINLFIYLLRLFG--RD 288


>gi|299142122|ref|ZP_07035255.1| membrane protein [Prevotella oris C735]
 gi|298576211|gb|EFI48084.1| membrane protein [Prevotella oris C735]
          Length = 244

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 130/240 (54%), Gaps = 19/240 (7%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           + +   A M +VY  M L L ++GI+++          P+   +I    ++   +G ++ 
Sbjct: 22  LSEAFPALMRKVYLWMTLALAISGIVAY-----GVATSPNLLYLIYTNQLVF--WGLIIT 74

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
              L W          I  ++   + S  A  +MF  ++AL G +LS  F+ +   +I++
Sbjct: 75  ELVLVWK---------ISGSIWKENRSLAATTLMFATFAALNGATLSYIFIRFAPTAIIK 125

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
           TFFIT+ +F   S YGY TK+DL   GSF+ M   GL +  + N+F +SS +D  +S  G
Sbjct: 126 TFFITSGTFAVTSAYGYFTKKDLSKWGSFLFMALDGLIIALVANIFFKSSMLDFIISIAG 185

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAY-AERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +++F  LT +D+Q IK   +   D++  +++ ++ GAL LY+DFI +F++LLR  G  RD
Sbjct: 186 VLLFVGLTIWDSQNIKRQLAVAPDMSETSQKIALCGALDLYLDFINLFIYLLRLFG--RD 243


>gi|328956668|ref|YP_004374054.1| putative integral inner membrane protein [Carnobacterium sp. 17-4]
 gi|328672992|gb|AEB29038.1| putative integral inner membrane protein [Carnobacterium sp. 17-4]
          Length = 239

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 88/238 (36%), Positives = 126/238 (52%), Gaps = 20/238 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  +   +Y+ MA+GL +TGI +F             ++ I+N  V  T FG L     
Sbjct: 20  GLSKFFASIYSYMAVGLTITGITAFY---------ASQSAFILNL-VFGTRFGFLA---- 65

Query: 84  LRWIFIFAPLGVFIFLNVRLHSL-SAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
               F  A + + + L+     L SA A+ + F+ ++ + G+ LSS FL+Y   SI   F
Sbjct: 66  ----FFIAEIALVMKLSANGAKLKSAGASIVGFIAFAIINGIILSSIFLMYDLGSIGAAF 121

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGL 201
             TAASF  +SL G+TTK+DL  +G  +     GL +  LVN  F++S   D+ +S + +
Sbjct: 122 ISTAASFAGMSLVGFTTKKDLTSLGGQLRGALIGLIIAMLVNGFFLQSGPADMVLSFITV 181

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           VIF   TAYDTQK+KE Y            ++ GAL LY+DFI IF+ LLR  G  RD
Sbjct: 182 VIFIGFTAYDTQKLKELYVHHSGEENLGALAISGALSLYLDFINIFLGLLRIFGGGRD 239


>gi|295104333|emb|CBL01877.1| Integral membrane protein, interacts with FtsH [Faecalibacterium
           prausnitzii SL3/3]
          Length = 234

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 88/238 (36%), Positives = 126/238 (52%), Gaps = 29/238 (12%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT-SPLRW 86
           YM R Y  MALGL +T   +F   + ATT                     L Y  + L  
Sbjct: 20  YMTRTYRWMALGLLITFAAAF---VTATT--------------------PLFYVVNSLYL 56

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
           +F  A L + I L+ R+ ++S  AA+ +FL Y+ L G+ LS +FL +   ++V  F  T+
Sbjct: 57  LFTIAELALVIVLSARVQNMSVGAARGVFLGYALLNGMVLSYYFLAFDLGTLVLAFLATS 116

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFS 205
             FG +++YG TT +DL   G  ++M  F L +   V  LF       +  S +GLV+F 
Sbjct: 117 LYFGLMAVYGTTTHKDLSGWGPKLMMALFALIITGFVGVLFGMGFMGTVLYSGIGLVVFM 176

Query: 206 ALTAYDTQKIKEAYSDRY-DVAYAERQSVIGALMLYMDFIQIFVHLLRFLG---SRRD 259
            LTAYDTQK+ + YS    D   AE+ S+ GAL LY+DFI IF++++R LG    RRD
Sbjct: 177 LLTAYDTQKLSQMYSYYAGDSELAEKASIYGALTLYLDFINIFLYVVRLLGLNSRRRD 234


>gi|223983847|ref|ZP_03634011.1| hypothetical protein HOLDEFILI_01292 [Holdemania filiformis DSM
           12042]
 gi|223964171|gb|EEF68519.1| hypothetical protein HOLDEFILI_01292 [Holdemania filiformis DSM
           12042]
          Length = 233

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 82/258 (31%), Positives = 134/258 (51%), Gaps = 32/258 (12%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           ++Q VV+S  G        L  ++   +  M  GL VT I++FL                
Sbjct: 3   DHQEVVSSLGGVS------LSQHLTHTFLWMTAGLAVTAIVAFLT--------------- 41

Query: 66  INRGVMLTGFGALMYT---SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                + +G    +Y+   +PL  + + A LGV IFL  +L  +    AK++FL YSAL 
Sbjct: 42  -----LFSGLWMTIYSFSLAPL--VLLVAQLGVVIFLTGKLAKMQPSTAKLLFLAYSALT 94

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G++ S   L Y   ++   F  TA  FGS+++ G TTK+DL  +G  ++ G   + ++++
Sbjct: 95  GITFSILPLAYGFGTMFIAFGFTALMFGSMAVIGMTTKKDLSGLGPILMAGLITMIVITI 154

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEA-YSDRYDVAYAERQSVIGALMLYM 241
           V  F+   AI + M+ + + IF  LTAYD QK++   Y+   + A  ++ S+  AL LY+
Sbjct: 155 VGWFINLDAISMVMNYIMIGIFLGLTAYDMQKMRAMYYACESEPAMLDKISIYSALDLYL 214

Query: 242 DFIQIFVHLLRFLGSRRD 259
           DFI IF+++LR LG  + 
Sbjct: 215 DFINIFLYVLRILGRSQK 232


>gi|160944712|ref|ZP_02091939.1| hypothetical protein FAEPRAM212_02226 [Faecalibacterium prausnitzii
           M21/2]
 gi|158443896|gb|EDP20900.1| hypothetical protein FAEPRAM212_02226 [Faecalibacterium prausnitzii
           M21/2]
          Length = 220

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 87/238 (36%), Positives = 125/238 (52%), Gaps = 29/238 (12%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT-SPLRW 86
           YM R Y  MALGL +T   +F+     T   P                  L Y  + L  
Sbjct: 6   YMTRTYRWMALGLLITFAAAFV-----TATTP------------------LFYVVNSLYL 42

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
           +F  A L + I L+ R+ ++S  AA+ +FL Y+ L G+ LS +FL +   ++V  F  T+
Sbjct: 43  LFTIAELALVIVLSARVQNMSVGAARGVFLGYALLNGMVLSYYFLAFDLGTLVLAFLATS 102

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFS 205
             FG +++YG TT +DL   G  ++M  F L +   V  LF       +  S +GLV+F 
Sbjct: 103 LYFGLMAVYGTTTHKDLSGWGPKLMMALFALIITGFVGVLFGMGFMGTVLYSGIGLVVFM 162

Query: 206 ALTAYDTQKIKEAYSDRY-DVAYAERQSVIGALMLYMDFIQIFVHLLRFLG---SRRD 259
            LTAYDTQK+ + YS    D   AE+ S+ GAL LY+DFI IF++++R LG    RRD
Sbjct: 163 LLTAYDTQKLSQMYSYYAGDSELAEKASIYGALTLYLDFINIFLYVVRLLGLNSRRRD 220


>gi|269122236|ref|YP_003310413.1| hypothetical protein Sterm_3648 [Sebaldella termitidis ATCC 33386]
 gi|268616114|gb|ACZ10482.1| protein of unknown function UPF0005 [Sebaldella termitidis ATCC
           33386]
          Length = 241

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 76/225 (33%), Positives = 120/225 (53%), Gaps = 21/225 (9%)

Query: 36  MALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGV 95
           M +GL V+GI  FLV              + N  +M     +L++ + L ++  F  LG+
Sbjct: 36  MVVGLLVSGISGFLV--------------MTNVEIM-----SLIFGTNLYYVLFFVELGL 76

Query: 96  FIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLY 155
               ++ L   S  A + MFLLY+ L G++LS    +YT +SI+  F  T   +  L+ Y
Sbjct: 77  VFMFSMMLMKASVGALRGMFLLYAVLNGITLSIIGYIYTGESIIYVFLGTVVYYACLAAY 136

Query: 156 GYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKI 215
           GY T+ +LG    +++ G   L ++SL+N+FM++      MS  G++IFSA TA D   I
Sbjct: 137 GYLTRDNLGRYLPYVMAGLIALIVVSLLNIFMKNDYFYWIMSYAGVIIFSAFTAIDMNII 196

Query: 216 KEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +   +D    D    +R  + GAL LY+DFI +F++LLR  G +R
Sbjct: 197 RHRLTDYAMEDNTMLDRIQIAGALNLYLDFINLFLYLLRLFGKKR 241


>gi|313115248|ref|ZP_07800728.1| conserved hypothetical protein [Faecalibacterium cf. prausnitzii
           KLE1255]
 gi|310622441|gb|EFQ05916.1| conserved hypothetical protein [Faecalibacterium cf. prausnitzii
           KLE1255]
          Length = 236

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 72/181 (39%), Positives = 108/181 (59%), Gaps = 4/181 (2%)

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + L  +F  A L +   L+ R+ ++S   A+  F  Y+ L G+ LS +FL++   ++V  
Sbjct: 54  NSLYLVFTIAELVLVYVLSSRVQNMSVGGARATFFAYALLNGMVLSYYFLIFDLGTLVLA 113

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMG 200
           F  T+  FG +++YG TT +DL   G  ++MG F L +   V  LF  S    +  SA+G
Sbjct: 114 FLATSLYFGLMAVYGTTTHKDLSGWGPKLMMGLFALIITGFVGMLFGMSFLTTVLYSAVG 173

Query: 201 LVIFSALTAYDTQKIKEAYS-DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG--SR 257
           LV+F  LTAYDTQK+ + +S   YD   AE+ S+ GAL LY+DFI IF++++R LG  SR
Sbjct: 174 LVVFMLLTAYDTQKLSQMFSYYAYDGELAEKASIYGALTLYLDFINIFLYVVRLLGMNSR 233

Query: 258 R 258
           R
Sbjct: 234 R 234


>gi|227903421|ref|ZP_04021226.1| integral membrane protein, interacts with FtsH [Lactobacillus
           acidophilus ATCC 4796]
 gi|227868897|gb|EEJ76318.1| integral membrane protein, interacts with FtsH [Lactobacillus
           acidophilus ATCC 4796]
          Length = 266

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 103/178 (57%), Gaps = 1/178 (0%)

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + L W+ +F P+G+ + ++ +  + +  A  +M ++ + + G   +     YT   I   
Sbjct: 88  TALMWVILFVPIGLSLGISFK-ATRNPVAGFIMLMILAVIYGFEFALLAGYYTQAQIGTA 146

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +AA FGS++++G  TK++L  +GS+M     GLF+  +VN+F+R+S      S +G+
Sbjct: 147 FLSSAAVFGSMAIFGTFTKKNLNNLGSYMRAALIGLFVAMIVNMFLRNSVATFIFSIIGV 206

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           VIF+ LTAYD QK++  Y+   D       +V+GAL LY+DFI IF+ LL+  G   D
Sbjct: 207 VIFTGLTAYDAQKMRNIYNSYGDQVSTNGLAVLGALQLYLDFINIFLFLLQIFGMGND 264


>gi|293401590|ref|ZP_06645732.1| putative membrane protein [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291304848|gb|EFE46095.1| putative membrane protein [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 235

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 88/248 (35%), Positives = 135/248 (54%), Gaps = 39/248 (15%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +TI Q    + I+ +  M LGL +T +++F                    G++ T     
Sbjct: 17  TTIQQ----HAIKTFAWMGLGLLITALVAF--------------------GMVTTNMTLR 52

Query: 79  MYTS-PL-RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK 136
           +Y S P+   + +FA LGV +    RL  + A  A+++F+ YS L+G++ S+   VY   
Sbjct: 53  LYVSYPIAPMLLLFAQLGVAVAFAARLAKMKAATARILFVAYSILMGVTFSTLAFVYDLG 112

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDL---GPIGSFMIMGAFGLFLLSLVNLFMRSSAID 193
           SI   F ITA  FG L + GYTTK +L   GPI    +MG  GL  L +V + M    +D
Sbjct: 113 SIGIAFGITAVYFGCLVMIGYTTKMNLLRFGPI----LMG--GLLTLIIVEVVMTLLGMD 166

Query: 194 LT---MSAMGLVIFSALTAYDTQKIKEAY-SDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
           +T    +A+GL++F+ +TAYDTQK+K  Y S   D +   + S+  A  LY+DFI IF++
Sbjct: 167 ITTRGFTAIGLLLFTGITAYDTQKMKALYHSYEGDESMLSKLSIYSAFDLYLDFINIFLY 226

Query: 250 LLRFLGSR 257
           +LRF+G+R
Sbjct: 227 ILRFVGNR 234


>gi|163789887|ref|ZP_02184323.1| predicted inner membrane protein [Carnobacterium sp. AT7]
 gi|159874827|gb|EDP68895.1| predicted inner membrane protein [Carnobacterium sp. AT7]
          Length = 236

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 129/241 (53%), Gaps = 28/241 (11%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL-MYTSP 83
           L  +   +Y  M LGL +TGI +F             +S I+N  V  T FG L  + + 
Sbjct: 18  LSKFFASIYIYMTLGLSITGITAFY---------ASQSSFILNL-VFGTRFGMLAFFIAE 67

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           +  +   A  G       +L S  A A+ + F+ ++ + G++LSS FL+Y   SI   F 
Sbjct: 68  IALVMKLASNGA------KLRS--ASASIIGFIAFAVINGITLSSIFLMYDLGSIGAAFI 119

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLV 202
            TAASF  +SL G+TTK+DL  +G  +     GL +  LVN  F++S   D+ +S + +V
Sbjct: 120 STAASFAGMSLVGFTTKKDLTTLGGQLRGALIGLIIAMLVNGFFLKSGPADMVLSFITVV 179

Query: 203 IFSALTAYDTQKIKEAYSDRYDVAYAERQ----SVIGALMLYMDFIQIFVHLLRFLGSRR 258
           IF   TAYDTQK+K+ Y+ RY     E+     ++ GAL LY+DFI IF+ LLR  G  R
Sbjct: 180 IFIGFTAYDTQKLKDLYT-RYS---GEQNLGALAISGALSLYLDFINIFIGLLRIFGGGR 235

Query: 259 D 259
           D
Sbjct: 236 D 236


>gi|291457704|ref|ZP_06597094.1| inner membrane protein YbhL [Bifidobacterium breve DSM 20213]
 gi|291380757|gb|EFE88275.1| inner membrane protein YbhL [Bifidobacterium breve DSM 20213]
          Length = 273

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 142/267 (53%), Gaps = 35/267 (13%)

Query: 5   RNYQRVVNSGSGFGSTI---------DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILAT 55
           +NYQ     G+G G+T          ++  RA + +VY  M +G+ VT I++F+      
Sbjct: 27  QNYQYAAQ-GTGAGTTAINTTMTYSYEEARRASVTKVYGEMTIGVIVTAIVAFI------ 79

Query: 56  TVDPDAASIIINRGVMLTGFGA-LMYTSPLRWI-FIFAPLGVFIFLNVRLHSLSAYAAKM 113
                        G M   + A L  T  +  I      +G+ + L  R+  + +  A++
Sbjct: 80  -------------GQMTGAYYAFLASTGAIGLIALCVVQVGLAVVLGARVTKMKSGTARV 126

Query: 114 MFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMG 173
           MF +Y+AL+G +LSS F+VY+  SIV    ITAA F +L+++G TTK ++   G  +++G
Sbjct: 127 MFYVYAALMGFTLSSIFMVYSLGSIVTALGITAAFFFALTMFGMTTKINMLKAGPILMIG 186

Query: 174 AFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---R 230
              L +  LV +F+    +   + A+GL++F+ +T YD Q  + A   +Y+    E   R
Sbjct: 187 LIVLIISQLVLMFLHVDGMTQIVCALGLILFAGMTIYDAQSTR-ALLSQYEAQGPEMVKR 245

Query: 231 QSVIGALMLYMDFIQIFVHLLRFLGSR 257
            S++ AL LY+DF+ +F+++L+ LG+R
Sbjct: 246 VSILCALNLYLDFVNMFLYILQLLGNR 272


>gi|315037785|ref|YP_004031353.1| hypothetical protein LA2_02890 [Lactobacillus amylovorus GRL 1112]
 gi|325956260|ref|YP_004286870.1| hypothetical protein LAC30SC_02795 [Lactobacillus acidophilus 30SC]
 gi|312275918|gb|ADQ58558.1| hypothetical protein LA2_02890 [Lactobacillus amylovorus GRL 1112]
 gi|325332825|gb|ADZ06733.1| hypothetical protein LAC30SC_02795 [Lactobacillus acidophilus 30SC]
 gi|327183076|gb|AEA31523.1| hypothetical protein LAB52_02735 [Lactobacillus amylovorus GRL
           1118]
          Length = 236

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 101/178 (56%), Gaps = 1/178 (0%)

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + L WI +  PLG+ + ++ R  + +  A  +M ++ + + G   +     YT   I   
Sbjct: 58  TALMWIILIVPLGLSMGISFR-ATRNPVAGFVMLMILAVIYGFEFALLAGFYTGAQISTA 116

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +AA FG+++++G  TKRDL  +GS+M     GL +  +VN+F+R+S      S +G+
Sbjct: 117 FLSSAAVFGAMAIFGTFTKRDLNNLGSYMGAALIGLLVAMIVNIFLRNSVASFVFSIIGV 176

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +IF+ LTAYD QK+K  Y++          +V+GAL LY+DFI IF+ LL+  G   D
Sbjct: 177 IIFTGLTAYDAQKMKSIYNNYGSQVPTNGLAVLGALQLYLDFINIFLFLLQIFGMGND 234


>gi|157151682|ref|YP_001449841.1| membrane protein [Streptococcus gordonii str. Challis substr. CH1]
 gi|157076476|gb|ABV11159.1| membrane protein [Streptococcus gordonii str. Challis substr. CH1]
          Length = 228

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 130/242 (53%), Gaps = 29/242 (11%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            G+  +  ++Y+L+ +GLG++ I+S L                     ML+ F +++ + 
Sbjct: 11  SGINTFYAKIYSLVGVGLGISAIVSAL---------------------MLSMFQSVIVSV 49

Query: 83  PL--RWIF---IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
            +   WIF   I A L + +F    +   ++ AA  +FLLYSAL G +LS    +YT  S
Sbjct: 50  LMGSTWIFYVAIAAEL-ILVFAASGMAVKNSPAALPLFLLYSALNGFTLSIVLALYTQSS 108

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           ++  F   +A F +++  G  TK+DL  +G  +    FGL + S+VN+F+R+ + D  +S
Sbjct: 109 VLSAFVTASAMFFAMAFIGKVTKKDLSGMGRALRAALFGLIIASVVNIFLRNGSFDFLIS 168

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
             G++IFS L A+D QKI+  Y +R +       +V  AL LY+DFI +F+ LLR  G R
Sbjct: 169 IAGVIIFSGLIAWDNQKIRYVY-ERSNGQVENGWAVSLALSLYLDFINLFLSLLRLFG-R 226

Query: 258 RD 259
            D
Sbjct: 227 ND 228


>gi|126728995|ref|ZP_01744810.1| hypothetical protein SSE37_09208 [Sagittula stellata E-37]
 gi|126710925|gb|EBA09976.1| hypothetical protein SSE37_09208 [Sagittula stellata E-37]
          Length = 247

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 126/238 (52%), Gaps = 29/238 (12%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           + ID+GLRA+M +VY LM+  L +T  +++LV          A+S  + +         +
Sbjct: 18  AQIDEGLRAHMNKVYALMSGALLMTFALAYLV----------ASSPALQQ---------V 58

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +  SP+ W+ IF PL   +  +   H LS  A   +F  Y+AL G+SL++ F+++    +
Sbjct: 59  LLVSPVVWVVIFGPLAFVMIASFAFHKLSVVALNGLFWAYAALTGVSLATIFIMFDMMQV 118

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAID--LTM 196
           +     TA +F  LSL GY TKR+LGP+    +M  +GL   +L+++       +    M
Sbjct: 119 ITGLAYTAVAFLGLSLTGYLTKRNLGPVHQVAVMMTWGLVAFALISMLFGGMGGNTFWWM 178

Query: 197 SAMGLVIFSALTAYDTQKIKEAYSD-------RYDVAYAERQSVIGALMLYMDFIQIF 247
           +   L +F+ LTA  TQ+IK  Y +         D+ + E+ ++IGAL LY+ FI +F
Sbjct: 179 NVAILGLFAVLTATSTQEIKNTYLEARTHGGPEADL-FLEKAAIIGALQLYISFIAMF 235


>gi|196017669|ref|XP_002118604.1| hypothetical protein TRIADDRAFT_34469 [Trichoplax adhaerens]
 gi|190578645|gb|EDV18908.1| hypothetical protein TRIADDRAFT_34469 [Trichoplax adhaerens]
          Length = 108

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 154 LYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQ 213
           +YG+TTK+DL  +GSF+IMG  GL + S+VN+FM++ A+   +S +G+++F+  TAYD+Q
Sbjct: 1   IYGHTTKKDLTSMGSFLIMGVVGLLIASVVNIFMQNGAMQFVISIVGVLVFTLFTAYDSQ 60

Query: 214 KIKEA-YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +IK   Y  R +    ++ +V G+L LYMDFI +FV LL+ LG RRD
Sbjct: 61  RIKALYYQTRSNAEVTQKLAVYGSLTLYMDFINLFVFLLQLLGVRRD 107


>gi|262282152|ref|ZP_06059921.1| membrane protein [Streptococcus sp. 2_1_36FAA]
 gi|262262606|gb|EEY81303.1| membrane protein [Streptococcus sp. 2_1_36FAA]
          Length = 228

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 130/242 (53%), Gaps = 29/242 (11%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            G+  +  ++Y+L+ +GLG++ I+S L                     ML+ F +++ + 
Sbjct: 11  SGINTFYAKIYSLVGVGLGISAIVSAL---------------------MLSMFQSVIVSV 49

Query: 83  PL--RWIF---IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
            +   WIF   I A L + +F    +   ++ AA  +FL+YSAL G +LS    +YT  S
Sbjct: 50  LMGSTWIFYVAIAAEL-ILVFAASGMAVKNSPAALPLFLVYSALNGFTLSIVLALYTQSS 108

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           ++  F   +A F +++  G  TK+DL  +G  +    FGL + S+VN+F+R+ + D  +S
Sbjct: 109 VLSAFVTASAMFFAMAFIGKVTKKDLSGMGRALRAALFGLIIASVVNIFLRNGSFDFLIS 168

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
             G++IFS L A+D QKI+  Y +R +       +V  AL LY+DFI +F+ LLR  G R
Sbjct: 169 IAGVIIFSGLIAWDNQKIRYVY-ERSNGQVENGWAVSLALSLYLDFINLFLSLLRLFG-R 226

Query: 258 RD 259
            D
Sbjct: 227 ND 228


>gi|227513547|ref|ZP_03943596.1| integral membrane protein, interacts with FtsH [Lactobacillus
           buchneri ATCC 11577]
 gi|227524690|ref|ZP_03954739.1| integral membrane protein, interacts with FtsH [Lactobacillus
           hilgardii ATCC 8290]
 gi|227083420|gb|EEI18732.1| integral membrane protein, interacts with FtsH [Lactobacillus
           buchneri ATCC 11577]
 gi|227088174|gb|EEI23486.1| integral membrane protein, interacts with FtsH [Lactobacillus
           hilgardii ATCC 8290]
          Length = 235

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/256 (33%), Positives = 133/256 (51%), Gaps = 32/256 (12%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA 61
           S+ RN +RVVN+ +G        L A++ ++Y  M+L + V+   +FL     TTV  D 
Sbjct: 5   SNERNERRVVNNAAG--------LNAFLTKMYGWMSLAVLVSAATAFLT---VTTVSRD- 52

Query: 62  ASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
                    +L G G  M+ + + W  +  P  V  F  ++  SL A+AA M    Y+ L
Sbjct: 53  ---------VLNGGG--MWIAIIAWFIL--PF-VVSFQALKRPSL-AFAALMG---YAVL 94

Query: 122 IGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS 181
            G   S+    YT  SI   F   +A F +++++G  T+++L  IG   I     L +  
Sbjct: 95  SGFVFSTLAYRYTGASIAAAFVSASAIFITMTVFGLVTRKNLDKIGRQAIAALIALVIAM 154

Query: 182 LVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQ--SVIGALML 239
           ++N+F+RSS I    S + +VIF+ALTAYDTQK+K+ Y+             +V GAL L
Sbjct: 155 IINIFLRSSLITFVFSIIAVVIFTALTAYDTQKMKQMYNQAGSTGQVSVSGLAVFGALQL 214

Query: 240 YMDFIQIFVHLLRFLG 255
           Y+DF+ +F+ LL+  G
Sbjct: 215 YLDFVNLFLQLLQIFG 230


>gi|257469849|ref|ZP_05633941.1| integral membrane protein [Fusobacterium ulcerans ATCC 49185]
          Length = 238

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 72/220 (32%), Positives = 123/220 (55%), Gaps = 20/220 (9%)

Query: 46  MSFLVNILATTVDPDAASIIINRGVMLTGFGA-LMYT-SPLRWIFIFAPLGVFIFLNVRL 103
           ++ ++ +L TT+ P          + L GF A L+Y   P   I +FA + +   L++ +
Sbjct: 31  LNMVIGVLITTLVP----------IYLFGFNARLLYAIMPYFKIIMFAEIALVFGLSLGI 80

Query: 104 HSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDL 163
           + +S+  A+MMF LYS + G+  SS   V+   SI  T  +    F  ++ YGYTT  DL
Sbjct: 81  NKMSSGTARMMFFLYSLMNGILFSSLGFVFHPVSIFYTLGVALIMFIVIAAYGYTTSEDL 140

Query: 164 GPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY 223
              G +++ G   + ++S++N F+++  +    + +G+VIFSAL AYD  +IK+     +
Sbjct: 141 SNYGKYLMTGLISIIIMSVINFFLKAPFLYWIGTVLGIVIFSALIAYDVNRIKKI---AF 197

Query: 224 DVAYAERQS-----VIGALMLYMDFIQIFVHLLRFLGSRR 258
            +A  + ++     +IGAL LY+DFI +F++LLR  G RR
Sbjct: 198 QMANGDEEAMNKLGIIGALNLYLDFINLFLYLLRIFGKRR 237


>gi|317064078|ref|ZP_07928563.1| integral membrane protein [Fusobacterium ulcerans ATCC 49185]
 gi|313689754|gb|EFS26589.1| integral membrane protein [Fusobacterium ulcerans ATCC 49185]
          Length = 230

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 73/217 (33%), Positives = 121/217 (55%), Gaps = 14/217 (6%)

Query: 46  MSFLVNILATTVDPDAASIIINRGVMLTGFGA-LMYT-SPLRWIFIFAPLGVFIFLNVRL 103
           ++ ++ +L TT+ P          + L GF A L+Y   P   I +FA + +   L++ +
Sbjct: 23  LNMVIGVLITTLVP----------IYLFGFNARLLYAIMPYFKIIMFAEIALVFGLSLGI 72

Query: 104 HSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDL 163
           + +S+  A+MMF LYS + G+  SS   V+   SI  T  +    F  ++ YGYTT  DL
Sbjct: 73  NKMSSGTARMMFFLYSLMNGILFSSLGFVFHPVSIFYTLGVALIMFIVIAAYGYTTSEDL 132

Query: 164 GPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE-AYS-D 221
              G +++ G   + ++S++N F+++  +    + +G+VIFSAL AYD  +IK+ A+   
Sbjct: 133 SNYGKYLMTGLISIIIMSVINFFLKAPFLYWIGTVLGIVIFSALIAYDVNRIKKIAFQMA 192

Query: 222 RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             D     +  +IGAL LY+DFI +F++LLR  G RR
Sbjct: 193 NGDEEAMNKLGIIGALNLYLDFINLFLYLLRIFGKRR 229


>gi|225389055|ref|ZP_03758779.1| hypothetical protein CLOSTASPAR_02800 [Clostridium asparagiforme
           DSM 15981]
 gi|225044877|gb|EEG55123.1| hypothetical protein CLOSTASPAR_02800 [Clostridium asparagiforme
           DSM 15981]
          Length = 236

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 66/184 (35%), Positives = 105/184 (57%), Gaps = 3/184 (1%)

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           L Y     ++ +FA LGV +FL+ R+  +S   A+++F +Y+ L G+  S++F VY    
Sbjct: 54  LNYVPAWPYVLLFAELGVVLFLSARISKMSVVTARVLFFVYAILNGIVFSAYFYVYDLMI 113

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           +   F +T+  FG ++L GY    +   I  FM  G   L    +++LF+  SA +    
Sbjct: 114 LWSVFLLTSLFFGVMALIGYFANVNFSGIRPFMTGGLIFLCGFWVLSLFINLSAFETIAC 173

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVA--YAERQSVIGALMLYMDFIQIFVHLLRFLG 255
            +G+ IF   TAYDT+KIK AY + Y  A   A + S+  AL LY+DFI +F+++LR LG
Sbjct: 174 TVGIFIFLLFTAYDTKKIK-AYYEYYGQAPEMAAKASIFSALQLYLDFINLFLYILRILG 232

Query: 256 SRRD 259
            +R+
Sbjct: 233 RKRN 236


>gi|227510538|ref|ZP_03940587.1| integral membrane protein, interacts with FtsH [Lactobacillus
           brevis subsp. gravesensis ATCC 27305]
 gi|227190190|gb|EEI70257.1| integral membrane protein, interacts with FtsH [Lactobacillus
           brevis subsp. gravesensis ATCC 27305]
          Length = 235

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 83/256 (32%), Positives = 133/256 (51%), Gaps = 32/256 (12%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA 61
           S+ RN +RVVN+ +G        L A++ ++Y  M+L + V+   +FL     T + P  
Sbjct: 5   SNERNERRVVNNAAG--------LNAFLTKMYGWMSLAVLVSAATAFLT---VTAISP-- 51

Query: 62  ASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
                    +LTG G  M+ + + W  +  P  V  F  ++  SL A+AA M    Y+ L
Sbjct: 52  --------AVLTGGG--MWIAIIAWFIL--PF-VVSFQALKRPSL-AFAALMG---YAVL 94

Query: 122 IGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS 181
            G   S+    YT  SI   F   +A F +++++G  T+++L  IG   I     L +  
Sbjct: 95  SGFVFSTLAYRYTGASIAAAFVSASAIFITMTVFGLVTRKNLDKIGRQAIAALIALVIAM 154

Query: 182 LVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQ--SVIGALML 239
           ++N+F+RS+ I    S + +VIF+ALTAYDTQK+K+ Y+             +V GAL L
Sbjct: 155 IINIFLRSTLITFVFSIIAVVIFTALTAYDTQKMKQMYNQAGSTGQVSVSGLAVFGALQL 214

Query: 240 YMDFIQIFVHLLRFLG 255
           Y+DF+ +F+ LL+  G
Sbjct: 215 YLDFVNLFLQLLQIFG 230


>gi|259046638|ref|ZP_05737039.1| membrane protein [Granulicatella adiacens ATCC 49175]
 gi|259036803|gb|EEW38058.1| membrane protein [Granulicatella adiacens ATCC 49175]
          Length = 238

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 83/239 (34%), Positives = 122/239 (51%), Gaps = 15/239 (6%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
           +G   + ++VY  M  G+ ++ ++++L    +TT  P   S+  N  V   G+G      
Sbjct: 13  EGRNQFFMKVYGWMFGGIAISAVVAYL---FSTT--PALFSLFYNFMVKTHGYG------ 61

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKM-MFLLYSALIGLSLSSFFLVYTSKSIVQT 141
              W      L +   +      L      M M+ LY+AL GL+  +   VY   SIVQ 
Sbjct: 62  --MWGIFLLQLVLVFLMRPDYEKLGNPIRYMVMYCLYAALTGLTFFTLTFVYDLGSIVQA 119

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM-RSSAIDLTMSAMG 200
           F  T A F  LS+ G+TTK+DL   G   +    GL + S +NLF  RSS ++  MS + 
Sbjct: 120 FASTCALFVGLSVVGFTTKKDLTGWGQQALGALIGLIIASALNLFFFRSSMVEWIMSGIS 179

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           L+IF  LT YDTQK+K  Y      +  E  +++GAL LY+DFI IF+ +LR  GS +D
Sbjct: 180 LIIFIILTIYDTQKLKRMYDYFEGQSALEGIAILGALELYLDFINIFLDILRLFGSGKD 238


>gi|295102755|emb|CBL00300.1| Integral membrane protein, interacts with FtsH [Faecalibacterium
           prausnitzii L2-6]
          Length = 235

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 80/231 (34%), Positives = 123/231 (53%), Gaps = 26/231 (11%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY-TSPLRW 86
           YM R Y  MA GL VT  M++   I+ATT                    +L+Y  + L +
Sbjct: 20  YMTRTYRWMAGGLLVTFAMAY---IMATT--------------------SLIYLVNSLYF 56

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
           +     L +   L+ R+  +S   A+  F  Y+ L G+ LS +FL+++  ++V  F  TA
Sbjct: 57  LLTIGELALVFMLSARVQKMSIDGARAAFFGYAILNGMVLSYYFLMFSVGTLVMAFLATA 116

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFS 205
             FG +++YG TT +DL   G  ++M    + + SLV  LF       +    +GLV+F 
Sbjct: 117 VYFGLMAVYGTTTHKDLTGWGPRLMMALVAMIVTSLVGALFGFGFGASVLYCGIGLVVFM 176

Query: 206 ALTAYDTQKIKEAYSDRY-DVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
            LTAYDTQK+++ Y+    D   AE+ S+ GAL LY+DFI IF++++R LG
Sbjct: 177 LLTAYDTQKLRQIYAYYAGDAELAEKASIYGALTLYLDFINIFLYVVRLLG 227


>gi|323467073|gb|ADX70760.1| Integral membrane protein [Lactobacillus helveticus H10]
          Length = 238

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 107/186 (57%), Gaps = 4/186 (2%)

Query: 77  ALMYTSP-LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTS 135
           A+M   P + WI +F P+G+ + +N +  + +  A  +M ++ + + G   +     YT 
Sbjct: 54  AVMQMPPAMMWIILFVPIGLSLGINFK-ATRNPVAGFVMLMILAVIYGFEFALLAGFYTQ 112

Query: 136 KSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLT 195
             I   F  +AA FG+++++G  TK++L  +GS++     GL +  +VN+F+R+S     
Sbjct: 113 AQIGTAFVSSAAVFGAMAVFGTFTKKNLNNMGSYLSAALIGLLVAMVVNIFLRNSVASFV 172

Query: 196 MSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF-- 253
            S +G+VIF+ LTAYD QK+K  Y++          +V+GAL LY+DF+ IF+ LL+   
Sbjct: 173 FSIIGVVIFTGLTAYDAQKMKAIYNNYGSQVSTNGLAVLGALQLYLDFVNIFLFLLQIFG 232

Query: 254 LGSRRD 259
           +G  RD
Sbjct: 233 MGGDRD 238


>gi|213852350|ref|ZP_03381882.1| hypothetical protein SentesT_05374 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
          Length = 113

 Score =  105 bits (262), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (67%), Gaps = 2/112 (1%)

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V+F  LT
Sbjct: 2   FGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVVVFVGLT 61

Query: 209 AYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K      D  D A   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 62  AYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR 113


>gi|108807067|ref|YP_650983.1| hypothetical protein YPA_1071 [Yersinia pestis Antiqua]
 gi|108778980|gb|ABG13038.1| putative membrane protein [Yersinia pestis Antiqua]
          Length = 113

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 78/112 (69%), Gaps = 2/112 (1%)

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++S YGYTTKRDL  +GS + MG  G+ L SLVN++++S A+   ++ +G+++F  LT
Sbjct: 2   FGAMSFYGYTTKRDLSGMGSMLFMGLIGIILASLVNIWLKSPALMWVVTYIGVLVFVGLT 61

Query: 209 AYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K   A  D  D     + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 62  AYDTQKLKNLGAQLDVNDKDSFRKYSIVGALTLYLDFINLFLMLLRIFGNRR 113


>gi|328462078|gb|EGF34251.1| hypothetical protein AAULH_03081 [Lactobacillus helveticus MTCC
           5463]
          Length = 234

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 107/186 (57%), Gaps = 4/186 (2%)

Query: 77  ALMYTSP-LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTS 135
           A+M   P + WI +F P+G+ + +N +  + +  A  +M ++ + + G   +     YT 
Sbjct: 50  AVMQMPPAMMWIILFVPIGLSLGINFK-ATRNPVAGFVMLMILAVIYGFEFALLAGFYTQ 108

Query: 136 KSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLT 195
             I   F  +AA FG+++++G  TK++L  +GS++     GL +  +VN+F+R+S     
Sbjct: 109 AQIGTAFVSSAAVFGAMAVFGTFTKKNLNNMGSYLSAALIGLLVAMVVNIFLRNSVASFV 168

Query: 196 MSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF-- 253
            S +G+VIF+ LTAYD QK+K  Y++          +V+GAL LY+DF+ IF+ LL+   
Sbjct: 169 FSIIGVVIFTGLTAYDAQKMKAIYNNYGSQVSTNGLAVLGALQLYLDFVNIFLFLLQIFG 228

Query: 254 LGSRRD 259
           +G  RD
Sbjct: 229 MGGDRD 234


>gi|161507075|ref|YP_001577029.1| hypothetical protein lhv_0560 [Lactobacillus helveticus DPC 4571]
 gi|260102787|ref|ZP_05753024.1| integral membrane protein [Lactobacillus helveticus DSM 20075]
 gi|160348064|gb|ABX26738.1| hypothetical protein lhv_0560 [Lactobacillus helveticus DPC 4571]
 gi|260083391|gb|EEW67511.1| integral membrane protein [Lactobacillus helveticus DSM 20075]
          Length = 234

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 107/186 (57%), Gaps = 4/186 (2%)

Query: 77  ALMYTSP-LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTS 135
           A+M   P + WI +F P+G+ + +N +  + +  A  +M ++ + + G   +     YT 
Sbjct: 50  AVMQMPPAMMWIILFVPIGLSLGINFK-ATRNPVAGFVMLMILAVIYGFEFALLAGFYTQ 108

Query: 136 KSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLT 195
             I   F  +AA FG+++++G  TK++L  +GS++     GL +  +VN+F+R+S     
Sbjct: 109 AQIGTAFVSSAAVFGAMAVFGTFTKKNLNNMGSYLSAALIGLLVAMVVNIFLRNSVASFV 168

Query: 196 MSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF-- 253
            S +G+VIF+ LTAYD QK+K  Y++          +V+GAL LY+DF+ IF+ LL+   
Sbjct: 169 FSIIGVVIFTGLTAYDAQKMKAIYNNYGSQVSTNGLAVLGALQLYLDFVNIFLFLLQIFG 228

Query: 254 LGSRRD 259
           +G  RD
Sbjct: 229 MGGDRD 234


>gi|116492455|ref|YP_804190.1| integral membrane protein, interacts with FtsH [Pediococcus
           pentosaceus ATCC 25745]
 gi|116102605|gb|ABJ67748.1| Integral membrane protein, interacts with FtsH [Pediococcus
           pentosaceus ATCC 25745]
          Length = 232

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 126/239 (52%), Gaps = 18/239 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + GL  ++ ++Y  MA  +  +G++++L     TT+   A    +++G M          
Sbjct: 11  EIGLNRFLTKMYGWMAAAVAFSGVIAYL----GTTIWRPAVMTFLSQGRMSI-------- 58

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
               W+ IF  L +F+    +    +   + +M   +SA  G++LSS F++Y++ +I   
Sbjct: 59  ----WV-IFVALFLFMIFGQKAALQNPTVSFLMLFAFSAFFGITLSSVFMLYSTATIAGA 113

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL-FMRSSAIDLTMSAMG 200
           FF  A+ F  +S+ G TTKRDL  +G+ +I     + ++S++NL F+ SSA+    S +G
Sbjct: 114 FFSAASVFIVMSVMGVTTKRDLSRMGNHLIAALIAMVVVSVINLFFLHSSAVTFFFSIIG 173

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +VIF+ L+ YDT  +K  Y +  D       ++ GA  LY+DFI +F + L   G  RD
Sbjct: 174 IVIFAGLSMYDTATMKRLYLNYGDQVSETGLAIQGAFSLYLDFINLFQYFLTIFGWNRD 232


>gi|258508757|ref|YP_003171508.1| integral membrane protein [Lactobacillus rhamnosus GG]
 gi|257148684|emb|CAR87657.1| Integral membrane protein, interacts with FtsH [Lactobacillus
           rhamnosus GG]
 gi|259650063|dbj|BAI42225.1| conserved hypothetical protein [Lactobacillus rhamnosus GG]
          Length = 236

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 125/252 (49%), Gaps = 29/252 (11%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
           +RVVN         + GL  +  R+Y LM  GL VT ++S+L   L  T+  D  + +  
Sbjct: 4   RRVVN---------EAGLTQFFSRIYTLMGSGLVVTALVSYL---LGVTLKNDYINFVGA 51

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
             ++              WI    PL +  F+  R    S   A +MF L SA  G + +
Sbjct: 52  HPIIF-------------WIMTALPLILSFFVTGRRAQASPGYATLMFYLMSASFGFTFA 98

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
           S  +V  + ++      TA  F  +S+ G+  KRDL   G+  +   FG+ ++ LVN+FM
Sbjct: 99  SVAMVAKTSNLAVALATTAVVFFVMSMVGHFGKRDLSKAGNIAMSALFGVIIMMLVNMFM 158

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY----SDRYDVAYAERQSVIGALMLYMDF 243
            SS + + +S   L+IF  LTA+DTQ++K  Y    SD          +V+GALMLY+DF
Sbjct: 159 GSSGMQMLISYAILIIFIVLTAWDTQRLKNLYLTAGSDGQAAISTSSLAVVGALMLYLDF 218

Query: 244 IQIFVHLLRFLG 255
           + +F  +L+ LG
Sbjct: 219 LNLFTAILQILG 230


>gi|257437828|ref|ZP_05613583.1| putative membrane protein [Faecalibacterium prausnitzii A2-165]
 gi|257199751|gb|EEU98035.1| putative membrane protein [Faecalibacterium prausnitzii A2-165]
          Length = 233

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 130/259 (50%), Gaps = 33/259 (12%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D RNY R      G+          YM R Y  MA GL +T  M++L    ATT      
Sbjct: 2   DYRNYDR------GYAEP-TMSASDYMTRTYRWMACGLLITFAMAYLT---ATT------ 45

Query: 63  SIIINRGVMLTGFGALMY-TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
                         +L+Y    L  +   A L +   L+ R+ ++S  AA+  F  Y+ L
Sbjct: 46  --------------SLIYLVDSLYLVLTIAELALVFVLSSRVQTMSVGAARATFFGYALL 91

Query: 122 IGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL-L 180
            G+ LS +FLV+++ +++     T+  FG +++YG TT +DL   G  ++M    + +  
Sbjct: 92  NGMVLSYYFLVFSASTLIMALLATSLYFGLMAVYGTTTHKDLTGWGPRLMMALVAMIITG 151

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYS-DRYDVAYAERQSVIGALML 239
            +  LF       +    +GLV+F  LTAYDTQK+++ YS    D   AE+ S+ GAL L
Sbjct: 152 FVGMLFGFGFGGSVLYCGIGLVVFMLLTAYDTQKLQQMYSYYSADAEMAEKASIYGALTL 211

Query: 240 YMDFIQIFVHLLRFLGSRR 258
           Y+DFI IF++++R +G+ R
Sbjct: 212 YLDFINIFLYVVRLMGNNR 230


>gi|229545506|ref|ZP_04434231.1| integral membrane protein [Enterococcus faecalis TX1322]
 gi|256619388|ref|ZP_05476234.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|256853428|ref|ZP_05558798.1| conserved hypothetical protein [Enterococcus faecalis T8]
 gi|257087119|ref|ZP_05581480.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|257090196|ref|ZP_05584557.1| predicted protein [Enterococcus faecalis CH188]
 gi|307275648|ref|ZP_07556789.1| membrane family protein [Enterococcus faecalis TX2134]
 gi|307295971|ref|ZP_07575803.1| membrane family protein [Enterococcus faecalis TX0411]
 gi|312902692|ref|ZP_07761896.1| membrane family protein [Enterococcus faecalis TX0635]
 gi|229309422|gb|EEN75409.1| integral membrane protein [Enterococcus faecalis TX1322]
 gi|256598915|gb|EEU18091.1| conserved hypothetical protein [Enterococcus faecalis ATCC 4200]
 gi|256711887|gb|EEU26925.1| conserved hypothetical protein [Enterococcus faecalis T8]
 gi|256995149|gb|EEU82451.1| conserved hypothetical protein [Enterococcus faecalis D6]
 gi|256999008|gb|EEU85528.1| predicted protein [Enterococcus faecalis CH188]
 gi|306496302|gb|EFM65881.1| membrane family protein [Enterococcus faecalis TX0411]
 gi|306507753|gb|EFM76882.1| membrane family protein [Enterococcus faecalis TX2134]
 gi|310633746|gb|EFQ17029.1| membrane family protein [Enterococcus faecalis TX0635]
 gi|315025918|gb|EFT37850.1| membrane family protein [Enterococcus faecalis TX2137]
 gi|315028956|gb|EFT40888.1| membrane family protein [Enterococcus faecalis TX4000]
 gi|315033230|gb|EFT45162.1| membrane family protein [Enterococcus faecalis TX0017]
 gi|315143490|gb|EFT87506.1| membrane family protein [Enterococcus faecalis TX2141]
 gi|315147573|gb|EFT91589.1| membrane family protein [Enterococcus faecalis TX4244]
 gi|315149311|gb|EFT93327.1| membrane family protein [Enterococcus faecalis TX0012]
 gi|315161517|gb|EFU05534.1| membrane family protein [Enterococcus faecalis TX0645]
 gi|315576955|gb|EFU89146.1| membrane family protein [Enterococcus faecalis TX0630]
 gi|323481050|gb|ADX80489.1| conserved hypothetical protein [Enterococcus faecalis 62]
          Length = 228

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 75/254 (29%), Positives = 129/254 (50%), Gaps = 28/254 (11%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N Q  + +G+G        L  +  ++Y  +ALG+G++ IM++    + T   P  A+  
Sbjct: 2   NNQEYIQTGTG--------LNKFYAKIYGFLALGIGISAIMAY---AMTTVFLPVLAT-- 48

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                       L  +S   W+     +G+ ++L  +    +   A   F+ Y+ L G++
Sbjct: 49  ------------LFQSSLAFWMIWLVEIGLVLYLGAKAQK-NPTIAIAGFVAYALLNGVT 95

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LS   L+YT  ++   F   AA+FG++SL G  TK+DL  +G        G+ +  L+N+
Sbjct: 96  LSVTLLMYTGGTVAGAFLSAAATFGAMSLVGVFTKKDLSAVGHAAYSALIGIIIAMLLNM 155

Query: 186 F-MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
           F + SSA++  +S + ++IFS +TAYD Q+I++ Y+   D A     +V  AL LY+DFI
Sbjct: 156 FLLHSSAVEFFISILMVLIFSGITAYDNQRIRQVYAQTGDQA-GTGMAVFFALQLYLDFI 214

Query: 245 QIFVHLLRFLGSRR 258
            +F+  LR  G   
Sbjct: 215 NLFLAFLRIFGKNN 228


>gi|253584240|ref|ZP_04861438.1| integral membrane protein [Fusobacterium varium ATCC 27725]
 gi|251834812|gb|EES63375.1| integral membrane protein [Fusobacterium varium ATCC 27725]
          Length = 238

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 122/217 (56%), Gaps = 14/217 (6%)

Query: 46  MSFLVNILATTVDPDAASIIINRGVMLTGFGA-LMYT-SPLRWIFIFAPLGVFIFLNVRL 103
           ++ +V +L TT+ P          + L GF A L+Y   P   I +FA + +   L++ +
Sbjct: 31  LNMVVGVLITTIVP----------IYLFGFNARLLYAIMPYFKIIMFAEIALVFGLSLGI 80

Query: 104 HSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDL 163
           + +S+  A+MMF LYS + G+  SS   V+   SI  T  +    F  ++ YGYTTK DL
Sbjct: 81  NKMSSGTARMMFFLYSLMNGVLFSSLGFVFHPVSIFYTLGVALIMFIVIAAYGYTTKEDL 140

Query: 164 GPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE-AYS-D 221
              G +++ G   + ++SL+N F+++  +    + +G+VIFSAL AYD  +IK+ A+   
Sbjct: 141 SNYGKYLMTGLISIIIMSLINFFLKAPILYWIGTVLGIVIFSALIAYDVNRIKKIAFQMS 200

Query: 222 RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             D     +  +IGAL LY+DFI +F++LLR  G RR
Sbjct: 201 NGDEEVMNKLGIIGALNLYLDFINLFLYLLRIFGKRR 237


>gi|257124963|ref|YP_003163077.1| hypothetical protein Lebu_0158 [Leptotrichia buccalis C-1013-b]
 gi|257048902|gb|ACV38086.1| protein of unknown function UPF0005 [Leptotrichia buccalis
           C-1013-b]
          Length = 232

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 93/151 (61%), Gaps = 3/151 (1%)

Query: 112 KMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMI 171
           K+MFL+YSAL GL+LS+  ++Y    ++  F  T   F  +++YGY TK +L      ++
Sbjct: 82  KLMFLIYSALNGLTLSAIGIIYAPSIVISAFLGTLVLFAVVAVYGYFTKENLTKFTPMLM 141

Query: 172 MGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYA 228
           +G   + L+SLVN+F+R+S +DL +S +G+++F+   A D  +IK    AY+ + D    
Sbjct: 142 IGLISIVLVSLVNIFLRNSGLDLFVSVLGVIVFTIFIAVDVNRIKSNIIAYAVQEDSEIL 201

Query: 229 ERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            +  + GAL LY+DF+ +F+ +LR  G  R+
Sbjct: 202 NKIEISGALSLYLDFVNLFLSILRISGRGRN 232


>gi|322517492|ref|ZP_08070365.1| membrane protein [Streptococcus vestibularis ATCC 49124]
 gi|322123974|gb|EFX95533.1| membrane protein [Streptococcus vestibularis ATCC 49124]
          Length = 229

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 78/248 (31%), Positives = 123/248 (49%), Gaps = 36/248 (14%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFL---------VNILATTVDPDAASIIINRG 69
           +T D GL  +  ++Y L+ +G+G++ ++S+L         VNIL        A+I +   
Sbjct: 8   TTSDAGLNRFFGKIYGLVGIGVGISAVISYLMLFPLSHLFVNILMNYSWVYTAAIFVELA 67

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
           ++    GA    +P                          AA  +FL+YSAL G +LS  
Sbjct: 68  LVFLASGAARKNTP--------------------------AALPLFLVYSALNGFTLSFI 101

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
            + YT  ++ Q F  TA  F  ++L G + KRDL  I  F++    G+ + SLVN+F  S
Sbjct: 102 IVQYTQANVFQAFISTAIVFFVMALIGVSIKRDLSGIVKFLMAALIGIIVASLVNIFFAS 161

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
           S +   +S + ++IFS L AYD Q IK+ Y    +    +  +V  AL LY+DFI +F++
Sbjct: 162 STMSFVISIVSVLIFSGLIAYDNQLIKKIYYST-NGQVTDGWAVSMALSLYLDFINLFLN 220

Query: 250 LLRFLGSR 257
           +LR   SR
Sbjct: 221 ILRIFASR 228


>gi|322373863|ref|ZP_08048398.1| membrane protein [Streptococcus sp. C150]
 gi|321277235|gb|EFX54305.1| membrane protein [Streptococcus sp. C150]
          Length = 229

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 131/239 (54%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +T D GL  +  ++Y L+ +G+G++ ++S+L+      + P  + + +N          L
Sbjct: 8   TTSDTGLNRFFGKIYGLVGMGVGLSAVISYLM------LGP-FSHLFVN---------IL 51

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           M  S +  + IF  L + +FL       +  AA  +FL+YSAL G +LS   + YT  ++
Sbjct: 52  MNYSWVYTVAIFVELAL-VFLASGAARKNTPAALPLFLVYSALNGFTLSFIIVQYTQATV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            Q F  TA  F ++SL G + KRDL  +  F++    G+ + SLVN+F+ S  +   +S 
Sbjct: 111 FQAFISTAIVFFTMSLIGISVKRDLSGMAKFLMAALIGIIVASLVNIFLASGTMSFVISI 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L AYD Q IK+ Y    +   ++  +V  AL LY+DFI +F+++LR   SR
Sbjct: 171 ISVLIFSGLIAYDNQMIKKVYYAM-NGQVSDGWAVSMALSLYLDFINLFLNILRLFASR 228


>gi|29376434|ref|NP_815588.1| hypothetical protein EF1906 [Enterococcus faecalis V583]
 gi|227519252|ref|ZP_03949301.1| integral membrane protein [Enterococcus faecalis TX0104]
 gi|227555540|ref|ZP_03985587.1| integral membrane protein [Enterococcus faecalis HH22]
 gi|229549752|ref|ZP_04438477.1| integral membrane protein [Enterococcus faecalis ATCC 29200]
 gi|255972448|ref|ZP_05423034.1| predicted protein [Enterococcus faecalis T1]
 gi|256959226|ref|ZP_05563397.1| conserved hypothetical protein [Enterococcus faecalis DS5]
 gi|256961597|ref|ZP_05565768.1| conserved hypothetical protein [Enterococcus faecalis Merz96]
 gi|256964813|ref|ZP_05568984.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
 gi|257079294|ref|ZP_05573655.1| conserved hypothetical protein [Enterococcus faecalis JH1]
 gi|257419598|ref|ZP_05596592.1| predicted protein [Enterococcus faecalis T11]
 gi|293382401|ref|ZP_06628338.1| membrane protein [Enterococcus faecalis R712]
 gi|293388250|ref|ZP_06632766.1| membrane protein [Enterococcus faecalis S613]
 gi|294779804|ref|ZP_06745191.1| membrane family protein [Enterococcus faecalis PC1.1]
 gi|300860870|ref|ZP_07106957.1| conserved hypothetical protein [Enterococcus faecalis TUSoD Ef11]
 gi|307268254|ref|ZP_07549638.1| membrane family protein [Enterococcus faecalis TX4248]
 gi|307272895|ref|ZP_07554142.1| membrane family protein [Enterococcus faecalis TX0855]
 gi|312900940|ref|ZP_07760234.1| membrane family protein [Enterococcus faecalis TX0470]
 gi|312908372|ref|ZP_07767336.1| membrane family protein [Enterococcus faecalis DAPTO 512]
 gi|312910555|ref|ZP_07769397.1| membrane family protein [Enterococcus faecalis DAPTO 516]
 gi|312950941|ref|ZP_07769851.1| membrane family protein [Enterococcus faecalis TX0102]
 gi|29343898|gb|AAO81658.1| conserved hypothetical protein [Enterococcus faecalis V583]
 gi|227073264|gb|EEI11227.1| integral membrane protein [Enterococcus faecalis TX0104]
 gi|227175345|gb|EEI56317.1| integral membrane protein [Enterococcus faecalis HH22]
 gi|229305021|gb|EEN71017.1| integral membrane protein [Enterococcus faecalis ATCC 29200]
 gi|255963466|gb|EET95942.1| predicted protein [Enterococcus faecalis T1]
 gi|256949722|gb|EEU66354.1| conserved hypothetical protein [Enterococcus faecalis DS5]
 gi|256952093|gb|EEU68725.1| conserved hypothetical protein [Enterococcus faecalis Merz96]
 gi|256955309|gb|EEU71941.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
 gi|256987324|gb|EEU74626.1| conserved hypothetical protein [Enterococcus faecalis JH1]
 gi|257161426|gb|EEU91386.1| predicted protein [Enterococcus faecalis T11]
 gi|291080177|gb|EFE17541.1| membrane protein [Enterococcus faecalis R712]
 gi|291082332|gb|EFE19295.1| membrane protein [Enterococcus faecalis S613]
 gi|294453178|gb|EFG21593.1| membrane family protein [Enterococcus faecalis PC1.1]
 gi|300849909|gb|EFK77659.1| conserved hypothetical protein [Enterococcus faecalis TUSoD Ef11]
 gi|306510509|gb|EFM79532.1| membrane family protein [Enterococcus faecalis TX0855]
 gi|306515414|gb|EFM83945.1| membrane family protein [Enterococcus faecalis TX4248]
 gi|310625786|gb|EFQ09069.1| membrane family protein [Enterococcus faecalis DAPTO 512]
 gi|310631090|gb|EFQ14373.1| membrane family protein [Enterococcus faecalis TX0102]
 gi|311289103|gb|EFQ67659.1| membrane family protein [Enterococcus faecalis DAPTO 516]
 gi|311292039|gb|EFQ70595.1| membrane family protein [Enterococcus faecalis TX0470]
 gi|315036715|gb|EFT48647.1| membrane family protein [Enterococcus faecalis TX0027]
 gi|315152216|gb|EFT96232.1| membrane family protein [Enterococcus faecalis TX0031]
 gi|315159825|gb|EFU03842.1| membrane family protein [Enterococcus faecalis TX0312]
 gi|315167364|gb|EFU11381.1| membrane family protein [Enterococcus faecalis TX1341]
 gi|315169553|gb|EFU13570.1| membrane family protein [Enterococcus faecalis TX1342]
 gi|315174252|gb|EFU18269.1| membrane family protein [Enterococcus faecalis TX1346]
 gi|315574500|gb|EFU86691.1| membrane family protein [Enterococcus faecalis TX0309B]
 gi|315581838|gb|EFU94029.1| membrane family protein [Enterococcus faecalis TX0309A]
          Length = 228

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 129/254 (50%), Gaps = 28/254 (11%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N Q  + +G+G        L  +  ++Y  +ALG+G++ IM++    + T   P  A+  
Sbjct: 2   NNQEYIQTGTG--------LNKFYAKIYGFLALGIGISAIMAY---AMTTVFLPVLAT-- 48

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                       L  +S   W+     +G+ ++L  +    +   A   F+ Y+ L G++
Sbjct: 49  ------------LFQSSLAFWMIWLVEIGLVLYLGAKAQK-NPTIAIAGFVAYALLNGVT 95

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LS   L+YT  ++   F   AA+FG++SL G  TK+DL  +G        G+ +  L+N+
Sbjct: 96  LSVTLLMYTGGTVAGAFLSAAATFGAMSLVGVFTKKDLSAVGHAAYSALIGIIIAMLLNM 155

Query: 186 F-MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
           F + S+A++  +S + ++IFS +TAYD Q+I++ Y+   D A     +V  AL LY+DFI
Sbjct: 156 FLLHSNAVEFFISILMVLIFSGITAYDNQRIRQVYAQTGDQA-GTGMAVFFALQLYLDFI 214

Query: 245 QIFVHLLRFLGSRR 258
            +F+  LR  G   
Sbjct: 215 NLFLAFLRIFGKNN 228


>gi|229552559|ref|ZP_04441284.1| integral membrane protein, interacts with FtsH [Lactobacillus
           rhamnosus LMS2-1]
 gi|258539933|ref|YP_003174432.1| integral membrane protein, interacts with FtsH [Lactobacillus
           rhamnosus Lc 705]
 gi|229314111|gb|EEN80084.1| integral membrane protein, interacts with FtsH [Lactobacillus
           rhamnosus LMS2-1]
 gi|257151609|emb|CAR90581.1| Integral membrane protein, interacts with FtsH [Lactobacillus
           rhamnosus Lc 705]
          Length = 236

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 124/252 (49%), Gaps = 29/252 (11%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
           +RVVN         + GL  +  R+Y LM  GL VT ++S+L   L  T+  D  + +  
Sbjct: 4   RRVVN---------EAGLTQFFSRIYTLMGSGLVVTALVSYL---LGVTLKNDYINFVGA 51

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
             ++              WI    PL +  F+  R    S   A +MF L SA  G + +
Sbjct: 52  HPIIF-------------WIMTALPLILSFFVTGRRAQASPGYATLMFYLMSASFGFTFA 98

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
           S  +V  + ++      TA  F  +S+ G+  KRDL   G+  +   FG+ ++  VN+FM
Sbjct: 99  SVAMVAKTSNLAVALATTAVVFLVMSMVGHFGKRDLSKAGNIAMSALFGVIIMMFVNMFM 158

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY----SDRYDVAYAERQSVIGALMLYMDF 243
            SS + + +S   L+IF  LTA+DTQ++K  Y    SD          +V+GALMLY+DF
Sbjct: 159 GSSGMQMLISYAILIIFIVLTAWDTQRLKNLYLTAGSDGQATISTSSLAVVGALMLYLDF 218

Query: 244 IQIFVHLLRFLG 255
           + +F  +L+ LG
Sbjct: 219 LNLFTAILQILG 230


>gi|255975548|ref|ZP_05426134.1| conserved hypothetical protein [Enterococcus faecalis T2]
 gi|257082267|ref|ZP_05576628.1| conserved hypothetical protein [Enterococcus faecalis E1Sol]
 gi|257084884|ref|ZP_05579245.1| conserved hypothetical protein [Enterococcus faecalis Fly1]
 gi|257416349|ref|ZP_05593343.1| conserved hypothetical protein [Enterococcus faecalis AR01/DG]
 gi|307280522|ref|ZP_07561571.1| membrane family protein [Enterococcus faecalis TX0860]
 gi|255968420|gb|EET99042.1| conserved hypothetical protein [Enterococcus faecalis T2]
 gi|256990297|gb|EEU77599.1| conserved hypothetical protein [Enterococcus faecalis E1Sol]
 gi|256992914|gb|EEU80216.1| conserved hypothetical protein [Enterococcus faecalis Fly1]
 gi|257158177|gb|EEU88137.1| conserved hypothetical protein [Enterococcus faecalis ARO1/DG]
 gi|295113193|emb|CBL31830.1| Integral membrane protein, interacts with FtsH [Enterococcus sp.
           7L76]
 gi|306504070|gb|EFM73286.1| membrane family protein [Enterococcus faecalis TX0860]
          Length = 228

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 129/254 (50%), Gaps = 28/254 (11%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N Q  + +G+G        L  +  ++Y  +ALG+G++ IM++    + T   P  A+  
Sbjct: 2   NNQEYIQTGTG--------LNKFYAKIYGFLALGIGISAIMAY---AMTTVFLPVLAT-- 48

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                       L  +S   W+     +G+ ++L  +    +   A   F+ Y+ L G++
Sbjct: 49  ------------LFKSSLAFWMIWLVEIGLVLYLGAKAQK-NPTIAIAGFVAYALLNGVT 95

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LS   L+YT  ++   F   AA+FG++SL G  TK+DL  +G        G+ +  L+N+
Sbjct: 96  LSVTLLMYTGGTVAGAFLSAAATFGAMSLVGVFTKKDLSAVGHAAYSALIGIIIAMLLNM 155

Query: 186 F-MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
           F + S+A++  +S + ++IFS +TAYD Q+I++ Y+   D A     +V  AL LY+DFI
Sbjct: 156 FLLHSNAVEFFISILMVLIFSGITAYDNQRIRQVYAQTGDQA-GTGMAVFFALQLYLDFI 214

Query: 245 QIFVHLLRFLGSRR 258
            +F+  LR  G   
Sbjct: 215 NLFLAFLRIFGKNN 228


>gi|199599524|ref|ZP_03212913.1| Integral membrane protein, interacts with FtsH [Lactobacillus
           rhamnosus HN001]
 gi|199589593|gb|EDY97710.1| Integral membrane protein, interacts with FtsH [Lactobacillus
           rhamnosus HN001]
          Length = 236

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 124/252 (49%), Gaps = 29/252 (11%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
           +RVVN         + GL  +  R+Y LM  GL VT ++S+L   L  T+  D  + +  
Sbjct: 4   RRVVN---------EAGLTQFFSRIYTLMGSGLVVTALVSYL---LGVTLKNDYINFVGA 51

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
             ++              WI    PL +  F+  R    S   A +MF L SA  G + +
Sbjct: 52  HPIIF-------------WIMTALPLILSFFVTGRRAQASPGYATLMFYLMSASFGFTFA 98

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
           S  +V  + ++      TA  F  +S+ G+  KRDL   G+  +   FG+ ++  VN+FM
Sbjct: 99  SVAMVAKTSNLAVALATTAVVFLVMSMVGHFGKRDLSKAGNIAMSALFGVIIMMFVNMFM 158

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY----SDRYDVAYAERQSVIGALMLYMDF 243
            SS + + +S   L+IF  LTA+DTQ++K  Y    SD          +V+GALMLY+DF
Sbjct: 159 GSSGMQMLISYAILIIFIVLTAWDTQRLKNLYLTAGSDGQAAISTSSLAVVGALMLYLDF 218

Query: 244 IQIFVHLLRFLG 255
           + +F  +L+ LG
Sbjct: 219 LNLFTAILQILG 230


>gi|257422296|ref|ZP_05599286.1| conserved hypothetical protein [Enterococcus faecalis X98]
 gi|257164120|gb|EEU94080.1| conserved hypothetical protein [Enterococcus faecalis X98]
 gi|315157021|gb|EFU01038.1| membrane family protein [Enterococcus faecalis TX0043]
 gi|327535424|gb|AEA94258.1| membrane protein [Enterococcus faecalis OG1RF]
          Length = 228

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 129/254 (50%), Gaps = 28/254 (11%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N Q  + +G+G        L  +  ++Y  +ALG+G++ IM++    + T   P  A+  
Sbjct: 2   NNQEYIQTGAG--------LNKFYAKIYGFLALGIGISAIMAY---AMTTVFLPVLAT-- 48

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                       L  +S   W+     +G+ ++L  +    +   A   F+ Y+ L G++
Sbjct: 49  ------------LFKSSLAFWMIWLVEIGLVLYLGAKAQK-NPTIAIAGFVAYALLNGVT 95

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LS   L+YT  ++   F   AA+FG++SL G  TK+DL  +G        G+ +  L+N+
Sbjct: 96  LSVTLLMYTGGTVAGAFLSAAATFGAMSLVGVFTKKDLSAVGHAAYSALIGIIIAMLLNM 155

Query: 186 F-MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
           F + S+A++  +S + ++IFS +TAYD Q+I++ Y+   D A     +V  AL LY+DFI
Sbjct: 156 FLLHSNAVEFFISILMVLIFSGITAYDNQRIRQVYAQTGDQA-GTGMAVFFALQLYLDFI 214

Query: 245 QIFVHLLRFLGSRR 258
            +F+  LR  G   
Sbjct: 215 NLFLAFLRIFGKNN 228


>gi|256762844|ref|ZP_05503424.1| conserved hypothetical protein [Enterococcus faecalis T3]
 gi|307287941|ref|ZP_07567974.1| membrane family protein [Enterococcus faecalis TX0109]
 gi|256684095|gb|EEU23790.1| conserved hypothetical protein [Enterococcus faecalis T3]
 gi|306501086|gb|EFM70393.1| membrane family protein [Enterococcus faecalis TX0109]
 gi|315163607|gb|EFU07624.1| membrane family protein [Enterococcus faecalis TX1302]
          Length = 228

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 128/254 (50%), Gaps = 28/254 (11%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N Q  + +G+G        L  +  ++Y  +ALG+G++ IM++    + T   P  A+  
Sbjct: 2   NNQEYIQTGTG--------LNKFYAKIYGFLALGIGISAIMAY---AMTTVFLPVLAT-- 48

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                       L  +S   W+     +G+ ++L  +    +   A   F+ Y+ L G++
Sbjct: 49  ------------LFKSSLAFWMIWLVEIGLVLYLGAKAQK-NPTIAIAGFVAYALLNGVT 95

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LS   L+YT  ++   F   AA+FG++SL G  TK+DL  +G        G+ +  L+N+
Sbjct: 96  LSVTLLMYTGGTVAGAFLSAAATFGAMSLVGVFTKKDLSAVGHAAYSALIGIIIAMLLNM 155

Query: 186 F-MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
           F + SSA++  +S + ++IFS +TAYD Q+I++ Y+   D       +V  AL LY+DFI
Sbjct: 156 FLLHSSAVEFFISILMVLIFSGITAYDNQRIRQVYAQTGD-QVGTGMAVFFALQLYLDFI 214

Query: 245 QIFVHLLRFLGSRR 258
            +F+  LR  G   
Sbjct: 215 NLFLAFLRIFGKNN 228


>gi|167646934|ref|YP_001684597.1| hypothetical protein Caul_2972 [Caulobacter sp. K31]
 gi|167349364|gb|ABZ72099.1| protein of unknown function UPF0005 [Caulobacter sp. K31]
          Length = 237

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 92/173 (53%), Gaps = 3/173 (1%)

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           W    APL + +  +  +  LS   A  +F+ Y+ L+GLSL      YT   +  TF   
Sbjct: 68  WGVTLAPLLLVMVPSGAVTRLSPALAAGVFIAYAVLVGLSLGGVVAAYTGHGLALTFVAV 127

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           AA F  L+L G  T+ DL  +G F +M    L +  + NL   SS +DL +SA+G+++F+
Sbjct: 128 AAGFAGLALLGAITRADLSGLGVFGLMSVMALIVAMIANLLFDSSTLDLAISAIGVLVFA 187

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            LTA+D Q+I     D +     +R  ++ AL LY+D + IF+  LR  G RR
Sbjct: 188 GLTAFDIQRINRLQVDDWS---DDRAPILAALTLYLDLLNIFLFALRLGGRRR 237


>gi|24380095|ref|NP_722050.1| putative integral membrane protein [Streptococcus mutans UA159]
 gi|290579926|ref|YP_003484318.1| putative integral membrane protein [Streptococcus mutans NN2025]
 gi|24378091|gb|AAN59356.1|AE015001_1 putative integral membrane protein [Streptococcus mutans UA159]
 gi|254996825|dbj|BAH87426.1| putative integral membrane protein [Streptococcus mutans NN2025]
          Length = 229

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 133/243 (54%), Gaps = 29/243 (11%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D  L ++  ++Y L+ +G+G++ ++S+L+             + + R  M+    A+M  
Sbjct: 11  DSRLSSFFAKIYGLVGMGIGLSAVVSYLM-------------LYVFRNNMI----AIMVN 53

Query: 82  SPLRWIF---IFAPLGVFIFLN--VRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK 136
           +P  W++   IFA L + +  +   R +S +A     +FL+YSAL G +LS    +YT  
Sbjct: 54  AP--WVYYVAIFAELALVLIASNAARKNSPTALP---LFLVYSALNGFTLSFIIALYTQT 108

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTM 196
           +++Q F  +AA F  ++L G T K+DL  +G  ++    G+ + SL+N+F+ S  +   +
Sbjct: 109 TVLQAFVSSAAVFFVMALIGVTIKKDLSGMGKALLAALIGIIIASLINMFIGSGTMSYVI 168

Query: 197 SAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           S + ++IFS L AYD Q IK  Y D      ++  +V  AL LY+DFI +F+ LLR  G 
Sbjct: 169 SIISVLIFSGLIAYDNQLIKRVY-DYNSGNVSDGWAVSMALNLYLDFINLFLSLLRIFG- 226

Query: 257 RRD 259
           R D
Sbjct: 227 RND 229


>gi|329846694|ref|ZP_08261967.1| integral membrane protein [Asticcacaulis biprosthecum C19]
 gi|328844201|gb|EGF93769.1| integral membrane protein [Asticcacaulis biprosthecum C19]
          Length = 111

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 76/109 (69%), Gaps = 1/109 (0%)

Query: 152 LSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYD 211
           +SLYGYTTKRDL  +G+ +IMG  G+   S+VNLF++S+A+   +S +G+++F  LTAYD
Sbjct: 1   MSLYGYTTKRDLAGLGALLIMGLIGVITASVVNLFLKSNALQFGISIIGVLVFIGLTAYD 60

Query: 212 TQKIKEAYSDRYDVAYAERQSVI-GALMLYMDFIQIFVHLLRFLGSRRD 259
           TQK+K  Y+   D +    + VI GAL LY+DFI +F+ LL   G+RR 
Sbjct: 61  TQKLKLPYATLTDKSEGVGKIVILGALTLYLDFINLFLQLLYLFGNRRK 109


>gi|304415291|ref|ZP_07395982.1| putative membrane protein [Candidatus Regiella insecticola LSR1]
 gi|304282857|gb|EFL91329.1| putative membrane protein [Candidatus Regiella insecticola LSR1]
          Length = 113

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 79/112 (70%), Gaps = 2/112 (1%)

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGY+T+RDL   G+ + MG  G+ L S++N++++S+A+   ++ +G+V+F  LT
Sbjct: 2   FGAMSLYGYSTQRDLSGFGNMLFMGLIGILLASVINIWLKSNALMWAVTYLGVVLFVGLT 61

Query: 209 AYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K   +  D  D     + +++GAL LY+DFI +F+ LLR  GSRR
Sbjct: 62  AYDTQKLKNMGNQIDANDTEGLRKYAIVGALTLYLDFINLFLMLLRISGSRR 113


>gi|227893047|ref|ZP_04010852.1| integral membrane protein, interacts with FtsH [Lactobacillus
           ultunensis DSM 16047]
 gi|227865160|gb|EEJ72581.1| integral membrane protein, interacts with FtsH [Lactobacillus
           ultunensis DSM 16047]
          Length = 234

 Score =  102 bits (254), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 60/184 (32%), Positives = 102/184 (55%), Gaps = 2/184 (1%)

Query: 77  ALMYTSP-LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTS 135
           A+M   P   W+ +F P+ + + ++ +  + +  A  +M ++ + + G   +     YT 
Sbjct: 50  AVMNMPPAFMWVILFVPIALSMGISFK-ATRNPVAGFIMLMILAVIYGFEFALLAGYYTQ 108

Query: 136 KSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLT 195
             I   F  +AA FGS++L+G  TK++L  +GS+M     GL +  +VN+F+R+S     
Sbjct: 109 AQIGTAFLSSAAVFGSMALFGTFTKKNLNNLGSYMGAALIGLIVAMIVNMFLRNSVATFV 168

Query: 196 MSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
            S +G+VIF+ LTAYD QK+K  Y+           +++GAL LY+DF+ IF+ LL+  G
Sbjct: 169 FSIIGVVIFTGLTAYDAQKMKNIYNSYGSQVPTNGLAILGALQLYLDFVNIFLFLLQIFG 228

Query: 256 SRRD 259
              D
Sbjct: 229 MGND 232


>gi|116495191|ref|YP_806925.1| integral membrane protein, interacts with FtsH [Lactobacillus casei
           ATCC 334]
 gi|301066755|ref|YP_003788778.1| integral membrane protein, interacts with FtsH [Lactobacillus casei
           str. Zhang]
 gi|116105341|gb|ABJ70483.1| Integral membrane protein, interacts with FtsH [Lactobacillus casei
           ATCC 334]
 gi|300439162|gb|ADK18928.1| Integral membrane protein, interacts with FtsH [Lactobacillus casei
           str. Zhang]
          Length = 236

 Score =  102 bits (254), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 79/252 (31%), Positives = 124/252 (49%), Gaps = 29/252 (11%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
           +RVVN         + GL  +  R+Y LM  GL VT ++S+L   L      +  S +  
Sbjct: 4   RRVVN---------EAGLTQFFSRIYTLMGSGLVVTALVSYL---LGFPFRAEYTSFVSG 51

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
             ++              WI  F P+ +  F+  R    S   A +MF L SA  G + +
Sbjct: 52  HPIVF-------------WIMAFMPIILSFFVTGRRAQASPGYATVMFYLMSASFGFTFA 98

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
           S  +V    ++      TA  F  +S+ G+  KRDL   GS  ++  FG+ ++S VN+F+
Sbjct: 99  SVAMVADGTNLAVALATTAVVFLVMSMVGHFGKRDLSKAGSIAMVALFGIIIMSFVNMFL 158

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY----SDRYDVAYAERQSVIGALMLYMDF 243
            S+ + L +S   L+IF  LTA+DTQ++K  Y    +D          +V+GALMLY+DF
Sbjct: 159 GSNGMQLLISYGVLIIFIVLTAWDTQRLKNLYLTTGNDGQAAVSEGSLAVLGALMLYLDF 218

Query: 244 IQIFVHLLRFLG 255
           + +F  +L+ LG
Sbjct: 219 LNLFTAILQILG 230


>gi|266619242|ref|ZP_06112177.1| putative membrane protein [Clostridium hathewayi DSM 13479]
 gi|288869237|gb|EFD01536.1| putative membrane protein [Clostridium hathewayi DSM 13479]
          Length = 236

 Score =  102 bits (253), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 57/170 (33%), Positives = 100/170 (58%), Gaps = 3/170 (1%)

Query: 91  APLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFG 150
           A + V +FL+ R+H +S   A+ +F  Y+ L G+  S++FL+Y    ++  F  T+  FG
Sbjct: 68  AEIAVVLFLSARIHKMSVGTARALFFTYAVLNGVVFSAYFLMYDMVDLILVFGATSIFFG 127

Query: 151 SLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAY 210
            +++ GY T  D   I +F++ G   L +  L+++F+     ++ +  +G+ IF   TAY
Sbjct: 128 VMAVIGYVTNADFSRIRNFLMGGLIFLVVFWLLSMFINLGQFEMIVCYIGIFIFLGFTAY 187

Query: 211 DTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           DTQKI+ AY   Y  D   A + S+  AL LY+DF+ +F++++R +G R+
Sbjct: 188 DTQKIR-AYHQYYAQDPEMAAKASIFSALQLYLDFVNLFLYIIRIVGRRK 236


>gi|227534791|ref|ZP_03964840.1| integral membrane protein, interacts with FtsH [Lactobacillus
           paracasei subsp. paracasei ATCC 25302]
 gi|239632073|ref|ZP_04675104.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|227187547|gb|EEI67614.1| integral membrane protein, interacts with FtsH [Lactobacillus
           paracasei subsp. paracasei ATCC 25302]
 gi|239526538|gb|EEQ65539.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
          Length = 239

 Score =  102 bits (253), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 79/252 (31%), Positives = 124/252 (49%), Gaps = 29/252 (11%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
           +RVVN         + GL  +  R+Y LM  GL VT ++S+L   L      +  S +  
Sbjct: 7   RRVVN---------EAGLTQFFSRIYTLMGSGLVVTALVSYL---LGFPFRAEYTSFVSG 54

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
             ++              WI  F P+ +  F+  R    S   A +MF L SA  G + +
Sbjct: 55  HPIVF-------------WIMAFMPIILSFFVTGRRAQASPGYATVMFYLMSASFGFTFA 101

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
           S  +V    ++      TA  F  +S+ G+  KRDL   GS  ++  FG+ ++S VN+F+
Sbjct: 102 SVAMVADGTNLAVALATTAVVFLVMSMVGHFGKRDLSKAGSIAMVALFGIIIMSFVNMFL 161

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY----SDRYDVAYAERQSVIGALMLYMDF 243
            S+ + L +S   L+IF  LTA+DTQ++K  Y    +D          +V+GALMLY+DF
Sbjct: 162 GSNGMQLLISYGVLIIFIVLTAWDTQRLKNLYLTTGNDGQAAVSEGSLAVLGALMLYLDF 221

Query: 244 IQIFVHLLRFLG 255
           + +F  +L+ LG
Sbjct: 222 LNLFTAILQILG 233


>gi|312864013|ref|ZP_07724249.1| putative membrane protein [Streptococcus vestibularis F0396]
 gi|311100426|gb|EFQ58633.1| putative membrane protein [Streptococcus vestibularis F0396]
          Length = 229

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 121/248 (48%), Gaps = 36/248 (14%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFL---------VNILATTVDPDAASIIINRG 69
           +T D GL  +  +VY L+ +G+G++ ++S+L         VNIL        A+I I   
Sbjct: 8   TTSDAGLNRFFGKVYGLVGIGVGLSAVISYLMLFPLSHLFVNILMNYSWIYMAAIFIELA 67

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
           ++    GA    +P                          AA  +FL+YSAL G +LS  
Sbjct: 68  LVFLASGAARRNTP--------------------------AALPLFLVYSALNGFTLSFI 101

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
              YT   + Q F  TA  F  ++L G + KRDL  I  F++    G+ + SLVN+F  S
Sbjct: 102 IAQYTQAIVFQAFLSTAIVFFVMALIGVSIKRDLSGIVKFLMAALIGIIVASLVNIFFAS 161

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
           S +   +S + ++IFS L AYD Q IK+ Y    +    +  +V  AL LY+DFI +F++
Sbjct: 162 STMSFVISIVSVLIFSGLIAYDNQLIKKIYYST-NGQVTDGWAVSMALSLYLDFINLFLN 220

Query: 250 LLRFLGSR 257
           +LR   SR
Sbjct: 221 ILRIFASR 228


>gi|191638700|ref|YP_001987866.1| Integral membrane protein, interacts with FtsH [Lactobacillus casei
           BL23]
 gi|190713002|emb|CAQ67008.1| Integral membrane protein, interacts with FtsH [Lactobacillus casei
           BL23]
 gi|327382741|gb|AEA54217.1| hypothetical protein LC2W_1885 [Lactobacillus casei LC2W]
 gi|327385928|gb|AEA57402.1| hypothetical protein LCBD_1906 [Lactobacillus casei BD-II]
          Length = 236

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 79/252 (31%), Positives = 124/252 (49%), Gaps = 29/252 (11%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
           +RVVN         + GL  +  R+Y LM  GL VT ++S+L   L      +  S +  
Sbjct: 4   RRVVN---------EAGLTQFFSRIYTLMGSGLVVTALVSYL---LGFPFRAEYTSFVSG 51

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
             ++              WI  F P+ +  F+  R    S   A +MF L SA  G + +
Sbjct: 52  HPIVF-------------WIMAFMPIILSFFVTGRRAQASPGYATVMFYLMSASFGFTFA 98

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
           S  +V    ++      TA  F  +S+ G+  KRDL   G+  ++  FG+ ++S+VN F+
Sbjct: 99  SVAMVADGTNLAVALATTAVVFLVMSMVGHFGKRDLSKAGNIAMVALFGIIIMSIVNAFI 158

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY----SDRYDVAYAERQSVIGALMLYMDF 243
            SS + L +S   L+IF  LTA+DTQ++K  Y    +D          +V+GALMLY+DF
Sbjct: 159 GSSGMQLLISYGVLIIFIVLTAWDTQRLKNLYLTTGNDGQAAVSEGSLAVLGALMLYLDF 218

Query: 244 IQIFVHLLRFLG 255
           + +F  +L+ LG
Sbjct: 219 LNLFTAILQILG 230


>gi|260891091|ref|ZP_05902354.1| putative membrane protein [Leptotrichia hofstadii F0254]
 gi|260859118|gb|EEX73618.1| putative membrane protein [Leptotrichia hofstadii F0254]
          Length = 256

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 100/177 (56%), Gaps = 3/177 (1%)

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           WIF+   +   +  +  +++ ++   K++FL+YSAL GL+ S   L Y    I   F  T
Sbjct: 80  WIFLILEVVAVLAFSALVYTANSSVLKLIFLIYSALSGLTFSIIGLRYAPDVIGSAFLGT 139

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
            + F  L++YGY TK +L      +  G   + L+S+VN+F+ +SAIDL +S +G++IF+
Sbjct: 140 LSIFVVLAIYGYFTKENLTRFVPLLTAGIIAMILVSVVNMFLGNSAIDLFVSVLGVIIFT 199

Query: 206 ALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
              A D  +I+    A +   D     +  ++GAL LY+DF+ +F+ +LR LG  RD
Sbjct: 200 IYIAVDVNRIRNNIIACAVHEDSDILNKIEIVGALELYLDFVNLFLSILRILGRGRD 256


>gi|218670681|ref|ZP_03520352.1| hypothetical conserved membrane protein [Rhizobium etli GR56]
          Length = 112

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/124 (42%), Positives = 75/124 (60%), Gaps = 16/124 (12%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D+RNYQ    S +  G  IDQGLR YM++VYNLMALGL +TG+ ++L    A      
Sbjct: 1   MADLRNYQ----SRAQTGEMIDQGLRTYMLKVYNLMALGLAITGVAAYLSFQFAFANGE- 55

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                      +T FG  +Y SPL+W+ I APL +  FL+ R+HS++  AA+  F +Y+A
Sbjct: 56  -----------ITAFGHAIYLSPLKWVVILAPLALVFFLSFRIHSMTVSAAQTTFAIYAA 104

Query: 121 LIGL 124
           L+G 
Sbjct: 105 LVGC 108


>gi|213424796|ref|ZP_03357546.1| hypothetical protein SentesTyphi_03256 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213647755|ref|ZP_03377808.1| hypothetical protein SentesTy_10997 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|289805334|ref|ZP_06535963.1| putative permease [Salmonella enterica subsp. enterica serovar
           Typhi str. AG3]
 gi|289825281|ref|ZP_06544560.1| putative permease [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-3139]
          Length = 109

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 73/109 (66%), Gaps = 2/109 (1%)

Query: 152 LSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYD 211
           +SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V+F  LTAYD
Sbjct: 1   MSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVVVFVGLTAYD 60

Query: 212 TQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           TQK+K      D  D A   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 61  TQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR 109


>gi|311114995|ref|YP_003986216.1| integral membrane protein [Gardnerella vaginalis ATCC 14019]
 gi|310946489|gb|ADP39193.1| integral membrane protein [Gardnerella vaginalis ATCC 14019]
          Length = 253

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 107/175 (61%), Gaps = 6/175 (3%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A + + + L +R+  +S +AA+ MF  Y+AL G +LS+ F V++  SI     +TA  
Sbjct: 81  IIAQVVLAVVLGMRVMKMSVFAARAMFYAYAALTGFTLSTIFTVFSLGSIAMVLALTAGF 140

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLT-MSAMGLVIFSAL 207
           F  L++   TTK ++   G  +++    L +  ++ +F+  SA  +  ++A+ ++IF+ L
Sbjct: 141 FLCLTMLALTTKVNMLKAGPILMVALLVLCVSQVILMFVAPSAGTMRFIAAIAVLIFAGL 200

Query: 208 TAYDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           TAYD QK +   EAY+D+ ++   +R S+I A  LY+DFI +FV+LL  LG+RRD
Sbjct: 201 TAYDAQKTRAIFEAYADQPEM--IKRISIICAFNLYLDFINMFVYLLELLGNRRD 253


>gi|330718753|ref|ZP_08313353.1| integral membrane protein, interacts with FtsH [Leuconostoc fallax
           KCTC 3537]
          Length = 238

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 127/241 (52%), Gaps = 19/241 (7%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           +D+G+RA+  + Y+ MAL + +TGI  ++V    +      AS+I    V + G      
Sbjct: 15  VDEGMRAFFKQTYSYMALAVLITGITGYIVK---SFFWEQIASLIYGNAVGVIGL----- 66

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
              ++++ IF      I  N   ++ +A+   M F   + + GL+      +YT+ SI+ 
Sbjct: 67  -IGVQFLLIF-----MIGRNTLKNTANAFGLLMTF---AVVEGLTTGVLLGLYTTASILG 117

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            F  TAA FG +S YG  TKR+LG +   +     GL + SL+N+F  +  ++L +S + 
Sbjct: 118 VFAATAAVFGGMSAYGLMTKRNLGGLRQALFGLLVGLIVASLINMFFPNGIVNLLISYVA 177

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG--SRR 258
           +V+FS  TAYD Q++K  Y+           ++ GAL LY+DFI +F +LLR  G  + R
Sbjct: 178 VVVFSLYTAYDNQRLKLMYAQTAGQMDTTGLAINGALSLYLDFINLFFYLLRLFGVMNTR 237

Query: 259 D 259
           D
Sbjct: 238 D 238


>gi|315223131|ref|ZP_07864999.1| conserved hypothetical protein [Streptococcus anginosus F0211]
 gi|315187820|gb|EFU21567.1| conserved hypothetical protein [Streptococcus anginosus F0211]
          Length = 227

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 80/243 (32%), Positives = 136/243 (55%), Gaps = 30/243 (12%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + G+ ++  +VY+L+ +G+G++ ++S L                     MLT F  ++Y+
Sbjct: 9   NSGINSFYAKVYSLVGMGIGISALVSAL---------------------MLTIFQDVIYS 47

Query: 82  SPL--RWIF---IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK 136
             +   WIF   IFA L V +++   + + +  AA   FL+YSAL G ++S    +YT  
Sbjct: 48  VIMANSWIFYLAIFAEL-VLVWVASGMSAKNNPAALPTFLVYSALNGFTISLVLALYTQA 106

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTM 196
           +++  F  ++A F +++L G  TK+DL  +G   I G  G+ + SLVN+F+RSS +D  +
Sbjct: 107 TVLAAFVTSSAMFFAMALIGKFTKKDLSGLGRAFIAGLIGVIIASLVNIFLRSSGLDFII 166

Query: 197 SAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           S + ++IFS L A+D Q+I+  Y ++     A   +V  AL LY+DFI +F+ +LR  G 
Sbjct: 167 SIISVIIFSGLIAWDNQRIRYVY-EQSGGNVAAGWAVSLALSLYLDFINLFLSILRIFG- 224

Query: 257 RRD 259
            RD
Sbjct: 225 -RD 226


>gi|319938689|ref|ZP_08013053.1| membrane protein [Streptococcus anginosus 1_2_62CV]
 gi|319811739|gb|EFW08005.1| membrane protein [Streptococcus anginosus 1_2_62CV]
          Length = 227

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 80/243 (32%), Positives = 136/243 (55%), Gaps = 30/243 (12%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + G+ ++  +VY+L+ +G+G++ ++S L                     MLT F  ++Y+
Sbjct: 9   NSGINSFYAKVYSLVGMGIGISALVSAL---------------------MLTIFQDVIYS 47

Query: 82  SPL--RWIF---IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK 136
             +   WIF   IFA L V +++   + + +  AA   FL+YSAL G ++S    +YT  
Sbjct: 48  VIMANSWIFYLAIFAEL-VLVWVASGMSAKNNPAALPTFLVYSALNGFTISLVLALYTQA 106

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTM 196
           +++  F  ++A F +++L G  TK+DL  +G   I G  G+ + SLVN+F+RSS +D  +
Sbjct: 107 TVLAAFITSSAMFFAMALIGKFTKKDLSGLGRSFIAGLIGVIIASLVNIFLRSSGLDFII 166

Query: 197 SAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           S + ++IFS L A+D Q+I+  Y ++     A   +V  AL LY+DFI +F+ +LR  G 
Sbjct: 167 SIISVIIFSGLIAWDNQRIRYVY-EQSGGNVAAGWAVSLALSLYLDFINLFLSILRIFG- 224

Query: 257 RRD 259
            RD
Sbjct: 225 -RD 226


>gi|225867933|ref|YP_002743881.1| membrane protein [Streptococcus equi subsp. zooepidemicus]
 gi|225701209|emb|CAW98141.1| putative membrane protein [Streptococcus equi subsp. zooepidemicus]
          Length = 229

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 124/238 (52%), Gaps = 19/238 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GL  +  +VY+L+ +G+G++  +S+L   +      +  SII++  ++  G       
Sbjct: 11  DAGLSHFFAKVYSLVGMGVGLSAFVSYL---MLFPFRQNLVSIILDHPMVYYG------A 61

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + +  + +F   G       R ++    AA  +FL+YSAL G +LS     Y   +++Q 
Sbjct: 62  AIVELVLVFVASGA-----ARRNT---PAALPLFLVYSALNGFTLSFIIAAYAQTTVLQA 113

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +AA F ++SL G   KRDL  I   M     G+ + SLVNLF+ S  +   +S + +
Sbjct: 114 FISSAAVFFAMSLLGVKVKRDLSGIRKAMFAALIGIIVASLVNLFIGSDLMSYVISLISV 173

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +IFS L A D Q IK+ Y      A  +  +V  AL LY+DFI +F+ LLR LG R D
Sbjct: 174 LIFSGLIASDNQMIKQVYQASNGQA-GDGWAVAMALSLYLDFINLFISLLRLLG-RND 229


>gi|239623786|ref|ZP_04666817.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239521817|gb|EEQ61683.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 234

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 108/193 (55%), Gaps = 4/193 (2%)

Query: 69  GVMLTGFGALMYTSPLRWIFIFA-PLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
           G + TG  A +Y+ P  +  +FA  +GV +FL+ R+  +S   A+ MF LY+ L GL   
Sbjct: 43  GGLFTGAIAYVYSIPYWYYILFAAEIGVVLFLSARIEKMSVGLARTMFFLYAVLNGLVFC 102

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
           ++ +++    +   F IT+  FG ++L G+    +   +  FM+ G   L    L+ +F+
Sbjct: 103 AYLIIFDLTILWMVFGITSVFFGIMALIGWFGNINFAKLRPFMVGGLIFLVFYWLLAMFI 162

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYD--VAYAERQSVIGALMLYMDFIQ 245
             SA +  +S  G+ +F   TAYDT+KI +AY + Y      A + S+  AL LY+DFI 
Sbjct: 163 DLSAFETGVSMFGIFLFLIFTAYDTKKI-QAYYEYYGQVPEMAAKASIFSALQLYLDFIN 221

Query: 246 IFVHLLRFLGSRR 258
           +F++LLR LG R+
Sbjct: 222 LFIYLLRVLGRRK 234


>gi|195978749|ref|YP_002123993.1| integral membrane protein [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|195975454|gb|ACG62980.1| integral membrane protein [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
          Length = 230

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 122/238 (51%), Gaps = 19/238 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GL  +  +VY+L+ +G+G++  +S+L   +      +  SII++  ++  G       
Sbjct: 12  DAGLSHFFAKVYSLVGMGVGLSAFVSYL---MLFPFRQNLVSIILDHPMVYYG------A 62

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + +  + +F   G            +  AA  +FL+YSAL G +LS     Y   +++Q 
Sbjct: 63  AIVELVLVFVASGA--------ARRNTPAALPLFLVYSALNGFTLSFIIAAYAQTTVLQA 114

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +AA F ++SL G   KRDL  I   M     G+ + SLVNLF+ S  +   +S + +
Sbjct: 115 FISSAAVFFAMSLLGVKVKRDLSGIRKAMFAALIGIIVASLVNLFIGSDLMSYVISLISV 174

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +IFS L A D Q IK+ Y      A  +  +V  AL LY+DFI +F+ LLR LG R D
Sbjct: 175 LIFSGLIASDNQMIKQVYQASNGQA-GDGWAVAMALSLYLDFINLFISLLRLLG-RND 230


>gi|83944862|ref|ZP_00957228.1| hypothetical protein OA2633_09544 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851644|gb|EAP89499.1| hypothetical protein OA2633_09544 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 253

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 79/256 (30%), Positives = 132/256 (51%), Gaps = 36/256 (14%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +++D GLR++M+ VYN M LGL ++ +++F+    A TVDP                  L
Sbjct: 16  TSVDAGLRSFMLGVYNKMGLGLVLSAVLAFV----AGTVDPVTQ---------------L 56

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           ++ SPL ++  F P+ +       + + S   A +++    +LIG  L  + L+ T+ + 
Sbjct: 57  VFNSPLYFVVQFGPIVLLFGSMFFMRNPSPLGAAVLYWAVVSLIGTGLGVWVLMATTGAS 116

Query: 139 VQTFFIT-AASFGS--------------LSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
            +T   T + + G+              LSLYGYTTK +L PIGSF++M   G+ L+SL+
Sbjct: 117 AETLTGTISVTMGTIAQAFFITAAAFFGLSLYGYTTKTNLQPIGSFLVMAVIGVVLISLL 176

Query: 184 NLFM-RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALMLYM 241
           N+F+  SS +   +    L + + + A+ TQ +K  Y + R D       +  GAL LY+
Sbjct: 177 NVFLIESSGLQWLIQFAILGLMAGVVAWQTQSLKLTYVEARGDQRSLGVLTYYGALNLYI 236

Query: 242 DFIQIFVHLLRFLGSR 257
            FI +F  +L  LG+R
Sbjct: 237 AFINMFQIILMILGNR 252


>gi|116627182|ref|YP_819801.1| integral membrane protein, interacts with FtsH [Streptococcus
           thermophilus LMD-9]
 gi|116100459|gb|ABJ65605.1| Integral membrane protein, interacts with FtsH [Streptococcus
           thermophilus LMD-9]
          Length = 229

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 124/250 (49%), Gaps = 37/250 (14%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFL---------VNILATTVDPDAASIIINRG 69
           +T D GL  +  ++Y L+ +G+G++ ++S+L         VNIL        A+I +   
Sbjct: 8   TTSDAGLNRFFGKIYGLVGIGVGLSAVISYLMLFPLSHLFVNILMNYSWIYMAAIFVELA 67

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
           ++    GA    +P                          AA  +FL+YSAL G +LS  
Sbjct: 68  LVFLASGAARRNTP--------------------------AALPLFLVYSALNGFTLSFI 101

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
            + YT   + Q F  TA  F  ++L G + KRDL  +  F++    G+ + SLVN+F  S
Sbjct: 102 IVQYTQAIVFQAFLSTAIVFFVMALIGVSIKRDLSGMVKFLMAALIGIIVASLVNIFFAS 161

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
           S +   +S + ++IFS L AYD Q IK+ Y    +    +  ++  AL LY+DFI +F++
Sbjct: 162 STMSFVISIVSVLIFSGLIAYDNQLIKKVYYST-NGQVTDGWAISMALSLYLDFINLFLN 220

Query: 250 LLRFLGSRRD 259
           +LR   +RRD
Sbjct: 221 ILRIF-ARRD 229


>gi|327490087|gb|EGF21875.1| integral membrane protein, receptor [Streptococcus sanguinis
           SK1058]
          Length = 227

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 124/240 (51%), Gaps = 23/240 (9%)

Query: 22  DQG-LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           DQ  + ++  ++Y+++ +G+G++ I+S L+      V  DA   I+ R V          
Sbjct: 8   DQSDINSFYAKIYSIVGVGIGISAIVSLLM----LFVFQDAIYTILTRSV---------- 53

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSL--SAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
                WI+  A    FI + V   +   ++ AA  MFL YSA+ G +LS    +Y    +
Sbjct: 54  -----WIYYAAIAVEFILVLVASGTARSNSPAALPMFLAYSAINGFTLSIIMALYLQSEV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  T   F ++   G  TK+DL  +G   + G  G+   S +N+F+RSS +D  +S 
Sbjct: 109 LLAFLTTTVMFFAMGFIGKVTKKDLSGMGRACMAGLIGIIAASFLNIFLRSSGLDFIVSI 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +G++IFS L A+D QKI+  Y ++ +       ++  AL LY+DFI +F+ LLR  G  +
Sbjct: 169 VGVIIFSGLIAWDNQKIRYVY-EQTNGNPGNGWAISLALHLYLDFINLFLSLLRIFGRNK 227


>gi|55820346|ref|YP_138788.1| hypothetical protein stu0249 [Streptococcus thermophilus LMG 18311]
 gi|55736331|gb|AAV59973.1| Conserved hypothetical, predicted membrane protein (TMS7)
           [Streptococcus thermophilus LMG 18311]
          Length = 229

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 123/250 (49%), Gaps = 37/250 (14%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFL---------VNILATTVDPDAASIIINRG 69
           +T D GL  +  ++Y L+ +G+G++ ++S+L         VNIL        A+I +   
Sbjct: 8   TTSDAGLNRFFGKIYGLVGIGVGISAVISYLMLFPLSHLFVNILMNYSWIYMAAIFVELA 67

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
           ++    GA    +P                          AA  +FL+YSAL G +LS  
Sbjct: 68  LVFLASGAARRNTP--------------------------AALPLFLVYSALNGFTLSFI 101

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
            + YT   + Q F  TA  F  ++L G + KRDL  +  F++    G+ + SLVN+F  S
Sbjct: 102 IVQYTQAIVFQAFLSTAIVFFVMALIGVSIKRDLSGMVKFLMAALIGIIVASLVNIFFAS 161

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
           S +   +S + ++IFS L AYD Q IK+ Y    +    +  +V  AL LY+DFI +F++
Sbjct: 162 STMSFVISIVSVLIFSGLIAYDNQLIKKVYYST-NGQVTDGWAVSMALSLYLDFINLFLN 220

Query: 250 LLRFLGSRRD 259
           +LR   +R D
Sbjct: 221 ILRIF-ARHD 229


>gi|332358337|gb|EGJ36163.1| integral membrane protein, receptor [Streptococcus sanguinis SK355]
          Length = 227

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 129/241 (53%), Gaps = 25/241 (10%)

Query: 22  DQG-LRAYMIRVYNLMALGLGVTGIMSF-LVNILATTVDPDAASIIINRGVMLTGFGALM 79
           DQ  + ++  ++Y+++ +G+G++ I+S  ++N            III+   +LTG     
Sbjct: 8   DQSDINSFYAKIYSIVGVGIGISAIVSLSMLNFFQ--------DIIIS---VLTG----- 51

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSL--SAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
                 WIF  A    FIF+ V   +   ++ AA  MFL YSA+ G +LS    +Y   +
Sbjct: 52  ----STWIFYAAIAAEFIFVLVASGTARSNSPAALPMFLAYSAINGFTLSIIMALYLQST 107

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           ++  F  T   F ++   G  TK+DL  +G   + G  G+   S++N+F+RSS +D  +S
Sbjct: 108 VLLAFLTTTVMFFAMGFIGKVTKKDLSGMGRACMAGLIGIIAASVLNIFLRSSGLDFIIS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            +G++IFS L A+D QKI+  Y ++ +       ++  AL LY+DFI +F+ LLR  G  
Sbjct: 168 IVGVLIFSGLIAWDNQKIRYVY-EQTNGNPGNGWAISLALHLYLDFINLFLSLLRIFGRN 226

Query: 258 R 258
           +
Sbjct: 227 K 227


>gi|228476490|ref|ZP_04061180.1| integral membrane protein, interacts with FtsH [Streptococcus
           salivarius SK126]
 gi|228251911|gb|EEK10957.1| integral membrane protein, interacts with FtsH [Streptococcus
           salivarius SK126]
          Length = 229

 Score = 98.6 bits (244), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 122/249 (48%), Gaps = 36/249 (14%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFL---------VNILATTVDPDAASIIINRG 69
           +T D GL  +  ++Y L+ +G+G++ ++S+L         VNIL        A++ +  G
Sbjct: 8   TTSDAGLSRFFGKIYGLVGIGVGLSAVISYLMLFPLSHVFVNILMNYSWVYMAALFLEFG 67

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
           ++    GA    +P                          AA  +FL+YSAL G +LS  
Sbjct: 68  LVFLASGAARRNTP--------------------------AALPLFLVYSALNGFTLSFI 101

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
            + YT   + Q F  TA  F  ++L G + KRDL  +  F++    G+ + SL+N+F  S
Sbjct: 102 IVQYTQAIVFQAFLSTAIVFFIMALIGVSIKRDLSGMAKFLMAALIGIIVASLINIFFAS 161

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
           S +   +S + ++IFS L AYD Q IK+ Y    +    +  +V  AL LY+DFI +F++
Sbjct: 162 SMMSFVISIVSILIFSGLIAYDNQLIKKVYYGA-NGQVTDGWAVSMALSLYLDFINLFLN 220

Query: 250 LLRFLGSRR 258
           +LR    R 
Sbjct: 221 ILRLFARRN 229


>gi|317058248|ref|ZP_07922733.1| integral membrane protein [Fusobacterium sp. 3_1_5R]
 gi|313683924|gb|EFS20759.1| integral membrane protein [Fusobacterium sp. 3_1_5R]
          Length = 232

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 97/165 (58%), Gaps = 8/165 (4%)

Query: 99  LNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYT 158
           L+ R++ +S+   K +F+LYS L GL+L +   +Y    ++ +F IT + F   + YG+ 
Sbjct: 71  LSFRVYKMSSGTVKTLFVLYSMLNGLTLCTIGFLYDPMIVLYSFGITLSIFTVSAFYGFK 130

Query: 159 TKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE- 217
           T  DL     F  +G   L L+SLVNL++  S++   ++  G V+F+ L AYD  +I+  
Sbjct: 131 TTEDLASYSRFFTIGLVSLILVSLVNLWLGVSSLYWMITVGGTVLFTGLIAYDVNRIRNM 190

Query: 218 ----AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
               A  D  DV   E+ +V+GAL LY+DFI +F+++LRF G +R
Sbjct: 191 SFYLAEEDGEDV---EKYAVMGALSLYLDFINLFLYILRFSGKKR 232


>gi|325690947|gb|EGD32947.1| integral membrane protein, receptor [Streptococcus sanguinis SK115]
          Length = 227

 Score = 98.2 bits (243), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 126/240 (52%), Gaps = 23/240 (9%)

Query: 22  DQG-LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           DQ  + ++  ++Y+++ +G+G++ ++S L+      V  DA   I+ R V          
Sbjct: 8   DQSDINSFYAKIYSIVGVGIGISAVVSLLM----LFVFQDAIYTILTRSV---------- 53

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSL--SAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
                WI+  A    FI + V   +   ++ AA  MFL YSA+ G +LS    +Y   ++
Sbjct: 54  -----WIYYAAIAVEFILVLVASGTARSNSPAALPMFLAYSAINGFTLSIIMALYLQSTV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  T   F ++   G  TK+DL  +G   + G  G+   S++N+F+RSS +D  +S 
Sbjct: 109 LLAFLTTTVMFFAMGFIGKVTKKDLSGMGRACMAGLIGIIAASVLNIFLRSSGLDFIISI 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +G++IFS L A+D QKI+  Y ++ +       ++  AL LY+DFI +F+ LLR  G  +
Sbjct: 169 VGVLIFSGLIAWDNQKIRYVY-EQTNGNPGNGWAISLALHLYLDFINLFLSLLRIFGRNK 227


>gi|323351011|ref|ZP_08086668.1| membrane protein [Streptococcus sanguinis VMC66]
 gi|322122735|gb|EFX94444.1| membrane protein [Streptococcus sanguinis VMC66]
          Length = 227

 Score = 98.2 bits (243), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 129/241 (53%), Gaps = 25/241 (10%)

Query: 22  DQG-LRAYMIRVYNLMALGLGVTGIMSFL-VNILATTVDPDAASIIINRGVMLTGFGALM 79
           DQ  + ++  ++Y+++ +G+G++ I+S L +N            III+   +LTG     
Sbjct: 8   DQSDINSFYAKIYSIVGVGIGISAIVSLLMLNFFQ--------DIIIS---VLTG----- 51

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSL--SAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
                 WIF  A    FIF+ V   +   ++ AA  MFL YSA+ G +LS    +Y   +
Sbjct: 52  ----STWIFYAAIAAEFIFVLVASGAARSNSPAALPMFLGYSAINGFTLSIIMALYLQST 107

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           ++  F  T   F ++   G  TK+DL  +G   + G  G+   S++N+F+RSS +D  +S
Sbjct: 108 VLLAFLTTTVMFFAMGFIGKVTKKDLSGMGRACMAGLIGIIAASVLNIFLRSSGLDFIVS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            +G++IFS L A+D QKI+  Y ++ +       ++  AL LY+DFI +F+ LLR  G  
Sbjct: 168 IVGVLIFSGLIAWDNQKIRYVY-EQTNGNPGNGWAISLALHLYLDFINLFLSLLRIFGRN 226

Query: 258 R 258
           +
Sbjct: 227 K 227


>gi|225871151|ref|YP_002747098.1| membrane protein [Streptococcus equi subsp. equi 4047]
 gi|225700555|emb|CAW95045.1| putative membrane protein [Streptococcus equi subsp. equi 4047]
          Length = 229

 Score = 98.2 bits (243), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 122/238 (51%), Gaps = 19/238 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GL  +  +VY+L+ +G+G++  +S+L   +      +  SI+++  ++  G       
Sbjct: 11  DAGLSHFFAKVYSLVGMGVGLSAFVSYL---MLFPFRQNLVSIVLDHPMVYYG------A 61

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + +  + +F   G            +  AA  +FL+YSAL G +LS     Y   +++Q 
Sbjct: 62  AIVELVLVFVASGA--------ARRNTPAALPLFLVYSALNGFTLSFIIAAYAQTTVLQA 113

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +AA F ++SL G   KRDL  I   M     G+ + SLVNLF+ S  +   +S + +
Sbjct: 114 FISSAAVFFAMSLLGVKVKRDLSGIRKAMFAALIGIIVASLVNLFIGSDLMSYVISLISV 173

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +IFS L A D Q IK+ Y    +    +  +V  AL LY+DFI +F+ LLR LG R D
Sbjct: 174 LIFSGLIASDNQMIKQVYQAS-NGQVGDGWAVAMALSLYLDFINLFISLLRLLG-RND 229


>gi|257451688|ref|ZP_05616987.1| integral membrane protein [Fusobacterium sp. 3_1_5R]
          Length = 226

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 97/165 (58%), Gaps = 8/165 (4%)

Query: 99  LNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYT 158
           L+ R++ +S+   K +F+LYS L GL+L +   +Y    ++ +F IT + F   + YG+ 
Sbjct: 65  LSFRVYKMSSGTVKTLFVLYSMLNGLTLCTIGFLYDPMIVLYSFGITLSIFTVSAFYGFK 124

Query: 159 TKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE- 217
           T  DL     F  +G   L L+SLVNL++  S++   ++  G V+F+ L AYD  +I+  
Sbjct: 125 TTEDLASYSRFFTIGLVSLILVSLVNLWLGVSSLYWMITVGGTVLFTGLIAYDVNRIRNM 184

Query: 218 ----AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
               A  D  DV   E+ +V+GAL LY+DFI +F+++LRF G +R
Sbjct: 185 SFYLAEEDGEDV---EKYAVMGALSLYLDFINLFLYILRFSGKKR 226


>gi|328946842|gb|EGG40979.1| integral membrane protein, receptor [Streptococcus sanguinis
           SK1087]
          Length = 227

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 127/241 (52%), Gaps = 25/241 (10%)

Query: 22  DQG-LRAYMIRVYNLMALGLGVTGIMSFL-VNILATTVDPDAASIIINRGVMLTGFGALM 79
           DQ  + ++  ++Y+++ +G+G++ I+S L +N            III+   +LTG     
Sbjct: 8   DQSDINSFYAKIYSIVGVGIGISAIVSLLMLNFFQ--------DIIIS---VLTG----- 51

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSL--SAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
                 WIF  A    FI + V   +   ++ AA  MFL YSA+ G +LS    +Y   +
Sbjct: 52  ----STWIFYAAIAVEFILVLVASGTARSNSPAALPMFLAYSAINGFTLSIIMALYLQST 107

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           ++  F  T   F ++   G  TK+DL  IG   + G  G+   S +N+F+RSS +D  +S
Sbjct: 108 VLLAFLTTTVMFFAMGFIGKVTKKDLSGIGKACMAGLIGIIAASFLNIFLRSSGLDFIIS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            +G++IFS L A+D QKI+  Y ++ +       ++  AL LY+DFI +F+ LLR  G  
Sbjct: 168 IVGVIIFSGLIAWDNQKIRYVY-EQTNGNPGNGWAISLALHLYLDFINLFLSLLRIFGRN 226

Query: 258 R 258
           +
Sbjct: 227 K 227


>gi|332359130|gb|EGJ36951.1| integral membrane protein, receptor [Streptococcus sanguinis SK49]
          Length = 227

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/241 (31%), Positives = 129/241 (53%), Gaps = 25/241 (10%)

Query: 22  DQG-LRAYMIRVYNLMALGLGVTGIMSFL-VNILATTVDPDAASIIINRGVMLTGFGALM 79
           DQ  + ++  ++Y+++ +G+G++ I+S L +N            III+   +LTG     
Sbjct: 8   DQSDINSFYAKIYSIVGVGIGISAIVSLLMLNFFQ--------DIIIS---VLTG----- 51

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSL--SAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
                 WIF  A    FIF+ V   +   ++ AA  MFL YSA+ G +LS    +Y   +
Sbjct: 52  ----STWIFYAAIAVEFIFVLVASGTARSNSPAALPMFLAYSAINGFTLSIIMALYLQST 107

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           ++  F  T   F ++   G  TK+DL  +G   + G  G+   S++N+F+RSS +D  +S
Sbjct: 108 VLLAFLTTTVMFFAMGFIGKVTKKDLSGMGRACMAGLIGIIAASVLNIFLRSSGLDFIIS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            +G++IFS L A+D QKI+  Y ++ +       ++  AL LY+DFI +F+ LLR  G  
Sbjct: 168 IVGVLIFSGLIAWDNQKIRYVY-EQTNGNPGNGWAISLALHLYLDFINLFLSLLRIFGRN 226

Query: 258 R 258
           +
Sbjct: 227 K 227


>gi|55822236|ref|YP_140677.1| hypothetical protein str0249 [Streptococcus thermophilus CNRZ1066]
 gi|55738221|gb|AAV61862.1| conserved hypothetical protein, membrane protein [Streptococcus
           thermophilus CNRZ1066]
 gi|312277661|gb|ADQ62318.1| Conserved hypothetical, predicted membrane protein (TMS7)
           [Streptococcus thermophilus ND03]
          Length = 229

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 123/250 (49%), Gaps = 37/250 (14%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFL---------VNILATTVDPDAASIIINRG 69
           +T D GL  +  ++Y L+ +G+G++ ++S+L         VNIL        A+I +   
Sbjct: 8   TTSDAGLNRFFGKIYGLVGIGVGLSAVISYLMLFPLSHLFVNILMNYSWIYMAAIFVELA 67

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
           ++    GA    +P                          AA  +FL+YSAL G +LS  
Sbjct: 68  LVFLASGAARRNTP--------------------------AALPLFLVYSALNGFTLSFI 101

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
            + YT   + Q F  TA  F  ++L G + KRDL  +  F++    G+ + SLVN+F  S
Sbjct: 102 IVQYTQAIVFQAFLSTAIVFFVMALIGVSIKRDLSGMVKFLMAALIGIIVASLVNIFFAS 161

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
           S +   +S + ++IFS L AYD Q IK+ Y    +    +  +V  AL LY+DFI +F++
Sbjct: 162 STMSFVISIVSVLIFSGLIAYDNQLIKKVYYST-NGQVTDGWAVSMALSLYLDFINLFLN 220

Query: 250 LLRFLGSRRD 259
           +LR   +R D
Sbjct: 221 ILRIF-ARHD 229


>gi|306834155|ref|ZP_07467275.1| membrane protein [Streptococcus bovis ATCC 700338]
 gi|304423728|gb|EFM26874.1| membrane protein [Streptococcus bovis ATCC 700338]
          Length = 230

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 124/235 (52%), Gaps = 18/235 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D  L  +  ++Y L+ +G+G++ ++SFL+  + T    +  +II+             Y 
Sbjct: 12  DSALNRFFAKIYGLVGVGIGLSALVSFLMLYVFT---DNMINIIV-------------YH 55

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
             + ++ IF  L + +FL       +  AA  +FL YSAL G +LS   + YT  ++VQ 
Sbjct: 56  PFVYYVAIFLELAL-VFLASNAARKNTPAALPLFLFYSALNGFTLSFVIVAYTQATVVQA 114

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +A  FG +++ G   K+DL  +   ++ G  G+ + SLVN+F+ S  +   +S + +
Sbjct: 115 FVSSALVFGVMAVIGTFVKKDLSGMAKALMAGLIGIIIASLVNMFIGSGTMSYIISIISV 174

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           +IFS L AYD Q IK  Y +       +  ++  AL LY+DFI +F+ LLR  G+
Sbjct: 175 LIFSGLIAYDNQMIKRVY-ESTGGNVGDGWAISMALSLYLDFINLFLSLLRIFGN 228


>gi|294782127|ref|ZP_06747453.1| membrane protein [Fusobacterium sp. 1_1_41FAA]
 gi|294480768|gb|EFG28543.1| membrane protein [Fusobacterium sp. 1_1_41FAA]
          Length = 228

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/170 (34%), Positives = 98/170 (57%), Gaps = 2/170 (1%)

Query: 91  APLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFG 150
           A LG+ + LN  L  +SA  A+++F+LYS +IG   S+    Y+  +I+  F      F 
Sbjct: 59  AGLGMVLVLNFFLKKMSAGIARILFILYSVVIGTIFSTVGFAYSPLAILYAFASALTIFV 118

Query: 151 SLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAY 210
            +S+YG+ TK DL    +F+I+G   L ++ L N+++    +    +  G+VIF+  TAY
Sbjct: 119 VMSIYGFFTKEDLSSYRTFLIVGLISLIVMGLFNIYLGVGRLYWIETIFGIVIFTGFTAY 178

Query: 211 DTQKIKE-AYS-DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           D  +IK  +Y  +  +    E+ S++ AL LY+DFI +F++LLR  G R+
Sbjct: 179 DVNRIKHISYQLENEEGENVEKLSIVWALELYLDFINLFLYLLRIFGKRK 228


>gi|227515611|ref|ZP_03945660.1| integral membrane protein, interacts with FtsH [Lactobacillus
           fermentum ATCC 14931]
 gi|227086041|gb|EEI21353.1| integral membrane protein, interacts with FtsH [Lactobacillus
           fermentum ATCC 14931]
          Length = 263

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 124/243 (51%), Gaps = 28/243 (11%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT- 81
            GL  ++ R+Y LM+L + V+ I ++L                      +T F A ++T 
Sbjct: 43  SGLNTFLTRMYGLMSLAVFVSAITAYLT---------------------MTVFKAAVFTF 81

Query: 82  ----SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
               + L WI +  P+ + + ++    + +   + +M +L S + G+  S    +YT+ +
Sbjct: 82  VAGHAGLVWIILLLPIALSMGISFS-ATRNPVGSFIMLMLVSIIYGVEFSLISAMYTAAN 140

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           I   F  +A  F +++++G  TKRDL   GS  +     L + SL+N+F+ S+AI    S
Sbjct: 141 IAAAFVSSAVIFVTMAVFGTVTKRDLSKAGSHAMAALVALIIASLINMFLHSAAITYIFS 200

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG-S 256
            + ++IF  LTA+D QK+K  Y +          +V+GAL LY+DFI +F+ LL+  G S
Sbjct: 201 YIAVIIFVVLTAWDAQKMKAIYVNYGAEVSMGGLAVMGALQLYLDFINLFLQLLQIFGMS 260

Query: 257 RRD 259
            RD
Sbjct: 261 NRD 263


>gi|327470416|gb|EGF15872.1| integral membrane protein [Streptococcus sanguinis SK330]
          Length = 227

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 124/240 (51%), Gaps = 23/240 (9%)

Query: 22  DQG-LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           DQ  + ++  ++Y+++ +G+G++ I+S L+      V  DA   I+ R V          
Sbjct: 8   DQSDINSFYAKIYSIVGVGIGISAIVSLLM----LFVFQDAIYTILTRSV---------- 53

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSL--SAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
                WI+  A    FI + V   +   ++ AA  MFL YSA+ G +LS    +Y    +
Sbjct: 54  -----WIYYAAIAVEFILVLVASGTARSNSPAALPMFLAYSAINGFTLSIIMALYLQSEV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  T   F ++   G  TK+DL  +G   + G  G+   S +N+F+RSS +D  +S 
Sbjct: 109 LLAFLTTTVMFFAMGFIGKVTKKDLSGMGRACMAGLIGIIAASFLNIFLRSSGLDFIVSI 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +G+++FS L A+D QKI+  Y ++ +       ++  AL LY+DFI +F+ LLR  G  +
Sbjct: 169 VGVLVFSGLIAWDNQKIRYVY-EQTNGNPGNGWAISLALHLYLDFINLFLSLLRIFGRNK 227


>gi|184155795|ref|YP_001844135.1| hypothetical protein LAF_1319 [Lactobacillus fermentum IFO 3956]
 gi|260663488|ref|ZP_05864378.1| integral membrane protein [Lactobacillus fermentum 28-3-CHN]
 gi|183227139|dbj|BAG27655.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956]
 gi|260552029|gb|EEX25082.1| integral membrane protein [Lactobacillus fermentum 28-3-CHN]
          Length = 236

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 124/243 (51%), Gaps = 28/243 (11%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT- 81
            GL  ++ R+Y LM+L + V+ I ++L                      +T F A ++T 
Sbjct: 16  SGLNTFLTRMYGLMSLAVFVSAITAYLT---------------------MTVFKAAVFTF 54

Query: 82  ----SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
               + L WI +  P+ + + ++    + +   + +M +L S + G+  S    +YT+ +
Sbjct: 55  VAGHAGLVWIILLLPIALSMGISFS-ATRNPVGSFIMLMLVSIIYGVEFSLISAMYTAAN 113

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           I   F  +A  F +++++G  TKRDL   GS  +     L + SL+N+F+ S+AI    S
Sbjct: 114 IAAAFVSSAVIFVTMAVFGTVTKRDLSKAGSHAMAALVALIIASLINMFLHSAAITYIFS 173

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG-S 256
            + ++IF  LTA+D QK+K  Y +          +V+GAL LY+DFI +F+ LL+  G S
Sbjct: 174 YIAVIIFVVLTAWDAQKMKAIYVNYGAEVSMGGLAVMGALQLYLDFINLFLQLLQIFGMS 233

Query: 257 RRD 259
            RD
Sbjct: 234 NRD 236


>gi|160939094|ref|ZP_02086445.1| hypothetical protein CLOBOL_03988 [Clostridium bolteae ATCC
           BAA-613]
 gi|158438057|gb|EDP15817.1| hypothetical protein CLOBOL_03988 [Clostridium bolteae ATCC
           BAA-613]
          Length = 236

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 99/170 (58%), Gaps = 3/170 (1%)

Query: 91  APLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFG 150
           A LGV I+L+ R+  +S   A+ +F LY+AL G+  S++   ++ + +   F ITA  FG
Sbjct: 68  AELGVVIYLSARIEKMSVGMARSLFFLYAALNGIVFSAYLFAFSLEILWMVFGITALFFG 127

Query: 151 SLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAY 210
            ++L G+    +   +  FM+ G   LF   +  +F+  SA D  +S +G+ +F  LTAY
Sbjct: 128 IMALIGWFGNINFTKLRPFMLGGLVFLFFYWIFAMFIDLSAFDTIVSTVGIFLFLVLTAY 187

Query: 211 DTQKIKEAYSDRYDVA--YAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           D +KI +A+   Y  A   A + S+  AL LY+DFI +FV+++R LG R+
Sbjct: 188 DVKKI-QAFHAYYGQAPEMAAKASIFSALQLYLDFINLFVYIMRILGRRK 236


>gi|327462017|gb|EGF08346.1| integral membrane protein, receptor [Streptococcus sanguinis
           SK1057]
 gi|332362246|gb|EGJ40046.1| integral membrane protein [Streptococcus sanguinis SK1056]
          Length = 227

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 128/241 (53%), Gaps = 25/241 (10%)

Query: 22  DQG-LRAYMIRVYNLMALGLGVTGIMSFL-VNILATTVDPDAASIIINRGVMLTGFGALM 79
           DQ  + ++  +VY+++ +G+G++ I+S L +N            III+   +LTG     
Sbjct: 8   DQSDINSFYAKVYSIVGVGIGISAIVSLLMLNFFQ--------DIIIS---VLTGS---- 52

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSL--SAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
                 WIF  A    FI + V   +   ++ AA  MFL YSA+ G +LS    +Y   +
Sbjct: 53  -----TWIFYAAIAVEFILVLVASGTARSNSPAALPMFLAYSAINGFTLSIIMALYLQST 107

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           ++  F  T   F ++   G  TK+DL  +G   + G  G+   SL+N+F+RSS +D  +S
Sbjct: 108 VLLAFLTTTVMFFAMGFIGKVTKKDLSGMGRACMAGLIGIIAASLLNIFLRSSGLDFIIS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            +G++IFS L A+D QKI+  Y ++ +       ++  AL LY+DFI +F+ LLR  G  
Sbjct: 168 IVGVLIFSGLIAWDNQKIRYVY-EQTNGNPGNGWAISLALHLYLDFINLFLSLLRIFGRN 226

Query: 258 R 258
           +
Sbjct: 227 K 227


>gi|322411171|gb|EFY02079.1| hypothetical protein SDD27957_01975 [Streptococcus dysgalactiae
           subsp. dysgalactiae ATCC 27957]
          Length = 229

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 124/238 (52%), Gaps = 19/238 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GL  +  ++Y+L+ +G+G++  +S+L   +      +  SII N+ ++   +GA++  
Sbjct: 11  DTGLNQFFAKIYSLVGMGIGLSAFVSYL---MLYPFRDNLVSIIANQPMVY--YGAVI-- 63

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
             +  I +F   G            +  AA  +FL+YSAL G +LS    +YT  ++ Q 
Sbjct: 64  --IELILVFVASGA--------ARKNTPAALPLFLIYSALNGFTLSFIIAIYTQTTVFQA 113

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +A  F ++S+ G  TKRD+  +   M     G+ + SL+NLF+ S  +   +S + +
Sbjct: 114 FVSSAVVFFAMSVLGVKTKRDMTGLRKAMFAALIGIIVASLINLFIGSGMMSYVISIISV 173

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +IFS L A D Q IK  Y    +    +  +V  AL LY+DFI +F+ LLR  G R D
Sbjct: 174 LIFSGLIASDNQMIKRVYQAT-NGQVGDGWAVAMALSLYLDFINLFISLLRLFG-RND 229


>gi|251781825|ref|YP_002996127.1| integral membrane protein [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242390454|dbj|BAH80913.1| integral membrane protein [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
          Length = 229

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 124/238 (52%), Gaps = 19/238 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GL  +  ++Y+L+ +G+G++  +S+L   +      +  SII N+ ++   +GA++  
Sbjct: 11  DAGLNQFFAKIYSLVGMGIGLSAFVSYL---MLYPFRDNLVSIIANQPMVY--YGAVI-- 63

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
             +  I +F   G            +  AA  +FL+YSAL G +LS    +YT  ++ Q 
Sbjct: 64  --IELILVFVASGA--------ARKNTPAALPLFLIYSALNGFTLSFIIAIYTQTTVFQA 113

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +A  F ++S+ G  TKRD+  +   M     G+ + SL+NLF+ S  +   +S + +
Sbjct: 114 FVSSAVVFFAMSVLGVKTKRDMTGLRKAMFAALIGIIVASLINLFIGSGMMSYVISIISV 173

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +IFS L A D Q IK  Y    +    +  +V  AL LY+DFI +F+ LLR  G R D
Sbjct: 174 LIFSGLIASDNQMIKRVYQAT-NGQVGDGWAVAMALSLYLDFINLFISLLRLFG-RND 229


>gi|323126638|gb|ADX23935.1| hypothetical protein SDE12394_01965 [Streptococcus dysgalactiae
           subsp. equisimilis ATCC 12394]
          Length = 229

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 124/238 (52%), Gaps = 19/238 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GL  +  ++Y+L+ +G+G++  +S+L   +      +  SII N+ ++   +GA++  
Sbjct: 11  DAGLNQFFAKIYSLVGMGIGLSAFVSYL---MLYPFRDNLVSIIANQPMVY--YGAVI-- 63

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
             +  I +F   G            +  AA  +FL+YSAL G +LS    +YT  ++ Q 
Sbjct: 64  --IELILVFVASGA--------ARKNTPAALPLFLIYSALNGFTLSFIIAIYTQTTVFQA 113

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +A  F ++S+ G  TKRD+  +   M     G+ + SL+NLF+ S  +   +S + +
Sbjct: 114 FVSSAVVFFAMSVLGVKTKRDMTGLRKAMFAALIGIIVASLINLFIGSGMMSYVISIISV 173

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +IFS L A D Q IK  Y    +    +  +V  AL LY+DFI +F+ LLR  G R D
Sbjct: 174 LIFSGLIASDNQMIKRVYQAT-NGQVGDGWAVAMALSLYLDFINLFISLLRLFG-RND 229


>gi|19745517|ref|NP_606653.1| hypothetical protein spyM18_0408 [Streptococcus pyogenes MGAS8232]
 gi|50913673|ref|YP_059645.1| integral membrane protein [Streptococcus pyogenes MGAS10394]
 gi|56808575|ref|ZP_00366306.1| COG0670: Integral membrane protein, interacts with FtsH
           [Streptococcus pyogenes M49 591]
 gi|71902956|ref|YP_279759.1| integral membrane protein [Streptococcus pyogenes MGAS6180]
 gi|94987930|ref|YP_596031.1| integral membrane protein [Streptococcus pyogenes MGAS9429]
 gi|94989804|ref|YP_597904.1| integral membrane protein [Streptococcus pyogenes MGAS10270]
 gi|94991814|ref|YP_599913.1| integral membrane protein [Streptococcus pyogenes MGAS2096]
 gi|139474364|ref|YP_001129080.1| hypothetical protein SpyM51557 [Streptococcus pyogenes str.
           Manfredo]
 gi|209558856|ref|YP_002285328.1| hypothetical protein Spy49_0295 [Streptococcus pyogenes NZ131]
 gi|306827959|ref|ZP_07461226.1| membrane protein [Streptococcus pyogenes ATCC 10782]
 gi|73921108|sp|Q5XDQ1|Y327_STRP6 RecName: Full=Uncharacterized membrane protein M6_Spy0327
 gi|73921125|sp|Q8P2D4|Y408_STRP8 RecName: Full=Uncharacterized membrane protein spyM18_0408
 gi|19747635|gb|AAL97152.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232]
 gi|50902747|gb|AAT86462.1| Integral membrane protein [Streptococcus pyogenes MGAS10394]
 gi|71802051|gb|AAX71404.1| integral membrane protein [Streptococcus pyogenes MGAS6180]
 gi|94541438|gb|ABF31487.1| integral membrane protein [Streptococcus pyogenes MGAS9429]
 gi|94543312|gb|ABF33360.1| Integral membrane protein [Streptococcus pyogenes MGAS10270]
 gi|94545322|gb|ABF35369.1| Integral membrane protein [Streptococcus pyogenes MGAS2096]
 gi|134272611|emb|CAM30878.1| putative membrane protein [Streptococcus pyogenes str. Manfredo]
 gi|209540057|gb|ACI60633.1| Membrane protein, putative [Streptococcus pyogenes NZ131]
 gi|304429878|gb|EFM32920.1| membrane protein [Streptococcus pyogenes ATCC 10782]
          Length = 229

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 122/238 (51%), Gaps = 19/238 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GL  +  ++Y+L+ +G+G++  +S+L   +      +  SI++N+ ++  G       
Sbjct: 11  DVGLNQFFAKIYSLVGMGVGLSAFVSYL---MLYPFRENLISILVNQPMIYYG------A 61

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + +  I +F   G            +  AA  +FL+YSAL G +LS   + Y   ++ Q 
Sbjct: 62  AIIELILVFVASGA--------ARKNTPAALPIFLIYSALNGFTLSFIIVAYAQTTVFQA 113

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +AA F ++S+ G  TKRD+  +   M     G+ + SL+NLF+ S  +   +S + +
Sbjct: 114 FLSSAAVFFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISVISV 173

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +IFS L A D Q IK  Y    +    +  +V  AL LY+DFI +F+ LLR  G R D
Sbjct: 174 LIFSGLIASDNQMIKRVYQAT-NGQVGDGWAVAMALSLYLDFINLFISLLRIFG-RND 229


>gi|325978968|ref|YP_004288684.1| putative integral membrane protein [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|325178896|emb|CBZ48940.1| putative integral membrane protein [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
          Length = 230

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 122/235 (51%), Gaps = 18/235 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D  L  +  ++Y L+ +G+G++ ++SFL+  + T    +  +II+             Y 
Sbjct: 12  DSALNRFFAKIYGLVGVGIGLSALVSFLMLYVFT---DNMVNIIV-------------YH 55

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
             + +  IF  L V +FL       +  AA  +FL YSAL G +LS   + YT  ++VQ 
Sbjct: 56  PFVYYGAIFLEL-VLVFLASNAARKNTPAALPLFLFYSALNGFTLSFVIVAYTQTTVVQA 114

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +A  FG +++ G   KRDL  +   ++    G+ + SLVN+F+ S  +   +S + +
Sbjct: 115 FVSSALVFGVMAIIGTFVKRDLSGMAKALMAALIGIIIASLVNMFIGSGTMSYIISIISV 174

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           +IFS L AYD Q IK  Y +       +  ++  AL LY+DFI +F+ LLR  GS
Sbjct: 175 LIFSGLIAYDNQMIKRVY-ESTGGNVGDGWAISMALSLYLDFINLFLSLLRIFGS 228


>gi|254303878|ref|ZP_04971236.1| possible inner membrane protein [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148324070|gb|EDK89320.1| possible inner membrane protein [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 228

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 92/159 (57%), Gaps = 4/159 (2%)

Query: 103 LHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRD 162
           ++ +SA  A+++FL YS + G++L+   L+Y  + I   F IT   F   ++YGYTT+ D
Sbjct: 71  INKISAGLARILFLAYSLVNGITLTVIGLIYAPQIIFYAFMITLTIFIVTAIYGYTTQED 130

Query: 163 LGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIK---EAY 219
           L     F ++    L  LS+ N FM+   ++  ++  G+VIF+ L AYD  +IK      
Sbjct: 131 LSSYRRFFMIALISLIALSIFNAFMKVGMLEWVITIAGVVIFTGLIAYDVNRIKVISYQL 190

Query: 220 SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +D  D    E+  +IGAL LY+DFI +F+++LR  G ++
Sbjct: 191 ADG-DTETMEKMGIIGALNLYLDFINLFIYILRIFGRKK 228


>gi|315918135|ref|ZP_07914375.1| integral membrane protein [Fusobacterium gonidiaformans ATCC 25563]
 gi|313692010|gb|EFS28845.1| integral membrane protein [Fusobacterium gonidiaformans ATCC 25563]
          Length = 232

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 96/165 (58%), Gaps = 8/165 (4%)

Query: 99  LNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYT 158
           L+ R++ +S+   K +F+ YS L GL+L +   +Y    ++ +F IT + F   + YG+ 
Sbjct: 71  LSFRVYKMSSGTVKTLFVFYSMLNGLTLCTIGFLYDPMIVLYSFGITLSIFTVSAFYGFK 130

Query: 159 TKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE- 217
           T  DL     F  +G   L L+SLVNL++  S++   ++  G V+F+ L AYD  +I+  
Sbjct: 131 TTEDLASYSRFFTIGLVSLILVSLVNLWLGVSSLYWMITVGGTVLFTGLIAYDVNRIRNM 190

Query: 218 ----AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
               A  D  DV   E+ +V+GAL LY+DFI +F+++LRF G +R
Sbjct: 191 SFYLAEEDGEDV---EKYAVMGALSLYLDFINLFLYILRFSGKKR 232


>gi|94993690|ref|YP_601788.1| membrane protein [Streptococcus pyogenes MGAS10750]
 gi|94547198|gb|ABF37244.1| Integral membrane protein [Streptococcus pyogenes MGAS10750]
          Length = 229

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 122/238 (51%), Gaps = 19/238 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GL  +  ++Y+L+ +G+G++  +S+L   +      +  SI++N+ ++  G       
Sbjct: 11  DVGLNQFFAKIYSLVGMGVGLSAFVSYL---MLYPFRENLISILVNQPMIYYG------A 61

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + +  I +F   G            +  AA  +FL+YSAL G +LS   + Y   ++ Q 
Sbjct: 62  AIIELILVFIASGA--------ARKNTPAALPIFLIYSALNGFTLSFIIVAYAQTTVFQA 113

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +AA F ++S+ G  TKRD+  +   M     G+ + SL+NLF+ S  +   +S + +
Sbjct: 114 FLSSAAVFFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISVISV 173

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +IFS L A D Q IK  Y    +    +  +V  AL LY+DFI +F+ LLR  G R D
Sbjct: 174 LIFSGLIASDNQMIKRVYQAT-NGQVGDGWAVAMALSLYLDFINLFISLLRIFG-RND 229


>gi|257466997|ref|ZP_05631308.1| integral membrane protein [Fusobacterium gonidiaformans ATCC 25563]
          Length = 226

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 96/165 (58%), Gaps = 8/165 (4%)

Query: 99  LNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYT 158
           L+ R++ +S+   K +F+ YS L GL+L +   +Y    ++ +F IT + F   + YG+ 
Sbjct: 65  LSFRVYKMSSGTVKTLFVFYSMLNGLTLCTIGFLYDPMIVLYSFGITLSIFTVSAFYGFK 124

Query: 159 TKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE- 217
           T  DL     F  +G   L L+SLVNL++  S++   ++  G V+F+ L AYD  +I+  
Sbjct: 125 TTEDLASYSRFFTIGLVSLILVSLVNLWLGVSSLYWMITVGGTVLFTGLIAYDVNRIRNM 184

Query: 218 ----AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
               A  D  DV   E+ +V+GAL LY+DFI +F+++LRF G +R
Sbjct: 185 SFYLAEEDGEDV---EKYAVMGALSLYLDFINLFLYILRFSGKKR 226


>gi|296875967|ref|ZP_06900026.1| membrane protein [Streptococcus parasanguinis ATCC 15912]
 gi|322390076|ref|ZP_08063611.1| membrane protein [Streptococcus parasanguinis ATCC 903]
 gi|296433042|gb|EFH18830.1| membrane protein [Streptococcus parasanguinis ATCC 15912]
 gi|321143203|gb|EFX38646.1| membrane protein [Streptococcus parasanguinis ATCC 903]
          Length = 228

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 123/247 (49%), Gaps = 37/247 (14%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMS---------FLVNILATTVDPDAASIIINRGVML 72
             GL A+  ++Y+L+ +G+G++ ++S         F V IL T      A++++   ++ 
Sbjct: 10  QSGLNAFYNKIYSLVGIGVGISALVSGLMMTVFQDFFVQILTTAPMVYYAAVVVELILVF 69

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
              G  +  SP                          +A  +FL+YSAL G +LS     
Sbjct: 70  VASGKAVKNSP--------------------------SALPIFLIYSALNGFTLSFIIAR 103

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           Y   ++ + F ++A  F  +   G   K+DL  +G  ++    G+ + S+VN+F+RSS +
Sbjct: 104 YMQATVYKAFLVSALMFIVMGAIGRVVKKDLSGMGRALMGVLIGVIIASVVNMFLRSSGM 163

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           D  +S + + +F+ LTA+D QKI+  Y D+ +   A   +V  AL LY+DFI +F+ LLR
Sbjct: 164 DYILSIISVFLFAGLTAWDNQKIRYVY-DQTNGQPATGWAVAMALELYLDFINLFISLLR 222

Query: 253 FLGSRRD 259
             G R D
Sbjct: 223 IFG-RND 228


>gi|325294511|ref|YP_004281025.1| hypothetical protein Dester_0310 [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064959|gb|ADY72966.1| protein of unknown function UPF0005 [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 223

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 101/177 (57%), Gaps = 9/177 (5%)

Query: 85  RWIFI-FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           +W FI FA L + + +   L   +   +   F L+SA  G+ L+  F+VYT  SI+  F 
Sbjct: 54  KWGFIGFAVLSLVLVIATGLLRNNPLLSGAAFYLFSAAEGILLAPIFIVYTGSSIITAFL 113

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMSAMGLV 202
             +  FG ++L   + K D    G+++ +G  G+ + SL+N+F ++S+ + + +S + ++
Sbjct: 114 TASILFGIMALLAISKKVDFRKFGTYLFVGLIGIVVASLLNVFLLKSAGLGIAISILTVL 173

Query: 203 IFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +F  LTAYD QK++E       +AY E  +  GAL LY+D I +F+ LLR  G RR+
Sbjct: 174 VFLGLTAYDIQKLEE-------MAYTEGNAFFGALALYLDLINLFLALLRLFGERRE 223


>gi|167771273|ref|ZP_02443326.1| hypothetical protein ANACOL_02631 [Anaerotruncus colihominis DSM
           17241]
 gi|167666524|gb|EDS10654.1| hypothetical protein ANACOL_02631 [Anaerotruncus colihominis DSM
           17241]
          Length = 235

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 104/183 (56%), Gaps = 1/183 (0%)

Query: 77  ALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK 136
           AL  T  L +  + A L + +FL  RLH +S  AA+ +FL +S L G++LS   L+Y + 
Sbjct: 53  ALFITWWLPFALLVAKLALVVFLTARLHKMSVGAARGIFLGFSVLTGVTLSPLMLMYEAG 112

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTM 196
           S +  F + A  FG ++  G  TKRD+      ++ G   L ++ LV+LF+    +D  +
Sbjct: 113 SAIFLFGVAALFFGVMAGAGLVTKRDVSGFAPIVLFGLIALVVMELVSLFIHMPMLDTAI 172

Query: 197 SAMGLVIFSALTAYDTQKIKE-AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
             +G+ IF  +T YD +K K+  Y+   D    ++ S+  AL LY+DFI +F++LLR LG
Sbjct: 173 CFIGIAIFLGVTTYDAKKCKDYYYAYENDAQMLDKVSIFSALNLYLDFINLFLYLLRLLG 232

Query: 256 SRR 258
            RR
Sbjct: 233 KRR 235


>gi|325911458|ref|ZP_08173870.1| putative membrane protein [Lactobacillus iners UPII 143-D]
 gi|325476808|gb|EGC79962.1| putative membrane protein [Lactobacillus iners UPII 143-D]
          Length = 237

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 102/187 (54%), Gaps = 6/187 (3%)

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           F AL     L ++ +  P  + I  +   + + ++   ++ +L + + GL+ S   L +T
Sbjct: 54  FNALSQNHALSFVLLILPFALIIGTSFSKNPILSF---VLLMLTAMVYGLTFSIICLAFT 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI   F  ++A F +++  G TTK+DL  +GS+      GL + +++N+F+R+  +  
Sbjct: 111 QTSITAAFLSSSAVFITMAFIGTTTKKDLSNLGSYASAALIGLIVATIINMFLRNPMVTY 170

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
             S + +VIF+ LTA+D QKIK  +   +D       ++IGAL LY+DFI +F+  L+  
Sbjct: 171 IFSYIAVVIFTILTAWDAQKIKNIFIQNHDEIATTSLAIIGALTLYLDFINLFIQFLQIF 230

Query: 255 G---SRR 258
           G   +RR
Sbjct: 231 GFSDNRR 237


>gi|288906001|ref|YP_003431223.1| integral membrane protein [Streptococcus gallolyticus UCN34]
 gi|306832020|ref|ZP_07465175.1| membrane protein [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|288732727|emb|CBI14301.1| putative conserved integral membrane protein [Streptococcus
           gallolyticus UCN34]
 gi|304425946|gb|EFM29063.1| membrane protein [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
          Length = 230

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 122/244 (50%), Gaps = 36/244 (14%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D  L  +  ++Y L+ +G+G++ ++SFL+                            ++T
Sbjct: 12  DSALNRFFAKIYGLVGVGIGLSALVSFLM--------------------------LYVFT 45

Query: 82  SPLRWIFIFAPLGVF--IFLNVRLHSLSAYAAKM-------MFLLYSALIGLSLSSFFLV 132
             +  I ++ P   +  IFL + L  L++ AA+        +FL YSAL G +LS   + 
Sbjct: 46  DNMVNIIVYHPFVYYGAIFLELALVFLASNAARKNTPAALPLFLFYSALNGFTLSFVIVA 105

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT  ++VQ F  +A  FG +++ G   KRDL  +   ++    G+ + SLVN+F+ S  +
Sbjct: 106 YTQTTVVQAFVSSALVFGVMAIIGTFVKRDLSGMAKALMAALIGIIIASLVNMFIGSGTM 165

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
              +S + ++IFS L AYD Q IK  Y +       +  ++  AL LY+DFI +F+ LLR
Sbjct: 166 SYIISIISVLIFSGLIAYDNQMIKRVY-ESTGGNVGDGWAISMALSLYLDFINLFLSLLR 224

Query: 253 FLGS 256
             GS
Sbjct: 225 IFGS 228


>gi|21909796|ref|NP_664064.1| hypothetical protein SpyM3_0260 [Streptococcus pyogenes MGAS315]
 gi|28896511|ref|NP_802861.1| hypothetical protein SPs1599 [Streptococcus pyogenes SSI-1]
 gi|73921091|sp|Q8K8I9|Y260_STRP3 RecName: Full=Uncharacterized membrane protein SpyM3_0260/SPs1599
 gi|21903981|gb|AAM78867.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315]
 gi|28811765|dbj|BAC64694.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1]
          Length = 229

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 122/238 (51%), Gaps = 19/238 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GL  +  ++Y+L+ +G+G++  +S+L   +      +  SI++N+ ++  G       
Sbjct: 11  DVGLNQFFAKIYSLVGMGVGLSAFVSYL---MLYPFRENLISILVNQPMIYYG------A 61

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + +  I +F   G            +  AA  +FL+Y+AL G +LS   + Y   ++ Q 
Sbjct: 62  AIIELILVFVASGA--------ARKNTPAALPIFLIYAALNGFTLSFIIVAYAQTTVFQA 113

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +AA F ++S+ G  TKRD+  +   M     G+ + SL+NLF+ S  +   +S + +
Sbjct: 114 FLSSAAVFFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISVISV 173

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +IFS L A D Q IK  Y    +    +  +V  AL LY+DFI +F+ LLR  G R D
Sbjct: 174 LIFSGLIASDNQMIKRVYQAT-NGQVGDGWAVAMALSLYLDFINLFISLLRIFG-RND 229


>gi|304384669|ref|ZP_07367015.1| integral membrane protein [Pediococcus acidilactici DSM 20284]
 gi|304328863|gb|EFL96083.1| integral membrane protein [Pediococcus acidilactici DSM 20284]
          Length = 254

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/258 (29%), Positives = 130/258 (50%), Gaps = 26/258 (10%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           ++    RV+N+      TI  GL  ++ ++Y  MA  +  +GI+++L      TV   A 
Sbjct: 22  NLDQQPRVINN------TI--GLNRFLTKMYGWMAAAVAFSGIIAYL----GATVWRPAV 69

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
              +++G M              W+ IF  L +F+    +    +   + +M   +S   
Sbjct: 70  MTFLSQGRMGI------------WL-IFIALFLFMIFGQKTALQNPTVSFLMLFAFSGFF 116

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G++LSS F++++  +I   FF  AA F  +S+ G TTKRDL  +G+ ++     + ++S+
Sbjct: 117 GITLSSVFMLFSIGTIAGAFFSAAAVFVVMSVIGLTTKRDLSRLGTHLLAALIAMVVVSV 176

Query: 183 VNL-FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYM 241
           +NL F+ SSA+    S +G+VIF+ L+ +DT  +K  Y    D       ++ GA  LY+
Sbjct: 177 INLFFLHSSAVTFFFSLIGIVIFAGLSMFDTASMKNLYLSYGDRVSETGLAIQGAFSLYL 236

Query: 242 DFIQIFVHLLRFLGSRRD 259
           DFI +F + L   G  RD
Sbjct: 237 DFINLFQYFLTIFGWSRD 254


>gi|312868483|ref|ZP_07728683.1| putative membrane protein [Streptococcus parasanguinis F0405]
 gi|311096228|gb|EFQ54472.1| putative membrane protein [Streptococcus parasanguinis F0405]
          Length = 228

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 123/247 (49%), Gaps = 37/247 (14%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMS---------FLVNILATTVDPDAASIIINRGVML 72
             GL A+  ++Y+L+ +G+G++ ++S         F V IL T      A++++   ++ 
Sbjct: 10  QSGLNAFYNKIYSLVGIGVGISALVSGLMMTVFQDFFVQILMTAPMVYYAAVVVELILVF 69

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
              G  +  SP                          +A  +FL+YSAL G +LS     
Sbjct: 70  VASGKAVKNSP--------------------------SALPIFLIYSALNGFTLSFIIAR 103

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           Y   ++ + F ++A  F  +   G   K+DL  +G  ++    G+ + S+VN+F+RSS +
Sbjct: 104 YMQATVYKAFLVSALMFIVMGAIGRVVKKDLSGMGRALMGVLIGVIIASVVNMFLRSSGM 163

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           D  +S + + +F+ LTA+D QKI+  Y D+ +   A   +V  AL LY+DFI +F+ LLR
Sbjct: 164 DYILSIISVFLFAGLTAWDNQKIRYVY-DQTNGQPATGWAVAMALELYLDFINLFISLLR 222

Query: 253 FLGSRRD 259
             G R D
Sbjct: 223 IFG-RND 228


>gi|300024760|ref|YP_003757371.1| hypothetical protein Hden_3257 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526581|gb|ADJ25050.1| protein of unknown function UPF0005 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 255

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 81/247 (32%), Positives = 125/247 (50%), Gaps = 31/247 (12%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           +DQGLR++M+  YN MALG+  T ++  L              ++ N  VM       + 
Sbjct: 21  LDQGLRSFMLGTYNYMALGVAGTAVVVML--------------LMANPAVMQA-----IA 61

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS--- 137
             P++W+   A LG+  F      S S   A   F  Y AL G+ +S    ++ ++    
Sbjct: 62  LGPMKWVIFAALLGLGWFAPRLFFSGSTALAHGAFWAYCALWGVLISPMIEMFVARGLSG 121

Query: 138 -IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM-----RSSA 191
            I Q FFI AA+F + SL GYTTK+D+     F+ M + GL +  LV+ F       S  
Sbjct: 122 LIGQAFFIAAATFAATSLIGYTTKKDMTGWSGFLSMASIGLIIAMLVSFFFITDPGTSKT 181

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFV 248
           + L +S++ +++FS +TA++TQ IK  Y +       +   R S+ GA MLY  FI +F+
Sbjct: 182 VSLLISSVVVLLFSVMTAFETQAIKSMYIENASHGSEDALKRSSIFGAFMLYGSFITMFI 241

Query: 249 HLLRFLG 255
           H+L  LG
Sbjct: 242 HILNILG 248


>gi|116512589|ref|YP_811496.1| integral membrane protein, interacts with FtsH [Lactococcus lactis
           subsp. cremoris SK11]
 gi|116108243|gb|ABJ73383.1| Integral membrane protein, interacts with FtsH [Lactococcus lactis
           subsp. cremoris SK11]
          Length = 237

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 128/243 (52%), Gaps = 27/243 (11%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL A+  ++Y LM  G+ V+ ++S+++     T   D    I+  G +   F  +++  
Sbjct: 16  DGLNAFFSKIYALMGAGVLVSALVSWIM----ITFFLDNMRAILQSGSL---FFLVLWII 68

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKM---MFLLYSALIGLSLSSFFLVYTSKSIV 139
           PL  +             V L  L+   +KM   +F+ Y+A +G  +S   L+YT+  I 
Sbjct: 69  PLVMV-------------VSLQGLAMKNSKMALPIFIGYAAFMGFLISFTLLMYTATDIT 115

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
             F   +A F  LS+YG  TKR+L  +G  + +  +GL +  L+NLF  S+ + + +S +
Sbjct: 116 LAFITASAMFFGLSVYGRFTKRNLSGMGKALGVAVWGLIIAMLLNLFFASTGLTILISLV 175

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL---GS 256
           G+VIFS L A+D QKI + Y + ++   ++  ++  AL LY+DFI +F+ LLR     G 
Sbjct: 176 GVVIFSGLIAWDNQKITQVY-NAHNGQVSDGWAISMALSLYLDFINMFLFLLRLFGIAGG 234

Query: 257 RRD 259
            RD
Sbjct: 235 NRD 237


>gi|81428253|ref|YP_395253.1| integral membrane protein [Lactobacillus sakei subsp. sakei 23K]
 gi|78609895|emb|CAI54942.1| Hypothetical integral membrane protein [Lactobacillus sakei subsp.
           sakei 23K]
          Length = 233

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 132/256 (51%), Gaps = 30/256 (11%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
           +RVVN        +D   R +  +VY LMALG+G++ +++ L   L T       +I+ N
Sbjct: 4   RRVVN--------VDSESR-FFSKVYGLMALGVGISALVAVL---LVTVFASQTVAILSN 51

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
                         + + W  +   + + + ++ R  + +  A+ MMF+ Y+ L GL+ +
Sbjct: 52  S------------NTWMVWGLMIVEMILVVQIS-RKATKNPSASMMMFIAYALLNGLTFT 98

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
              L Y    I   F  +A  F ++S YG  TK +L   G F +MG  G+ ++++VN FM
Sbjct: 99  VILLAYNIGQIGAAFISSALVFVAMSAYGRMTKNNLSGFGKFAMMGLIGIIIVTIVNAFM 158

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFI 244
            S+AI+  +S   L++F  LTA+D QK+      Y    +V+ +   +V+GAL LY+DF+
Sbjct: 159 GSAAIEYFLSYAMLIVFIILTAWDNQKLSLLYRQYGSTGEVSISGL-AVMGALTLYLDFV 217

Query: 245 QIFVHLLRFLG-SRRD 259
            +F+ +L+  G   RD
Sbjct: 218 NLFITMLQIFGFGNRD 233


>gi|324993657|gb|EGC25576.1| integral membrane protein, receptor [Streptococcus sanguinis SK405]
 gi|324995031|gb|EGC26944.1| integral membrane protein, receptor [Streptococcus sanguinis SK678]
 gi|325695048|gb|EGD36951.1| integral membrane protein, receptor [Streptococcus sanguinis SK150]
 gi|327474530|gb|EGF19935.1| integral membrane protein, receptor [Streptococcus sanguinis SK408]
          Length = 227

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 128/241 (53%), Gaps = 25/241 (10%)

Query: 22  DQG-LRAYMIRVYNLMALGLGVTGIMSFL-VNILATTVDPDAASIIINRGVMLTGFGALM 79
           DQ  + ++  ++Y+++ +G+G++ I+S L +N            III+   +LTG     
Sbjct: 8   DQSDINSFYAKIYSIVGVGIGISAIVSLLMLNFFQ--------DIIIS---VLTGS---- 52

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSL--SAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
                 WIF  A    FI + V   +   ++ AA  MFL YSA+ G +LS    +Y   +
Sbjct: 53  -----TWIFYAAIAVEFILVLVASGTARSNSPAALPMFLAYSAINGFTLSIIMALYLQST 107

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           ++  F  T   F ++   G  TK+DL  +G   + G  G+   S++N+F+RSS +D  +S
Sbjct: 108 VLLAFLTTTVMFFAMGFIGKVTKKDLSGMGRACMAGLIGIIAASVLNIFLRSSGLDFIIS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            +G++IFS L A+D QKI+  Y ++ +       ++  AL LY+DFI +F+ LLR  G  
Sbjct: 168 IVGVLIFSGLIAWDNQKIRYVY-EQTNGNPGNGWAISLALHLYLDFINLFLSLLRIFGRN 226

Query: 258 R 258
           +
Sbjct: 227 K 227


>gi|125624700|ref|YP_001033183.1| hypothetical protein llmg_1918 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|124493508|emb|CAL98487.1| putative membrane protein [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300071495|gb|ADJ60895.1| hypothetical protein LLNZ_09875 [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 237

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 128/243 (52%), Gaps = 27/243 (11%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL A+  ++Y LM  G+ V+ ++S+++     T   D    I+  G +   F  +++  
Sbjct: 16  DGLNAFFSKIYALMGAGVLVSALVSWIM----ITFFLDNMRAILQSGSL---FLLVLWII 68

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKM---MFLLYSALIGLSLSSFFLVYTSKSIV 139
           PL  +             V L  L+   +KM   +F+ Y+A +G  +S   L+YT+  I 
Sbjct: 69  PLVMV-------------VSLQGLAMKNSKMALPIFIGYAAFMGFLISFTLLMYTATDIT 115

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
             F   +A F  LS+YG  TKR+L  +G  + +  +GL +  L+NLF  S+ + + +S +
Sbjct: 116 LAFITASAMFFGLSVYGRFTKRNLSGMGKALGVAVWGLIVAMLLNLFFASTGLTILISLV 175

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL---GS 256
           G+VIFS L A+D QKI + Y + ++   ++  ++  AL LY+DFI +F+ LLR     G 
Sbjct: 176 GVVIFSGLIAWDNQKITQVY-NAHNGQVSDGWAISMALSLYLDFINMFLFLLRLFGIAGG 234

Query: 257 RRD 259
            RD
Sbjct: 235 NRD 237


>gi|15674509|ref|NP_268683.1| hypothetical protein SPy_0358 [Streptococcus pyogenes M1 GAS]
 gi|71910115|ref|YP_281665.1| integral membrane protein [Streptococcus pyogenes MGAS5005]
 gi|15214345|sp|Q9A1B9|Y358_STRP1 RecName: Full=Uncharacterized membrane protein
           SPy_0358/M5005_Spy0301
 gi|13621611|gb|AAK33404.1| conserved hypothetical protein (putative membrane spanning protein)
           [Streptococcus pyogenes M1 GAS]
 gi|71852897|gb|AAZ50920.1| integral membrane protein [Streptococcus pyogenes MGAS5005]
          Length = 229

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 71/238 (29%), Positives = 121/238 (50%), Gaps = 19/238 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GL  +  ++Y+L+ +G+G++  +S+L   +      +  SI++N+ ++  G   +   
Sbjct: 11  DVGLNQFFAKIYSLVGMGVGLSAFVSYL---MLYPFRENLISILVNQPMIYYGAAIIEL- 66

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                        + +F+       +  AA  +FL+YSAL G +LS   + Y   ++ Q 
Sbjct: 67  -------------ILVFVASSAARKNTPAALPIFLIYSALNGFTLSFIIVAYAQTTVFQA 113

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +AA F ++S+ G  TKRD+  +   M     G+ + SL+NLF+ S  +   +S + +
Sbjct: 114 FLSSAAVFFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISVISV 173

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +IFS L A D Q IK  Y    +    +  +V  AL LY+DFI +F+ LLR  G R D
Sbjct: 174 LIFSGLIASDNQMIKRVYQAT-NGQVGDGWAVAMALSLYLDFINLFISLLRIFG-RND 229


>gi|301299765|ref|ZP_07206008.1| putative membrane protein [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|300852620|gb|EFK80261.1| putative membrane protein [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 235

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 120/246 (48%), Gaps = 34/246 (13%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLV-NILATTVDPDAASIIINRGVMLTGFGALMYTS 82
           GL ++M ++Y  MA  + ++ + ++L+ N+                        AL + +
Sbjct: 14  GLNSFMTKMYGFMAGAVAISAVTAYLISNVYQVQ--------------------ALTFFA 53

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFL------LYSALIGLSLSSFFLVYTSK 136
             RW    A  G+ I   V + S+S  A +   +      LYS L GL       VY+S+
Sbjct: 54  NNRW----AVWGILILQVVLVMSMSFKADRSPAMSLTGLGLYSVLEGLFFGLIVQVYSSQ 109

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTM 196
            +   F      F  L+L G  TK+DL  IG   +     L ++ ++N+F+RSS I L  
Sbjct: 110 DVTMAFVSATVMFTVLALMGTNTKKDLSGIGRQAMAALIALIIVMIINIFLRSSIITLAF 169

Query: 197 SAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF--- 253
           S +G+VIF+AL A+D+Q+ ++ Y    +   A   +++GAL LY+DF+ +F+ LL     
Sbjct: 170 SFIGVVIFAALIAWDSQRFRQMYIQYGNQINATNLAIMGALQLYLDFVNLFIQLLNIFTG 229

Query: 254 LGSRRD 259
           LG  +D
Sbjct: 230 LGGNKD 235


>gi|114571450|ref|YP_758130.1| hypothetical protein Mmar10_2911 [Maricaulis maris MCS10]
 gi|114341912|gb|ABI67192.1| conserved hypothetical protein [Maricaulis maris MCS10]
          Length = 254

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 136/276 (49%), Gaps = 43/276 (15%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + ++ R  +       ++D GLR +M+ VYN M LGL ++  +++ V     T  P    
Sbjct: 1   MNDFSRTYSGAGTLDMSVDAGLRKFMLGVYNKMGLGLLLSAAIAYAVG----TYPP---- 52

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                   LT    L++ +PL ++  + PL +       + + S   + +++     LIG
Sbjct: 53  --------LT---QLVFGTPLLFVVQWGPLALLFGSMFFMRNPSPAGSAILYWAIVVLIG 101

Query: 124 LSLSSFFLVYTSKSIVQT----------------FFITAASFGSLSLYGYTTKRDLGPIG 167
            SLS + ++ +   +VQ+                F ITA SF +LS++GYTTKR+L P+ 
Sbjct: 102 ASLSFWVIIASQNQVVQSVGGRSLAIDFGTIAQAFVITAGSFMALSVFGYTTKRNLMPLQ 161

Query: 168 SFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVA 226
           +F+ M  FG   L L+N  F +S  ++L +    L++ + + A+ TQ +K  Y   Y +A
Sbjct: 162 NFLFMAMFGAIALGLMNAFFFQSGMLELLLQFGVLLLMAGVVAWQTQTLKVTY---YQIA 218

Query: 227 YAERQSVI----GALMLYMDFIQIFVHLLRFLGSRR 258
             +R   +    GAL LY+ F+ +F  +L  LGSR 
Sbjct: 219 GDQRSMAVMTNMGALNLYIAFVNMFQIILSLLGSRE 254


>gi|183601354|ref|ZP_02962724.1| hypothetical protein BIFLAC_01812 [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|219683410|ref|YP_002469793.1| hypothetical protein BLA_0925 [Bifidobacterium animalis subsp.
           lactis AD011]
 gi|241191147|ref|YP_002968541.1| hypothetical protein Balac_1123 [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|241196553|ref|YP_002970108.1| hypothetical protein Balat_1123 [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|183218960|gb|EDT89601.1| hypothetical protein BIFLAC_01812 [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|219621060|gb|ACL29217.1| Integral membrane protein [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|240249539|gb|ACS46479.1| hypothetical protein Balac_1123 [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|240251107|gb|ACS48046.1| hypothetical protein Balat_1123 [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|289178892|gb|ADC86138.1| Integral membrane protein [Bifidobacterium animalis subsp. lactis
           BB-12]
 gi|295794136|gb|ADG33671.1| hypothetical protein BalV_1083 [Bifidobacterium animalis subsp.
           lactis V9]
          Length = 261

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 110/178 (61%), Gaps = 5/178 (2%)

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           WI     +G+ I+L +R+  +S  AA++ F +Y+AL+G++LS+ FL Y   +I   F ++
Sbjct: 85  WILAIVEIGLAIYLGMRVMKMSTTAARVCFYVYAALMGVTLSTIFLAYDLGTIGIAFLVS 144

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL-TMSAMGLVIF 204
           A  + +L+++G TTK ++   G  +++    L +  ++ +F+  S   L  ++A+G+++F
Sbjct: 145 AGFYFALTMFGLTTKGNMLKAGPILMIALVVLIIAEVIMMFVAPSNTMLKVVTAIGILLF 204

Query: 205 SALTAYDTQKIKEA---YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           + LT YD Q  K+A   Y+ +   A  ++ S++ AL LY+DFI +F+++L+ LG  RD
Sbjct: 205 AGLTIYDAQFTKKAFAVYASQGPEA-IKKISILCALNLYLDFINLFLYILQALGLSRD 261


>gi|270290449|ref|ZP_06196674.1| integral membrane protein, interacts with FtsH [Pediococcus
           acidilactici 7_4]
 gi|270281230|gb|EFA27063.1| integral membrane protein, interacts with FtsH [Pediococcus
           acidilactici 7_4]
          Length = 232

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 121/237 (51%), Gaps = 18/237 (7%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  ++ ++Y  MA  +  +GI+++L      TV   A    +++G M            
Sbjct: 13  GLNRFLTKMYGWMAAAVAFSGIIAYL----GATVWRPAVMTFLSQGRMGI---------- 58

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
             W+ IF  L +F+    +    +   + +M   +S   G++LSS F++++  +I   FF
Sbjct: 59  --WL-IFIALFLFMIFGQKTALQNPTVSFLMLFAFSGFFGITLSSVFMLFSIGTIAGAFF 115

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL-FMRSSAIDLTMSAMGLV 202
             AA F  +S+ G TTKRDL  +G+ ++     + ++S++NL F+ SSA+    S +G+V
Sbjct: 116 SAAAVFVVMSVIGLTTKRDLSRLGTHLLAALIAMVVVSVINLFFLHSSAVTFFFSLIGIV 175

Query: 203 IFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           IF+ L+ +DT  +K  Y    D       ++ GA  LY+DFI +F + L   G  RD
Sbjct: 176 IFAGLSMFDTASMKNLYLSYGDRVSETGLAIQGAFSLYLDFINLFQYFLTIFGWSRD 232


>gi|262038764|ref|ZP_06012121.1| inner membrane protein YbhL [Leptotrichia goodfellowii F0264]
 gi|261747222|gb|EEY34704.1| inner membrane protein YbhL [Leptotrichia goodfellowii F0264]
          Length = 247

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 55/139 (39%), Positives = 82/139 (58%), Gaps = 3/139 (2%)

Query: 112 KMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMI 171
           + +F+LYSAL G +LS   ++YT  S++  F  T   F  L LYGY TK DL   G+ + 
Sbjct: 97  RFVFILYSALNGFTLSILGIIYTEGSLIFAFIGTLVLFIVLGLYGYFTKEDLSKYGTILK 156

Query: 172 MGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYA 228
           +G   L ++SL+N+FM S  +    S +G+++F    AYD  +IK    +Y+   D +  
Sbjct: 157 VGLIALIIMSLINMFMASDQLMWISSILGVIVFIVFIAYDINRIKNSIISYAVYEDASIL 216

Query: 229 ERQSVIGALMLYMDFIQIF 247
           ER  +IGAL LY+DFI +F
Sbjct: 217 ERIEIIGALRLYLDFINLF 235


>gi|327462926|gb|EGF09247.1| integral membrane protein, receptor [Streptococcus sanguinis SK1]
          Length = 227

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 127/241 (52%), Gaps = 25/241 (10%)

Query: 22  DQG-LRAYMIRVYNLMALGLGVTGIMSFL-VNILATTVDPDAASIIINRGVMLTGFGALM 79
           DQ  + ++  ++Y+++ +G+G++ I+S L +N            III+   +LTG     
Sbjct: 8   DQSDINSFYAKIYSIVGVGIGISAIVSLLMLNFFQ--------DIIIS---VLTGS---- 52

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSL--SAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
                 WIF  A    FI + V   +   ++ AA  MFL YSA+ G +LS    +Y   +
Sbjct: 53  -----TWIFYAAIAVEFILVLVASGTARSNSPAALPMFLAYSAINGFTLSIIMALYLQST 107

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           ++  F  T   F ++   G  TK+DL  +G   + G  G+   S +N+F+RSS +D  +S
Sbjct: 108 VLLAFLTTTVMFFAMGFIGKVTKKDLSGMGRACMAGLIGIIAASFLNIFLRSSGLDFIIS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            +G++IFS L A+D QKI+  Y ++ +       ++  AL LY+DFI +F+ LLR  G  
Sbjct: 168 IVGVLIFSGLIAWDNQKIRYVY-EQTNGNPGNGWAISLALHLYLDFINLFLSLLRIFGRN 226

Query: 258 R 258
           +
Sbjct: 227 K 227


>gi|257463510|ref|ZP_05627903.1| integral membrane protein [Fusobacterium sp. D12]
 gi|317061066|ref|ZP_07925551.1| integral membrane protein [Fusobacterium sp. D12]
 gi|313686742|gb|EFS23577.1| integral membrane protein [Fusobacterium sp. D12]
          Length = 226

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 57/165 (34%), Positives = 98/165 (59%), Gaps = 8/165 (4%)

Query: 99  LNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYT 158
           L+ R++ +S+   K +F+LYS L GL+L +   ++  + ++ +F I    F   ++YG+ 
Sbjct: 65  LSFRVYKMSSGTVKSIFILYSMLNGLTLCTIGFLFEPRIVLYSFGIAFGIFAVSAVYGFK 124

Query: 159 TKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE- 217
           T  DL     F  +G   L L+SLVNL++ ++++   ++  G V+F+ L AYD  +I+  
Sbjct: 125 TSEDLASYSRFFKIGLISLILVSLVNLWIGATSLYWMITIGGTVLFTGLIAYDVNRIRNI 184

Query: 218 ----AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
               A  D  DV   E+ +V+GAL LY+DFI +F+++LRF G +R
Sbjct: 185 SFYLAEEDGEDV---EKYAVMGALSLYLDFINLFLYILRFSGRKR 226


>gi|309804695|ref|ZP_07698760.1| putative membrane protein [Lactobacillus iners LactinV 09V1-c]
 gi|308166087|gb|EFO68305.1| putative membrane protein [Lactobacillus iners LactinV 09V1-c]
          Length = 237

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 102/187 (54%), Gaps = 6/187 (3%)

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           F AL     L ++ +  P  + I  +   + + ++   ++ +L + + GL+ S   L +T
Sbjct: 54  FNALSQNHALSFVLLILPFALIIGTSFSKNPILSF---VLLMLTAMVYGLTFSIICLAFT 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI   F  ++A F +++  G TTK+DL  +GS+      GL + +++N+F+R+  +  
Sbjct: 111 QTSITAAFLSSSAVFITMAFIGTTTKKDLSNLGSYASAALIGLIVATIINMFLRNPMVTY 170

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
             S + +VIF+ LTA+D QK+K  +   +D       ++IGAL LY+DFI +F+  L+  
Sbjct: 171 IFSYIAVVIFTILTAWDAQKMKNIFIQNHDEIATTSLAIIGALTLYLDFINLFIQFLQIF 230

Query: 255 G---SRR 258
           G   +RR
Sbjct: 231 GFSDNRR 237


>gi|259501115|ref|ZP_05744017.1| conserved hypothetical protein [Lactobacillus iners DSM 13335]
 gi|302190437|ref|ZP_07266691.1| integral membrane protein, interacts with FtsH [Lactobacillus iners
           AB-1]
 gi|309806171|ref|ZP_07700188.1| putative membrane protein [Lactobacillus iners LactinV 03V1-b]
 gi|312873398|ref|ZP_07733449.1| putative membrane protein [Lactobacillus iners LEAF 2052A-d]
 gi|325913337|ref|ZP_08175705.1| putative membrane protein [Lactobacillus iners UPII 60-B]
 gi|329920396|ref|ZP_08277128.1| putative membrane protein [Lactobacillus iners SPIN 1401G]
 gi|259167809|gb|EEW52304.1| conserved hypothetical protein [Lactobacillus iners DSM 13335]
 gi|308167452|gb|EFO69614.1| putative membrane protein [Lactobacillus iners LactinV 03V1-b]
 gi|311091082|gb|EFQ49475.1| putative membrane protein [Lactobacillus iners LEAF 2052A-d]
 gi|325477440|gb|EGC80584.1| putative membrane protein [Lactobacillus iners UPII 60-B]
 gi|328936072|gb|EGG32525.1| putative membrane protein [Lactobacillus iners SPIN 1401G]
          Length = 237

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 102/187 (54%), Gaps = 6/187 (3%)

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           F AL     L ++ +  P  + I  +   + + ++   ++ +L + + GL+ S   L +T
Sbjct: 54  FNALSQNHALSFVLLILPFALIIGTSFSKNPILSF---VLLMLTAMVYGLTFSIICLAFT 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI   F  ++A F +++  G TTK+DL  +GS+      GL + +++N+F+R+  +  
Sbjct: 111 QTSITAAFLSSSAVFITMAFIGTTTKKDLSNLGSYASAALIGLIVATIINMFLRNPMVTY 170

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
             S + +VIF+ LTA+D QK+K  +   +D       ++IGAL LY+DFI +F+  L+  
Sbjct: 171 IFSYIAVVIFTILTAWDAQKMKNIFIQNHDEIATTSLAIIGALTLYLDFINLFIQFLQIF 230

Query: 255 G---SRR 258
           G   +RR
Sbjct: 231 GFSDNRR 237


>gi|227890553|ref|ZP_04008358.1| integral membrane protein [Lactobacillus salivarius ATCC 11741]
 gi|227867491|gb|EEJ74912.1| integral membrane protein [Lactobacillus salivarius ATCC 11741]
          Length = 233

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 119/246 (48%), Gaps = 34/246 (13%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLV-NILATTVDPDAASIIINRGVMLTGFGALMYTS 82
           GL ++M ++Y  MA  + ++ + ++L+ N+                        AL + S
Sbjct: 12  GLNSFMAKMYGFMAGAVAISAVTAYLISNVYQVQ--------------------ALTFFS 51

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFL------LYSALIGLSLSSFFLVYTSK 136
             RW    A  G+ I   V + S+S  A +   +      LYS L GL       VY+S+
Sbjct: 52  NNRW----AVWGILILQVVLVMSMSFKADRSPAMSLTGLGLYSVLEGLFFGLIVQVYSSQ 107

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTM 196
            +   F      F  L+L G  TK+DL  IG   +     L ++ ++N+F+RSS I L  
Sbjct: 108 DVTMAFVSATVMFTVLALMGTNTKKDLSGIGRQAMAALIALIIVMIINIFLRSSIITLAF 167

Query: 197 SAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF--- 253
           S +G+VIF+AL A+D+Q+ ++ Y    +       +++GAL LY+DF+ +F+ LL     
Sbjct: 168 SFIGVVIFAALIAWDSQRFRQMYIQYGNQINTTNLAIMGALQLYLDFVNLFIQLLNIFTG 227

Query: 254 LGSRRD 259
           LG  +D
Sbjct: 228 LGGNKD 233


>gi|312868724|ref|ZP_07728916.1| putative membrane protein [Lactobacillus oris PB013-T2-3]
 gi|311095710|gb|EFQ53962.1| putative membrane protein [Lactobacillus oris PB013-T2-3]
          Length = 237

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 124/241 (51%), Gaps = 21/241 (8%)

Query: 22  DQ-GLRAYMIRVYNLMALGLGVTGIMSFL-VNILATTVDPDAASIIINRGVMLTGFGALM 79
           DQ GL +++ ++Y  M L + V+ + ++L +N+ AT V                  G   
Sbjct: 15  DQAGLNSFLTKMYGNMTLAVLVSALSAYLTMNVFATQV-----------------LGYFQ 57

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIV 139
               + W+ +  P+ + + ++    + +     +M +L + + G+  +     +T+ +I 
Sbjct: 58  QHQGMVWLILLLPIALSMGISFS-ATRNPVGGFIMLMLVAIIYGVEFALIAGAFTAANIT 116

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
             F  +AA F +++LYG  TKRDL   G+  +     L + S++N+F++S AI    S +
Sbjct: 117 AAFISSAAVFATMALYGTVTKRDLSKFGAHAMAALVALIIASIINIFLKSPAITYIFSYI 176

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG-SRR 258
            ++IF  LTA+D QK+K+ Y +  +       +++GAL LY+DF+ +F+  L+  G S R
Sbjct: 177 AVIIFVVLTAWDAQKMKQIYLNYSNENSVMGLAIVGALQLYLDFVNLFISFLQIFGMSDR 236

Query: 259 D 259
           D
Sbjct: 237 D 237


>gi|312870820|ref|ZP_07730926.1| putative membrane protein [Lactobacillus iners LEAF 3008A-a]
 gi|312873185|ref|ZP_07733244.1| putative membrane protein [Lactobacillus iners LEAF 2062A-h1]
 gi|311091418|gb|EFQ49803.1| putative membrane protein [Lactobacillus iners LEAF 2062A-h1]
 gi|311093696|gb|EFQ52034.1| putative membrane protein [Lactobacillus iners LEAF 3008A-a]
          Length = 237

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 102/187 (54%), Gaps = 6/187 (3%)

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           F AL     L ++ +  P  + I  +   + + ++   ++ +L + + GL+ S   L +T
Sbjct: 54  FNALSQNHALSFVLLILPFALIIGTSFSKNPILSF---VLLMLTAMVYGLTFSIICLAFT 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI   F  ++A F +++  G TTK+DL  +GS+      GL + +++N+F+R+  +  
Sbjct: 111 QTSITAAFLSSSAVFITMAFIGTTTKKDLSNLGSYASAALIGLIVATIINMFLRNPMVTY 170

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
             S + +VIF+ LTA+D QK+K  +   +D       ++IGAL LY+DFI +F+  L+  
Sbjct: 171 IFSYIAVVIFTILTAWDAQKMKNIFIQNHDEIATTSLAIIGALTLYLDFINLFIQFLQIF 230

Query: 255 G---SRR 258
           G   +RR
Sbjct: 231 GFSDNRR 237


>gi|90961463|ref|YP_535379.1| integral membrane protein [Lactobacillus salivarius UCC118]
 gi|90820657|gb|ABD99296.1| Integral membrane protein [Lactobacillus salivarius UCC118]
          Length = 237

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 119/246 (48%), Gaps = 34/246 (13%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLV-NILATTVDPDAASIIINRGVMLTGFGALMYTS 82
           GL ++M ++Y  MA  + ++ + ++L+ N+                        AL + S
Sbjct: 16  GLNSFMTKMYGFMAGAVAISAVTAYLISNVYQVQ--------------------ALTFFS 55

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFL------LYSALIGLSLSSFFLVYTSK 136
             RW    A  G+ I   V + S+S  A +   +      LYS L GL       VY+S+
Sbjct: 56  NNRW----AVWGILILQVVLVMSMSFKADRSPAMSLTGLGLYSVLEGLFFGLIVQVYSSQ 111

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTM 196
            +   F      F  L+L G  TK+DL  +G   +     L ++ ++N+F+RSS I L  
Sbjct: 112 DVTMAFVSATVMFTVLALMGTNTKKDLSGVGRQAMAALIALIIVMIINIFLRSSIITLAF 171

Query: 197 SAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF--- 253
           S +G+VIF+AL A+D+Q+ ++ Y    +       +++GAL LY+DF+ +F+ LL     
Sbjct: 172 SFIGVVIFAALIAWDSQRFRQMYIQYGNQINTTNLAIMGALQLYLDFVNLFIQLLNIFTG 231

Query: 254 LGSRRD 259
           LG  +D
Sbjct: 232 LGGNKD 237


>gi|315653827|ref|ZP_07906743.1| integral membrane protein, interacts with FtsH [Lactobacillus iners
           ATCC 55195]
 gi|315488523|gb|EFU78169.1| integral membrane protein, interacts with FtsH [Lactobacillus iners
           ATCC 55195]
          Length = 237

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 102/187 (54%), Gaps = 6/187 (3%)

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           F AL     L ++ +  P  + I  +   + + ++   ++ +L + + GL+ S   L +T
Sbjct: 54  FNALSQNHALSFVLLILPFALIIGTSFSKNPILSF---VLLMLTAMVYGLTFSIICLAFT 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI   F  ++A F +++  G TTK+DL  +GS+      GL + +++N+F+R+  +  
Sbjct: 111 QTSITAAFLSSSAVFITMAFIGTTTKKDLSNLGSYASAALIGLIVATIINMFLRNPMVTY 170

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
             S + +VIF+ LTA+D QK+K  +   +D       ++IGAL LY+DFI +F+  L+  
Sbjct: 171 IFSYISVVIFTILTAWDAQKMKNIFIQNHDEIATTSLAIIGALTLYLDFINLFIQFLQIF 230

Query: 255 G---SRR 258
           G   +RR
Sbjct: 231 GFSDNRR 237


>gi|270284051|ref|ZP_05965467.2| putative membrane protein [Bifidobacterium gallicum DSM 20093]
 gi|270278004|gb|EFA23858.1| putative membrane protein [Bifidobacterium gallicum DSM 20093]
          Length = 285

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/169 (32%), Positives = 105/169 (62%), Gaps = 5/169 (2%)

Query: 93  LGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSL 152
           +G+ ++L VR+  + A  A++ F +++AL+G +LS+ F+ Y+  +I     +TA  F +L
Sbjct: 117 IGLAVYLGVRVMKMQASTARIWFYVFAALMGFTLSTIFMAYSLGTIGVALLVTAGFFFAL 176

Query: 153 SLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM-RSSAIDLTMSAMGLVIFSALTAYD 211
           +++G TTK ++   G  +++G   L +  ++ +F+       + ++A+G+V+F+ LT YD
Sbjct: 177 TMFGMTTKGNMLKAGPVLLIGLIVLIVAEVIVMFIFPGDTAMMIITALGIVVFAGLTIYD 236

Query: 212 TQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           TQ +K  ++ +Y     E   R S++ AL LY+DFI +F+++LR  GSR
Sbjct: 237 TQFMKRVFA-QYSSQGPEAIKRLSILCALNLYLDFINMFLYILRLFGSR 284


>gi|125718587|ref|YP_001035720.1| integral membrane protein, receptor [Streptococcus sanguinis SK36]
 gi|125498504|gb|ABN45170.1| Integral membrane protein, possible receptor, putative
           [Streptococcus sanguinis SK36]
          Length = 227

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 127/241 (52%), Gaps = 25/241 (10%)

Query: 22  DQG-LRAYMIRVYNLMALGLGVTGIMSFL-VNILATTVDPDAASIIINRGVMLTGFGALM 79
           DQ  + ++  ++Y+++ +G+G++ I+S L +N            III+   +LTG     
Sbjct: 8   DQSDINSFYAKIYSIVGVGIGISAIVSLLMLNFFQ--------DIIIS---VLTGS---- 52

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSL--SAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
                 WIF  A    FI + V   +   ++ AA  MFL YSA+ G +LS    +Y   +
Sbjct: 53  -----TWIFYAAIAVEFILVLVASGTARSNSPAALPMFLAYSAINGFTLSIIMALYLQST 107

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           ++  F  T   F ++   G  TK+DL  +G   + G  G+   S++N+F+RS  +D  +S
Sbjct: 108 VLLAFLTTTVMFFAMGFIGKVTKKDLSGMGRACMAGLIGIIAASVLNIFLRSGGLDFIIS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            +G++IFS L A+D QKI+  Y ++ +       ++  AL LY+DFI +F+ LLR  G  
Sbjct: 168 IVGVLIFSGLIAWDNQKIRYVY-EQTNGNPGNGWAISLALHLYLDFINLFLSLLRIFGRN 226

Query: 258 R 258
           +
Sbjct: 227 K 227


>gi|22537744|ref|NP_688595.1| hypothetical protein SAG1604 [Streptococcus agalactiae 2603V/R]
 gi|25011693|ref|NP_736088.1| hypothetical protein gbs1653 [Streptococcus agalactiae NEM316]
 gi|76787395|ref|YP_330222.1| hypothetical protein SAK_1619 [Streptococcus agalactiae A909]
 gi|22534634|gb|AAN00468.1|AE014264_23 membrane protein, putative [Streptococcus agalactiae 2603V/R]
 gi|24413233|emb|CAD47312.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76562452|gb|ABA45036.1| membrane protein, putative [Streptococcus agalactiae A909]
 gi|319745521|gb|EFV97823.1| membrane protein [Streptococcus agalactiae ATCC 13813]
          Length = 229

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 128/240 (53%), Gaps = 23/240 (9%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG--FGALM 79
           D GL  +  ++Y L+ +G+G++  +S ++      + P     I+ +   + G  FGA++
Sbjct: 11  DSGLNQFFAKIYGLVGIGVGLSAAVSAIM----LYMFPQNMIAIMQK---MPGLYFGAII 63

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIV 139
               L  + +F   G            +  AA  +FL+YSAL G +LS     YT  +++
Sbjct: 64  ----LELVLVFVASGA--------ARRNTPAALPLFLIYSALNGFTLSFIIARYTQTTVL 111

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
           Q F  +AA F +++L G  TK+DL  +   ++    G+ + SLVNLF+ S  +   +S +
Sbjct: 112 QAFITSAAVFFAMALIGAKTKKDLSGMRKALMAALIGILIASLVNLFIGSGGMSYIISIV 171

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++IFS L AYD Q IK  Y+ +     A+  +V  AL LY+DFI +F+++LR L +R D
Sbjct: 172 CVIIFSGLIAYDNQMIKYVYNSQGG-QVADGWAVSMALSLYLDFINLFLNILR-LFARND 229


>gi|324991300|gb|EGC23233.1| integral membrane protein, receptor [Streptococcus sanguinis SK353]
 gi|325687123|gb|EGD29146.1| integral membrane protein, receptor [Streptococcus sanguinis SK72]
          Length = 227

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 130/243 (53%), Gaps = 29/243 (11%)

Query: 22  DQG-LRAYMIRVYNLMALGLGVTGIMSFL-VNILATTVDPDAASIIINRGVMLTGFGALM 79
           DQ  + ++  +VY+++ +G+G++ I+S L +N            III+   +LTG     
Sbjct: 8   DQSDINSFYAKVYSIVGVGIGISAIVSLLMLNFFQ--------DIIIS---VLTGS---- 52

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSLSAY----AAKMMFLLYSALIGLSLSSFFLVYTS 135
                 WIF +A + V  F+ V + S +A     AA  MFL YSA+ G +LS    +Y  
Sbjct: 53  -----TWIF-YAAIAVE-FILVLVASGTARSNNPAALPMFLAYSAINGFTLSIIMALYLQ 105

Query: 136 KSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLT 195
            +++  F  T   F ++   G  TK+DL  +G   + G  G+   S++N+F+RS  +D  
Sbjct: 106 STVLLAFLTTTVMFFAMGFIGKVTKKDLSGMGRACMAGLIGIIAASVLNIFLRSGGLDFI 165

Query: 196 MSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           +S +G++IFS L A+D QKI+  Y ++ +       ++  AL LY+DFI +F+ LLR  G
Sbjct: 166 ISIVGVLIFSGLIAWDNQKIRYVY-EQTNGNPGNGWAISLALHLYLDFINLFLSLLRIFG 224

Query: 256 SRR 258
             +
Sbjct: 225 RNK 227


>gi|309803865|ref|ZP_07697950.1| putative membrane protein [Lactobacillus iners LactinV 11V1-d]
 gi|308164099|gb|EFO66361.1| putative membrane protein [Lactobacillus iners LactinV 11V1-d]
          Length = 237

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 102/187 (54%), Gaps = 6/187 (3%)

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           F AL     L ++ +  P  + I  +   + + ++   ++ +L + + GL+ S   L +T
Sbjct: 54  FNALSQNHVLSFVLLILPFALIIGTSFSKNPILSF---VLLMLTAMVYGLTFSIICLAFT 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI   F  ++A F +++  G TTK+DL  +GS+      GL + +++N+F+R+  +  
Sbjct: 111 QTSITAAFLSSSAVFITMAFIGTTTKKDLSNLGSYASAALIGLIVATIINMFLRNPMVTY 170

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
             S + +VIF+ LTA+D QK+K  +   +D       ++IGAL LY+DFI +F+  L+  
Sbjct: 171 IFSYIAVVIFTILTAWDAQKMKNIFIQNHDEIATTSLAIIGALTLYLDFINLFIQFLQIF 230

Query: 255 G---SRR 258
           G   +RR
Sbjct: 231 GFSDNRR 237


>gi|312875398|ref|ZP_07735402.1| putative membrane protein [Lactobacillus iners LEAF 2053A-b]
 gi|311089061|gb|EFQ47501.1| putative membrane protein [Lactobacillus iners LEAF 2053A-b]
          Length = 237

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 102/187 (54%), Gaps = 6/187 (3%)

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           F AL     L ++ +  P  + I  +   + + ++   ++ +L + + GL+ S   L +T
Sbjct: 54  FNALSQNHVLSFVLLILPFALIIGTSFSKNPILSF---VLLMLTAMVYGLTFSIICLAFT 110

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI   F  ++A F +++  G TTK+DL  +GS+      GL + +++N+F+R+  +  
Sbjct: 111 QTSITAAFLSSSAVFITMAFIGTTTKKDLSNLGSYASAALIGLIVATIINMFLRNPMVTY 170

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
             S + +VIF+ LTA+D QK+K  +   +D       ++IGAL LY+DFI +F+  L+  
Sbjct: 171 IFSYIAVVIFTILTAWDAQKMKNIFIQNHDEIATTSLAIIGALTLYLDFINLFIQFLQIF 230

Query: 255 G---SRR 258
           G   +RR
Sbjct: 231 GFSDNRR 237


>gi|291461214|ref|ZP_06027661.2| putative membrane protein [Fusobacterium periodonticum ATCC 33693]
 gi|291378271|gb|EFE85789.1| putative membrane protein [Fusobacterium periodonticum ATCC 33693]
          Length = 224

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 98/170 (57%), Gaps = 2/170 (1%)

Query: 91  APLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFG 150
           A LG+ + LN  L  +SA  A+++F+LYS +IG+  S+    Y+  +I+  F      F 
Sbjct: 55  AGLGMVLVLNFFLKKMSAGIARLLFVLYSLVIGIIFSTVGFAYSPLAILYAFASALTIFI 114

Query: 151 SLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAY 210
            +S+YG+ TK DL    +F+++G   L ++ L N+++    +    +  G+VIF+  TAY
Sbjct: 115 VMSIYGFFTKEDLSSYRTFLMVGLISLIVMGLFNIYLGVGPLYWIETIFGIVIFTGFTAY 174

Query: 211 DTQKIKE-AYS-DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           D  +IK  +Y  +  +    E+ S+  AL LY+DFI +F++LLR  G R+
Sbjct: 175 DVNRIKHISYQLEAEEGEIVEKLSIRWALELYLDFINLFLYLLRIFGKRK 224


>gi|300214315|gb|ADJ78731.1| Integral membrane protein [Lactobacillus salivarius CECT 5713]
          Length = 235

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 119/246 (48%), Gaps = 34/246 (13%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLV-NILATTVDPDAASIIINRGVMLTGFGALMYTS 82
           GL ++M ++Y  MA  + ++ + ++L+ N+                        AL + +
Sbjct: 14  GLNSFMTKMYGFMAGAVAISAVTAYLISNVYQVQ--------------------ALTFFA 53

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFL------LYSALIGLSLSSFFLVYTSK 136
             RW    A  G+ I   V + S+S  A +   +      LYS L GL       VY+S+
Sbjct: 54  NNRW----AVWGILILQVVLVMSMSFKADRSPAMSLTGLGLYSVLEGLFFGLIVQVYSSQ 109

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTM 196
            +   F      F  L+L G  TK+DL  IG   +     L ++ ++N+F+RSS I L  
Sbjct: 110 DVTMAFVSATVMFTVLALMGTNTKKDLSGIGRQAMAALIALIIVMIINIFLRSSIITLAF 169

Query: 197 SAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF--- 253
           S +G+VIF+AL A+D+Q+ ++ Y    +       +++GAL LY+DF+ +F+ LL     
Sbjct: 170 SFIGVVIFAALIAWDSQRFRQMYIQYGNQINTTNLAIMGALQLYLDFVNLFIQLLNIFTG 229

Query: 254 LGSRRD 259
           LG  +D
Sbjct: 230 LGGNKD 235


>gi|237740719|ref|ZP_04571200.1| integral membrane protein [Fusobacterium sp. 2_1_31]
 gi|229422736|gb|EEO37783.1| integral membrane protein [Fusobacterium sp. 2_1_31]
          Length = 231

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 99/173 (57%), Gaps = 8/173 (4%)

Query: 91  APLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFG 150
           A LG+ + LN  L  +SA  A+++F+LYS +IG   S+    Y+  +I+  F      F 
Sbjct: 62  AGLGMVLILNFFLEKMSAGMARILFILYSLVIGTIFSTVGFAYSPLAILYAFASALTIFV 121

Query: 151 SLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAY 210
            +S+YG+ TK DL    +F+I+G   L ++ L+N+++    +    + +G+VIF+  TAY
Sbjct: 122 VMSIYGFFTKEDLSSYRTFLIVGLISLIVMGLINIYLGVGVLYWIETIVGIVIFTGFTAY 181

Query: 211 DTQKIKEAYSDRYDVAYAERQSV--IG---ALMLYMDFIQIFVHLLRFLGSRR 258
           D  +IK      Y +A  E ++V  +G   AL LY+DFI +F++ LR  G R+
Sbjct: 182 DVNRIKHI---SYQLANEEGENVEKLGIRWALELYLDFINLFLYALRIFGRRK 231


>gi|313890902|ref|ZP_07824526.1| putative membrane protein [Streptococcus pseudoporcinus SPIN 20026]
 gi|313120800|gb|EFR43915.1| putative membrane protein [Streptococcus pseudoporcinus SPIN 20026]
          Length = 229

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 122/241 (50%), Gaps = 19/241 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           S  D GL  +  ++Y L+  G+G++  +S+L   +      +  +II N   +   +GA+
Sbjct: 8   SETDSGLSQFFAKIYGLVGAGVGLSAFVSYL---MLYPFRDNLVAIIANHPFVY--YGAI 62

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +    L  I +F   G            +   A  +FL YSAL G +LS    VYT  ++
Sbjct: 63  I----LELILVFVASGA--------AQRNTPMALPLFLFYSALNGFTLSFIIAVYTQTTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +Q F  +AA F ++S+ G  TK+DL      ++    G+ + S+VNLF+ S  ++  +S 
Sbjct: 111 LQAFISSAAVFFTMSMIGLFTKKDLSGFTKALMAALIGIIVASIVNLFIGSGDLNFIISI 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           + ++IFS L A D  +IK  Y    +    +  ++  AL LY+DFI +F+ LLR  G R 
Sbjct: 171 VSVLIFSGLIAVDNNRIKAVYQAT-NGQVGDGWAIAMALSLYLDFINLFISLLRIFG-RN 228

Query: 259 D 259
           D
Sbjct: 229 D 229


>gi|295426514|ref|ZP_06819164.1| membrane protein [Lactobacillus amylolyticus DSM 11664]
 gi|295063882|gb|EFG54840.1| membrane protein [Lactobacillus amylolyticus DSM 11664]
          Length = 237

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 120/237 (50%), Gaps = 18/237 (7%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
             + +++ + Y++MAL + V+ + +FL    +TTV   A             F AL    
Sbjct: 17  SAVNSFLTKTYSIMALAVLVSALTAFL----STTVFKAA-------------FVALFSNK 59

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
              WI +F PL +   ++ R    +  A+ +M ++ +   GL+ +     YT  ++   F
Sbjct: 60  ASAWIILFLPLILSFAISFRAIR-NPVASFVMLMIMAVAYGLTFAIICAAYTDATVATAF 118

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
              AA F ++++YG  TKRDL  IGS+      G  + ++VN+F+R+  I    + +G++
Sbjct: 119 VSAAAVFITMAVYGTVTKRDLDNIGSYGTAALIGFIVATIVNIFLRNPMITYIFAYIGVL 178

Query: 203 IFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           IF  LTA++ Q++K  Y+   D   +   +  GAL LY+DF+ +F+  L+  G   D
Sbjct: 179 IFVGLTAWNAQQMKTIYAKYADQTNSLGLATAGALQLYLDFVNLFMFFLQIFGMGGD 235


>gi|325696354|gb|EGD38245.1| integral membrane protein, receptor [Streptococcus sanguinis SK160]
          Length = 227

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 126/241 (52%), Gaps = 25/241 (10%)

Query: 22  DQG-LRAYMIRVYNLMALGLGVTGIMSFL-VNILATTVDPDAASIIINRGVMLTGFGALM 79
           DQ  + ++  ++Y+++ +G+G++ I+S L +N            III+   +LTG     
Sbjct: 8   DQSDINSFYAKIYSIVGVGIGISAIVSLLMLNFFQ--------DIIIS---VLTG----- 51

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSL--SAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
                 WIF  A    FI + V   +   ++ AA  MFL YS + G +LS    +Y   +
Sbjct: 52  ----STWIFYAAIAVEFILVLVASGTARSNSPAALPMFLAYSVVNGFTLSIIMALYLQST 107

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           ++  F  T   F ++   G  TK+DL  +G   + G  G+   S +N+F+RSS +D  +S
Sbjct: 108 VLLAFLTTTVMFFAMGFIGKVTKKDLSGMGRACMAGLIGIIAASFLNIFLRSSGLDFIIS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            +G++IFS L A+D QKI+  Y ++ +       ++  AL LY+DFI +F+ LLR  G  
Sbjct: 168 IVGVLIFSGLIAWDNQKIRYVY-EQTNGNPGNGWAISLALHLYLDFINLFLSLLRIFGRN 226

Query: 258 R 258
           +
Sbjct: 227 K 227


>gi|146319364|ref|YP_001199076.1| integral membrane protein [Streptococcus suis 05ZYH33]
 gi|146321569|ref|YP_001201280.1| integral membrane protein [Streptococcus suis 98HAH33]
 gi|253752393|ref|YP_003025534.1| hypothetical protein SSUSC84_1547 [Streptococcus suis SC84]
 gi|253754219|ref|YP_003027360.1| membrane protein [Streptococcus suis P1/7]
 gi|253756153|ref|YP_003029293.1| membrane protein [Streptococcus suis BM407]
 gi|302024341|ref|ZP_07249552.1| membrane protein [Streptococcus suis 05HAS68]
 gi|330833333|ref|YP_004402158.1| putative integral membrane protein [Streptococcus suis ST3]
 gi|145690170|gb|ABP90676.1| putative integral membrane protein [Streptococcus suis 05ZYH33]
 gi|145692375|gb|ABP92880.1| putative integral membrane protein [Streptococcus suis 98HAH33]
 gi|251816682|emb|CAZ52323.1| putative membrane protein [Streptococcus suis SC84]
 gi|251818617|emb|CAZ56451.1| putative membrane protein [Streptococcus suis BM407]
 gi|251820465|emb|CAR47184.1| putative membrane protein [Streptococcus suis P1/7]
 gi|319758798|gb|ADV70740.1| putative integral membrane protein [Streptococcus suis JS14]
 gi|329307556|gb|AEB81972.1| putative integral membrane protein [Streptococcus suis ST3]
          Length = 233

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 93/162 (57%), Gaps = 8/162 (4%)

Query: 105 SLSAYAAKM------MFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYT 158
           S SA AAK       MFL YS   G+++S   + YTS+++V  F   A  F  +++ G T
Sbjct: 73  SASAMAAKNSPMALPMFLAYSVTNGITISMILMFYTSETVVLAFVSAALMFAIMAVIGMT 132

Query: 159 TKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEA 218
           TK+DL  +   +    +G+ + S++N+F+RSS +   MS + +++FS L AYD Q+I+  
Sbjct: 133 TKKDLSGMAQALRAALWGIIIASVINIFLRSSGLSFMMSIISVLVFSGLIAYDNQRIRNV 192

Query: 219 YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS-RRD 259
           + ++      +   V  AL LY+DFI +F++LLR  G   RD
Sbjct: 193 F-EQTGGNVGQGWVVSMALQLYLDFINLFLNLLRIFGGLSRD 233


>gi|259503622|ref|ZP_05746524.1| integral membrane protein [Lactobacillus antri DSM 16041]
 gi|259168396|gb|EEW52891.1| integral membrane protein [Lactobacillus antri DSM 16041]
          Length = 237

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 86/148 (58%), Gaps = 1/148 (0%)

Query: 113 MMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIM 172
           +M +L + + G+  +     +TS +I   F  +AA F +++LYG  TKRDL   G+  + 
Sbjct: 90  IMLMLVAVIYGVEFALIAGAFTSANITAAFISSAAVFATMALYGSVTKRDLSKFGAHAMA 149

Query: 173 GAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQS 232
               L + S++N+F++S AI    S + ++IF  LTA+D QK+K+ Y +  +       +
Sbjct: 150 ALVALIIASIINIFLKSPAITYIFSYIAVIIFVVLTAWDAQKMKQIYLNYSNENSVMGLA 209

Query: 233 VIGALMLYMDFIQIFVHLLRFLG-SRRD 259
           ++GAL LY+DF+ +F+  L+  G S RD
Sbjct: 210 IVGALQLYLDFVNLFISFLQIFGMSDRD 237


>gi|289450663|ref|YP_003475849.1| hypothetical protein HMPREF0868_1609 [Clostridiales genomosp. BVAB3
           str. UPII9-5]
 gi|289185210|gb|ADC91635.1| conserved hypothetical protein [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
          Length = 249

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 62/179 (34%), Positives = 98/179 (54%), Gaps = 15/179 (8%)

Query: 95  VFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSL 154
           VFIF +   H+  A  A  MFL+YS + G++ S+  + Y+  SIV  F ++A  F  ++ 
Sbjct: 70  VFIFSSQVRHA-RAGIATAMFLVYSIITGITFSTLIIFYSGASIVSGFALSALIFAVMAA 128

Query: 155 YGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQK 214
           +G+ TKRDL  +GS   +  FG  L+ + N+F+    I+L ++   L +F  LTAYD QK
Sbjct: 129 FGFLTKRDLSSLGSVGYVLLFGALLIGVANIFLHLPMINLLINYAILAVFIGLTAYDLQK 188

Query: 215 IKEAYSD---RYDVAYAERQ-----------SVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           ++ + ++   R   AY E             S++ AL LY+DF+ IF+ +L   G RR 
Sbjct: 189 VRRSVTELVARRSSAYRESDVAALDASIRSLSIMYALSLYLDFVNIFIRILSITGDRRS 247


>gi|332367399|gb|EGJ45132.1| integral membrane protein, receptor [Streptococcus sanguinis
           SK1059]
          Length = 227

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 126/241 (52%), Gaps = 25/241 (10%)

Query: 22  DQG-LRAYMIRVYNLMALGLGVTGIMSFL-VNILATTVDPDAASIIINRGVMLTGFGALM 79
           DQ  + ++  ++Y+++ +G+G++ I+S L +N            III+   +LTG     
Sbjct: 8   DQSDINSFYAKIYSIVGVGIGISAIVSLLMLNFFQ--------DIIIS---VLTGS---- 52

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSL--SAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
                 WIF  A    FI + V   +   ++ AA  MFL YSA+ G +LS    +Y    
Sbjct: 53  -----TWIFYAAIAVEFILVLVASGTARSNSPAALPMFLAYSAINGFTLSIIMALYLQSE 107

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           ++  F  T   F ++   G   K+DL  +G   + G  G+   S++N+F+RSS +D  +S
Sbjct: 108 VLLAFLTTTVMFFAMGFIGKVIKKDLSGMGRACMAGLIGIIAASVLNIFLRSSGLDFIVS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            +G++IFS L A+D QKI+  Y ++ +       ++  AL LY+DFI +F+ LLR  G  
Sbjct: 168 IVGVLIFSGLIAWDNQKIRYVY-EQTNGNPGNGWAISLALHLYLDFINLFLSLLRIFGRN 226

Query: 258 R 258
           +
Sbjct: 227 K 227


>gi|256847516|ref|ZP_05552962.1| conserved hypothetical protein [Lactobacillus coleohominis
           101-4-CHN]
 gi|256716180|gb|EEU31155.1| conserved hypothetical protein [Lactobacillus coleohominis
           101-4-CHN]
          Length = 235

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 118/233 (50%), Gaps = 19/233 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL +++ R+Y LM++ + V+  +++L      T+ P  AS                  S 
Sbjct: 16  GLNSFLTRMYGLMSVAVIVSAFVAYL------TMVPFRAS----------SLAFATQHSG 59

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI-GLSLSSFFLVYTSKSIVQTF 142
           + W+ +  P+   + + +   +    A  ++ L+  A+I G   S   + YT+ +I   F
Sbjct: 60  MVWLILLLPIA--LSMGISFSATRNPAGSLIMLMVIAVIYGFEFSLISMAYTTANIAAAF 117

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
             ++A F ++++YG  TKRDL   GS  +     L + SL+N+F+RS+AI    S + ++
Sbjct: 118 LSSSAVFITMTIYGTVTKRDLSRAGSHALAALVALIIASLINMFLRSAAITYVFSYIAVI 177

Query: 203 IFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           IF  LT +D QK+K  Y +           V+GAL LY+DFI +F+ LL+  G
Sbjct: 178 IFVVLTGWDAQKMKNIYLNYGSQVSIGGLVVLGALQLYLDFINLFLSLLQIFG 230


>gi|313140561|ref|ZP_07802754.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
 gi|313133071|gb|EFR50688.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
          Length = 294

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 127/245 (51%), Gaps = 26/245 (10%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
             +    RA + R Y  M LGL +T +++ +  +    V     S I + G  L GF   
Sbjct: 69  EQVQAAQRASVTRAYGEMTLGLIITAVVAVVAQMTGAYV-----SFIESTG--LIGF--- 118

Query: 79  MYTSPLRWIFIFAPLGVF--IFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK 136
                    F FA + V   + L  R+  + A  A++MF +Y+AL+G +LSS FLVY+  
Sbjct: 119 ---------FGFAIVQVVLAVALGARIMKIKASTARVMFYVYAALMGFTLSSIFLVYSIS 169

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL-T 195
            I     + AA F  L+++  TTK D+   G  +++G   L +  +V +F+  S   +  
Sbjct: 170 DIGVALVLCAAFFFVLTMFSLTTKFDMLKAGPILMVGLVVLIISQIVLMFVPGSTTGMRI 229

Query: 196 MSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLR 252
           + A GL++F+ +T YD Q+ +  +S  Y+    E   + S+I AL LY+DF+ +F+++L+
Sbjct: 230 ICAFGLILFAGMTLYDAQQTRALFS-AYEAQGPEMIKKISIICALNLYLDFVNMFLYILQ 288

Query: 253 FLGSR 257
             GSR
Sbjct: 289 LFGSR 293


>gi|259502646|ref|ZP_05745548.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
 gi|259169291|gb|EEW53786.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
          Length = 235

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 121/238 (50%), Gaps = 21/238 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  ++ ++Y LM   + ++ + ++LV           A++  N+      F A +  + 
Sbjct: 16  GLNRFLTKMYGLMTFAVLISALTAWLV-----------ANVFANQ------FAAFLANN- 57

Query: 84  LRW-IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI-GLSLSSFFLVYTSKSIVQT 141
            RW I++   L +F+   +  ++  +    +  L+ +A+I G++ +     YT   I   
Sbjct: 58  -RWGIWLIILLPIFLTFGISFNATRSPGMSLFLLILTAIIYGITFAFIAGAYTGADISTA 116

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +A  F +++L G  + RD   IGS+      GL +  LVNLF+ S A+D  +S + +
Sbjct: 117 FLSSAGIFLTMALIGTFSHRDFSRIGSYASAALIGLIIAMLVNLFLHSPAVDYVLSVIAV 176

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +IF+ LTA+D Q++K  Y+   D       +V+GAL LY+DFI +F+ LL    S  +
Sbjct: 177 IIFTILTAWDAQRMKSIYTGYGDQLSVNGLAVLGALQLYLDFINLFISLLDIFSSSDE 234


>gi|332522236|ref|ZP_08398488.1| putative membrane protein [Streptococcus porcinus str. Jelinkova
           176]
 gi|332313500|gb|EGJ26485.1| putative membrane protein [Streptococcus porcinus str. Jelinkova
           176]
          Length = 229

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 121/241 (50%), Gaps = 19/241 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           S  D GL  +  ++Y L+  G+G++  +S+L   +      +  +II N   +   +GA+
Sbjct: 8   SETDTGLSQFFAKIYGLVGAGVGLSAFVSYL---MLYPFRDNLVAIIANHPFVY--YGAI 62

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +    L  + +F   G            +   A  +FL YSAL G +LS     YT  ++
Sbjct: 63  I----LELVLVFLASGA--------AQRNTPMALPLFLFYSALNGFTLSFIIAAYTQTTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +Q F  +AA F ++S+ G  TK+DL      ++    G+ + S+VNLF+ S  ++  +S 
Sbjct: 111 LQAFISSAAVFFTMSMIGLLTKKDLSGFSKALMAALIGIIVASVVNLFIGSGGLNFIISI 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           + ++IFS L A D  +IK  Y    +    +  +V  AL LY+DFI +F+ LLR  G R 
Sbjct: 171 VSVLIFSGLIAVDNNRIKAVYQAT-NGQVGDGWAVAMALSLYLDFINLFISLLRIFG-RN 228

Query: 259 D 259
           D
Sbjct: 229 D 229


>gi|224283406|ref|ZP_03646728.1| Integral membrane protein [Bifidobacterium bifidum NCIMB 41171]
 gi|310287759|ref|YP_003939017.1| Integral membrane protein [Bifidobacterium bifidum S17]
 gi|311064645|ref|YP_003971370.1| hypothetical protein BBPR_1281 [Bifidobacterium bifidum PRL2010]
 gi|309251695|gb|ADO53443.1| Integral membrane protein [Bifidobacterium bifidum S17]
 gi|310866964|gb|ADP36333.1| Conserved hypothetical membrane spanning protein in uncharacterized
           protein family UPF0005 [Bifidobacterium bifidum PRL2010]
          Length = 277

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 127/245 (51%), Gaps = 26/245 (10%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
             +    RA + R Y  M LGL +T +++ +  +    V     S I + G  L GF   
Sbjct: 52  EQVQAAQRASVTRAYGEMTLGLIITAVVAVVAQMTGAYV-----SFIESTG--LIGF--- 101

Query: 79  MYTSPLRWIFIFAPLGVF--IFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK 136
                    F FA + V   + L  R+  + A  A++MF +Y+AL+G +LSS FLVY+  
Sbjct: 102 ---------FGFAIVQVVLAVALGARIMKIKASTARVMFYVYAALMGFTLSSIFLVYSIS 152

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL-T 195
            I     + AA F  L+++  TTK D+   G  +++G   L +  +V +F+  S   +  
Sbjct: 153 DIGVALVLCAAFFFVLTMFSLTTKFDMLKAGPILMVGLVVLIISQIVLMFVPGSTTGMRI 212

Query: 196 MSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLR 252
           + A GL++F+ +T YD Q+ +  +S  Y+    E   + S+I AL LY+DF+ +F+++L+
Sbjct: 213 ICAFGLILFAGMTLYDAQQTRALFS-AYEAQGPEMIKKISIICALNLYLDFVNMFLYILQ 271

Query: 253 FLGSR 257
             GSR
Sbjct: 272 LFGSR 276


>gi|322391339|ref|ZP_08064809.1| membrane protein [Streptococcus peroris ATCC 700780]
 gi|321145765|gb|EFX41156.1| membrane protein [Streptococcus peroris ATCC 700780]
          Length = 227

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 120/233 (51%), Gaps = 18/233 (7%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  +  +VY+ + LG+ ++ I+S L   + TT       +++N  + L   G +     
Sbjct: 11  GLNQFYAKVYSFVGLGIALSAIVSAL---MLTTFQDLLVQLMLNARIWLIVTGIVEVA-- 65

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
              + IFA           L + ++ A   MFLLYS + G SLS    +Y   +++  F 
Sbjct: 66  ---LVIFAS---------GLAAKNSPATLPMFLLYSVVNGFSLSFIVSLYLPGTVLTAFI 113

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
            +AA F  +++ G   K+DL  IG  +I   FGL L  +VN+F+ S  +D  +S + +++
Sbjct: 114 SSAALFFVMAIIGVVIKKDLSGIGRALIAALFGLILAMVVNIFLNSGFMDYIISIVMVIV 173

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           F+ L A+D QKI+  Y +  D   A   +V  AL LY+DFI +F+  LR  GS
Sbjct: 174 FAGLIAWDNQKIRYVYEES-DGQVATGWAVALALSLYLDFINLFLSFLRIFGS 225


>gi|194466656|ref|ZP_03072643.1| protein of unknown function UPF0005 [Lactobacillus reuteri 100-23]
 gi|194453692|gb|EDX42589.1| protein of unknown function UPF0005 [Lactobacillus reuteri 100-23]
          Length = 237

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 123/237 (51%), Gaps = 18/237 (7%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL +++ R+Y  M L + V+   ++L             ++ + R  +   FGA      
Sbjct: 18  GLNSFLTRMYGNMTLAVLVSAFSAYL-------------TMGVFRSAVFGFFGA---HPG 61

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           + W+ +  P+ + + ++    + +   A +M +L + + G+  +    VY+  SI   F 
Sbjct: 62  MVWVILLLPIALSMGVSFS-ATRNPVGAFIMLMLTAIIYGVEFAIIAGVYSGASIASAFV 120

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
            +AA F +++LYG  TKRDL   G+  +     L +  L+N+F++S AI    S + ++I
Sbjct: 121 SSAAVFVTMALYGTITKRDLSKFGAHAMAALIALMIAYLINMFLQSPAIAYIFSFIAVII 180

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG-SRRD 259
           F+ LTA+D QK+K+ Y +          +V+GAL LY+DF+ +F+ LL+  G S R+
Sbjct: 181 FTVLTAWDAQKMKQIYINYGGEVSTNGLAVLGALQLYLDFVNLFISLLQIFGMSERN 237


>gi|15214405|sp|Q9CEU8|YRJE_LACLA RecName: Full=Uncharacterized protein YrjE
          Length = 234

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 125/243 (51%), Gaps = 27/243 (11%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL A+  ++Y LM  G+ V+ ++S+++     T   D  + I+  G +   F  +++  
Sbjct: 13  DGLNAFFSKIYALMGAGVLVSALVSWIM----ITFFLDNMTAILQSGSL---FFLVLWII 65

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKM---MFLLYSALIGLSLSSFFLVYTSKSIV 139
           PL  +             V L  L+   +KM   +F+ Y+A +G  +S   L+YT+  I 
Sbjct: 66  PLVMV-------------VSLQGLAMKNSKMALPIFIGYAAFMGFLISFTLLMYTATDIT 112

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
             F   AA F  LS+YG  TKR+L  +G    +  +GL +   +N F  S+ + + +S +
Sbjct: 113 LAFVTAAAMFFGLSVYGRFTKRNLSAMGKAFGVAVWGLIIAMFLNFFFASTGLTILISLV 172

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL---GS 256
           G+VIF+ L A+D QKI + Y+   +   ++  ++  AL LY+DFI +F+ LLR     G 
Sbjct: 173 GVVIFAGLIAWDNQKITQVYNAN-NGQVSDGWAISMALSLYLDFINMFLFLLRLFGIAGG 231

Query: 257 RRD 259
            RD
Sbjct: 232 NRD 234


>gi|15673718|ref|NP_267892.1| transport permease [Lactococcus lactis subsp. lactis Il1403]
 gi|12724756|gb|AAK05834.1|AE006404_1 transport permease [Lactococcus lactis subsp. lactis Il1403]
 gi|326407202|gb|ADZ64273.1| transport permease [Lactococcus lactis subsp. lactis CV56]
          Length = 237

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 125/243 (51%), Gaps = 27/243 (11%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL A+  ++Y LM  G+ V+ ++S+++     T   D  + I+  G +   F  +++  
Sbjct: 16  DGLNAFFSKIYALMGAGVLVSALVSWIM----ITFFLDNMTAILQSGSL---FFLVLWII 68

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKM---MFLLYSALIGLSLSSFFLVYTSKSIV 139
           PL  +             V L  L+   +KM   +F+ Y+A +G  +S   L+YT+  I 
Sbjct: 69  PLVMV-------------VSLQGLAMKNSKMALPIFIGYAAFMGFLISFTLLMYTATDIT 115

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
             F   AA F  LS+YG  TKR+L  +G    +  +GL +   +N F  S+ + + +S +
Sbjct: 116 LAFVTAAAMFFGLSVYGRFTKRNLSAMGKAFGVAVWGLIIAMFLNFFFASTGLTILISLV 175

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL---GS 256
           G+VIF+ L A+D QKI + Y+   +   ++  ++  AL LY+DFI +F+ LLR     G 
Sbjct: 176 GVVIFAGLIAWDNQKITQVYNAN-NGQVSDGWAISMALSLYLDFINMFLFLLRLFGIAGG 234

Query: 257 RRD 259
            RD
Sbjct: 235 NRD 237


>gi|312868880|ref|ZP_07729066.1| putative membrane protein [Lactobacillus oris PB013-T2-3]
 gi|311095620|gb|EFQ53878.1| putative membrane protein [Lactobacillus oris PB013-T2-3]
          Length = 235

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 121/236 (51%), Gaps = 21/236 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL  ++ ++Y LM   + ++ + ++LV           A++  N+      F A +  +
Sbjct: 15  SGLNRFLTKMYGLMTFAVLISALTAWLV-----------ANVFANQ------FTAFLTNN 57

Query: 83  PLRW-IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI-GLSLSSFFLVYTSKSIVQ 140
             RW I++   L +F+   +  ++  +     + L+ +A+I G++ +     YT   I  
Sbjct: 58  --RWGIWLIILLPIFLTFGISFNATRSPGVSFVLLIITAIIYGITFAFIAGSYTGADIAT 115

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            F  +A  F +++L G  + RD   +GS+      GL +  LVNLF+ S A++  +S + 
Sbjct: 116 AFVSSAGIFLTMALIGTFSHRDFSRLGSYATAALVGLIIAMLVNLFLHSPAVNYVLSVIA 175

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           ++IF+ LTA+D Q++K  Y+   D       +V+GAL LY+DFI +FV LL   GS
Sbjct: 176 VIIFTILTAWDAQRMKSIYTGYGDELSVNGLAVLGALQLYLDFINLFVSLLDIFGS 231


>gi|260494486|ref|ZP_05814616.1| integral membrane protein [Fusobacterium sp. 3_1_33]
 gi|260197648|gb|EEW95165.1| integral membrane protein [Fusobacterium sp. 3_1_33]
          Length = 233

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 105/195 (53%), Gaps = 6/195 (3%)

Query: 69  GVMLTGFGALMYTSPLRW--IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           G+ L  F   +  S LR+  I + A +G+ +  ++ L  LSA   +++FLLYS +IG   
Sbjct: 40  GIYLYQFNQELLISLLRYFNILLIASVGIVLVSDLMLRKLSAGVLRILFLLYSLIIGTVF 99

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           S+   +Y+  +I+  F      F  +++YG+ +K DL     F I+G   L ++ L+N+ 
Sbjct: 100 STIGFLYSPLAILYAFGTALTIFVVMAIYGFISKEDLSSYRRFFIVGLISLIIMGLINIR 159

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMDF 243
           +    +    +  G+VIF+ L AYD  +IK      +D  D    E+ S+ GA  LY+DF
Sbjct: 160 LGVGPLYWIETIAGVVIFTGLIAYDVNRIKWISYQLADG-DNEVMEKMSIDGAFNLYLDF 218

Query: 244 IQIFVHLLRFLGSRR 258
           I +F++LLR  G ++
Sbjct: 219 INLFLYLLRIFGRKK 233


>gi|329117502|ref|ZP_08246219.1| putative membrane protein [Streptococcus parauberis NCFD 2020]
 gi|326907907|gb|EGE54821.1| putative membrane protein [Streptococcus parauberis NCFD 2020]
          Length = 229

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 123/238 (51%), Gaps = 19/238 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GL  +  ++Y+L+ +G+G++  +S+L   +      +  +I+ N   +   +GA+++ 
Sbjct: 11  DSGLNQFFAKIYSLVGMGIGLSAFVSYL---MLYPFKDNLLNIVANHPFVY--YGAIIFE 65

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
             L            +F        +  AA  +FL+YSAL G +LS   + YT+ +++Q 
Sbjct: 66  LLL------------VFFASGAARKNTPAALPLFLIYSALNGFTLSFIIMAYTTSTVMQA 113

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +A  F  +++ G   KRDL  +   +     G+ L S+VN+F+ S A+   +S + +
Sbjct: 114 FVSSAGVFFVMAMIGARIKRDLSGMRKALFAALIGIILASVVNIFLGSGAMSYIISIISV 173

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +IFS L A D Q IK+ Y    +    +  ++  AL LY+DFI +F+ LLR  G R D
Sbjct: 174 LIFSGLIAADNQMIKQVYQST-NGQVNDGWAIAMALSLYLDFINLFISLLRIFG-RND 229


>gi|227889462|ref|ZP_04007267.1| integral membrane protein, interacts with FtsH [Lactobacillus
           johnsonii ATCC 33200]
 gi|227849940|gb|EEJ60026.1| integral membrane protein, interacts with FtsH [Lactobacillus
           johnsonii ATCC 33200]
          Length = 239

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 122/232 (52%), Gaps = 17/232 (7%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  ++ R+Y +M + + V+ + ++L             ++ + R  ++T F +      
Sbjct: 18  GLNRFLSRMYGMMTIAVLVSALSAYL-------------TMTVFRTQVMTFFAS---NPA 61

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           + WI +  PL +   ++ R  + +  A+ +M ++ + + G+  S     YT +SI   F 
Sbjct: 62  MTWILLLVPLALTFGISFR-ATRNPVASFVMLMIMAIVYGVEFSLIAGAYTGRSIASAFV 120

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
            ++  F ++++ G TTK++L  +GS+      GL +  L+N+F+R+  +    S + ++I
Sbjct: 121 ASSTVFITMAVIGTTTKKNLNNLGSYASAALIGLIVAMLINMFLRNPMVSYIFSFIAVII 180

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           F+ LTA+D Q++K+ Y +       +  +V GAL LY+DF+ +F+  L+  G
Sbjct: 181 FTILTAWDAQRMKQIYENYSGQVSVDGLAVAGALALYLDFVNLFLQFLQIFG 232


>gi|289764406|ref|ZP_06523784.1| integral membrane protein [Fusobacterium sp. D11]
 gi|289715961|gb|EFD79973.1| integral membrane protein [Fusobacterium sp. D11]
          Length = 233

 Score = 92.0 bits (227), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 105/195 (53%), Gaps = 6/195 (3%)

Query: 69  GVMLTGFGALMYTSPLRW--IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           G+ L  F   +  S LR+  I + A +G+ +  ++ L  LSA   +++FLLYS +IG   
Sbjct: 40  GIYLYQFNQELLISLLRYFNILLIASVGIVLVSDLMLRKLSAGVLRILFLLYSLIIGTVF 99

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           S+   +Y+  +I+  F      F  +++YG+ +K DL     F I+G   L ++ L+N+ 
Sbjct: 100 STIGFLYSPLAILYAFGTALTIFVVMAIYGFISKEDLSSYRRFFIVGLISLIIMGLINIR 159

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMDF 243
           +    +    +  G+VIF+ L AYD  +IK      +D  D    E+ S+ GA  LY+DF
Sbjct: 160 LGVGPLYWIETIAGVVIFTGLIAYDVNRIKWISYQLADG-DNEIMEKMSIDGAFNLYLDF 218

Query: 244 IQIFVHLLRFLGSRR 258
           I +F++LLR  G ++
Sbjct: 219 INLFLYLLRIFGRKK 233


>gi|237744625|ref|ZP_04575106.1| integral membrane protein [Fusobacterium sp. 7_1]
 gi|229431854|gb|EEO42066.1| integral membrane protein [Fusobacterium sp. 7_1]
          Length = 224

 Score = 92.0 bits (227), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 105/195 (53%), Gaps = 6/195 (3%)

Query: 69  GVMLTGFGALMYTSPLRW--IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           G+ L  F   +  S LR+  I + A +G+ +  ++ L  LSA   +++FLLYS +IG   
Sbjct: 31  GIYLYQFNQELLISLLRYFNILLIASVGIVLVSDLMLRKLSAGVLRILFLLYSLIIGTVF 90

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           S+   +Y+  +I+  F      F  +++YG+ +K DL     F I+G   L ++ L+N+ 
Sbjct: 91  STIGFLYSPLAILYAFGTALTIFVVMAIYGFISKEDLSSYRRFFIVGLISLIIMGLINIR 150

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMDF 243
           +    +    +  G+VIF+ L AYD  +IK      +D  D    E+ S+ GA  LY+DF
Sbjct: 151 LGVGPLYWIETIAGVVIFTGLIAYDVNRIKWISYQLADG-DNEVMEKMSIDGAFNLYLDF 209

Query: 244 IQIFVHLLRFLGSRR 258
           I +F++LLR  G ++
Sbjct: 210 INLFLYLLRIFGRKK 224


>gi|256026392|ref|ZP_05440226.1| integral membrane protein [Fusobacterium sp. D11]
          Length = 250

 Score = 91.7 bits (226), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 105/195 (53%), Gaps = 6/195 (3%)

Query: 69  GVMLTGFGALMYTSPLRW--IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           G+ L  F   +  S LR+  I + A +G+ +  ++ L  LSA   +++FLLYS +IG   
Sbjct: 57  GIYLYQFNQELLISLLRYFNILLIASVGIVLVSDLMLRKLSAGVLRILFLLYSLIIGTVF 116

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           S+   +Y+  +I+  F      F  +++YG+ +K DL     F I+G   L ++ L+N+ 
Sbjct: 117 STIGFLYSPLAILYAFGTALTIFVVMAIYGFISKEDLSSYRRFFIVGLISLIIMGLINIR 176

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMDF 243
           +    +    +  G+VIF+ L AYD  +IK      +D  D    E+ S+ GA  LY+DF
Sbjct: 177 LGVGPLYWIETIAGVVIFTGLIAYDVNRIKWISYQLADG-DNEIMEKMSIDGAFNLYLDF 235

Query: 244 IQIFVHLLRFLGSRR 258
           I +F++LLR  G ++
Sbjct: 236 INLFLYLLRIFGRKK 250


>gi|3171165|gb|AAC18360.1| putative membrane spanning protein [Lactococcus lactis subsp.
           cremoris MG1363]
          Length = 196

 Score = 91.7 bits (226), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 96/165 (58%), Gaps = 7/165 (4%)

Query: 101 VRLHSLSAYAAKM---MFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGY 157
           V L  L+   +KM   +F+ Y+A +G  +S   L+YT+  I   F   +A F  LS+YG 
Sbjct: 33  VSLQGLAMKNSKMALPIFIGYAAFMGFLISFTLLMYTATDITLAFITASAMFFGLSVYGR 92

Query: 158 TTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE 217
            TKR+L  +G  + +  +GL +  L+NLF  S+ + + +S +G+VIFS L A+D QKI +
Sbjct: 93  FTKRNLSGMGKALGVAVWGLIVAMLLNLFFASTGLTILISLVGVVIFSGLIAWDNQKITQ 152

Query: 218 AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL---GSRRD 259
            Y + ++   ++  ++  AL LY+DFI +F+ LLR     G  RD
Sbjct: 153 VY-NAHNGQVSDGWAISMALSLYLDFINMFLFLLRLFGIAGGNRD 196


>gi|76799036|ref|ZP_00781231.1| membrane protein [Streptococcus agalactiae 18RS21]
 gi|77408454|ref|ZP_00785192.1| membrane protein [Streptococcus agalactiae COH1]
 gi|77412540|ref|ZP_00788835.1| membrane protein [Streptococcus agalactiae CJB111]
 gi|77414374|ref|ZP_00790529.1| membrane protein [Streptococcus agalactiae 515]
 gi|76585622|gb|EAO62185.1| membrane protein [Streptococcus agalactiae 18RS21]
 gi|77159564|gb|EAO70720.1| membrane protein [Streptococcus agalactiae 515]
 gi|77161408|gb|EAO72424.1| membrane protein [Streptococcus agalactiae CJB111]
 gi|77172896|gb|EAO76027.1| membrane protein [Streptococcus agalactiae COH1]
          Length = 188

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 91/150 (60%), Gaps = 2/150 (1%)

Query: 110 AAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSF 169
           AA  +FL+YSAL G +LS     YT  +++Q F  +AA F +++L G  TK+DL  +   
Sbjct: 41  AALPLFLIYSALNGFTLSFIIARYTQTTVLQAFITSAAVFFAMALIGAKTKKDLSGMRKA 100

Query: 170 MIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE 229
           ++    G+ + SLVNLF+ S  +   +S + ++IFS L AYD Q IK  Y+ +     A+
Sbjct: 101 LMAALIGILIASLVNLFIGSGGMSYIISIVCVIIFSGLIAYDNQMIKYVYNSQGG-QVAD 159

Query: 230 RQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
             +V  AL LY+DFI +F+++LR L +R D
Sbjct: 160 GWAVSMALSLYLDFINLFLNILR-LFARND 188


>gi|268319967|ref|YP_003293623.1| hypothetical protein FI9785_1500 [Lactobacillus johnsonii FI9785]
 gi|262398342|emb|CAX67356.1| hypothetical protein predicted by Glimmer/Critica [Lactobacillus
           johnsonii FI9785]
          Length = 237

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 122/232 (52%), Gaps = 17/232 (7%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  ++ R+Y +M + + V+ + ++L             ++ + R  ++T F +      
Sbjct: 18  GLNRFLSRMYGMMTIAVLVSALSAYL-------------TMTVFRTQVMTIFAS---NPA 61

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           + WI +  PL +   ++ R  + +  A+ +M ++ + + G+  S     YT +SI   F 
Sbjct: 62  MTWILLLVPLALTFGISFR-ATRNPVASFVMLMIMAIVYGVEFSLIAGAYTGRSIASAFV 120

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
            ++  F ++++ G TTK++L  +GS+      GL +  L+N+F+R+  +    S + ++I
Sbjct: 121 ASSTVFITMAVIGTTTKKNLNNLGSYASAALIGLIVAMLINMFLRNPMVSYIFSFIAVII 180

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           F+ LTA+D Q++K+ Y +       +  +V GAL LY+DF+ +F+  L+  G
Sbjct: 181 FTILTAWDAQRMKQIYENYSGQVSVDGLAVAGALALYLDFVNLFLQFLQIFG 232


>gi|329667831|gb|AEB93779.1| integral membrane protein [Lactobacillus johnsonii DPC 6026]
          Length = 237

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 122/232 (52%), Gaps = 17/232 (7%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  ++ R+Y +M + + V+ + ++L             ++ + R  ++T F +      
Sbjct: 18  GLNRFLSRMYGMMTIAVLVSALSAYL-------------TMTVFRTQVMTLFAS---NPA 61

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           + WI +  PL +   ++ R  + +  A+ +M ++ + + G+  S     YT +SI   F 
Sbjct: 62  MTWILLLVPLALTFGISFR-ATRNPVASFVMLMIMAIVYGVEFSLIAGAYTGRSIASAFV 120

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
            ++  F ++++ G TTK++L  +GS+      GL +  L+N+F+R+  +    S + ++I
Sbjct: 121 ASSTVFITMAVIGTTTKKNLNNLGSYASAALIGLIVAMLINMFLRNPMVSYIFSFIAVII 180

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           F+ LTA+D Q++K+ Y +       +  +V GAL LY+DF+ +F+  L+  G
Sbjct: 181 FTILTAWDAQRMKQIYENYSGQVSVDGLAVAGALALYLDFVNLFLQFLQIFG 232


>gi|300173071|ref|YP_003772237.1| integral membrane protein [Leuconostoc gasicomitatum LMG 18811]
 gi|299887450|emb|CBL91418.1| Integral membrane protein [Leuconostoc gasicomitatum LMG 18811]
          Length = 239

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/250 (29%), Positives = 118/250 (47%), Gaps = 36/250 (14%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVN--ILATTVDPDAASIIINRGV------ML 72
           +D G+RA+  + Y+ MA+ + VT I  F+V    LA  V   A +I+    +      ++
Sbjct: 15  MDAGMRAFFKQTYSFMAIAVMVTAITGFVVQKFFLAQVVALIAGNIVGTLALFGIQILIM 74

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
           T  G   + +P R                         A  + + ++ + GL+L     +
Sbjct: 75  TMIGRATFKNPAR-------------------------AFGLLMAFAVVEGLTLGLLLAI 109

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT  S+   F   AA FG ++ YG  TKRDL  +GS +     GL + S+VN+   +  +
Sbjct: 110 YTGASVTMAFVSAAAVFGGMAAYGIFTKRDLTGMGSILFGLLIGLVVASVVNILFYNGIV 169

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
            L +S + +++FS  TAYD Q +K  YS     A     +V GAL LY+DF+ +F  L+R
Sbjct: 170 SLLISGVSVIVFSLYTAYDNQNLKLMYSQFAGQADTTGLAVNGALRLYLDFVNLFFALIR 229

Query: 253 F---LGSRRD 259
               +G  RD
Sbjct: 230 IFGVVGGSRD 239


>gi|319946454|ref|ZP_08020691.1| membrane protein [Streptococcus australis ATCC 700641]
 gi|319747422|gb|EFV99678.1| membrane protein [Streptococcus australis ATCC 700641]
          Length = 228

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 126/254 (49%), Gaps = 27/254 (10%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N Q V++  SG        L ++  ++Y+L+ +G+G++ ++S L+  L            
Sbjct: 2   NQQTVIHEQSG--------LNSFYSKIYSLVGVGVGISAVVSALMMTLFQET-------- 45

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                    F  ++  +P  +    A   + + +  R    +   A  +FL YSAL G +
Sbjct: 46  ---------FIYILTQAPWVYYIAIAVELILVLVASRQSVKNNPMALPLFLTYSALNGFT 96

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LS     Y   ++ + F ++A  F  +S  G  TK+DL  +G   +    G+ + S+ N+
Sbjct: 97  LSFIIARYAQATVYKAFVVSALMFFIMSAIGRVTKKDLSGMGRAFMGALIGIIIASIANI 156

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F++SS +D  +S + ++IF+ LTA+D QKI+  Y ++ +        V  AL LY+DFI 
Sbjct: 157 FLQSSGMDYVLSILCVIIFAGLTAWDNQKIRYVY-EQSNGQPTNGWVVALALELYLDFIN 215

Query: 246 IFVHLLRFLGSRRD 259
           +F+++LR  G R D
Sbjct: 216 LFINILRIFG-RND 228


>gi|308235908|ref|ZP_07666645.1| hypothetical protein GvagA14_06780 [Gardnerella vaginalis ATCC
           14018]
          Length = 253

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 103/174 (59%), Gaps = 6/174 (3%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A + + + L +R+  +S +AA+ MF  Y+AL G +LS+ F V++  SI     +TA  
Sbjct: 81  IIAQVVLAVVLGMRVMKMSVFAARAMFYAYAALTGFTLSTIFTVFSLGSIAMVLALTAGF 140

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLT-MSAMGLVIFSAL 207
           F  L++   TTK ++   G  +++    L +  ++ +F+  SA  +  ++A+ ++IF+ L
Sbjct: 141 FLCLTMLALTTKVNMLKAGPILMVALLVLCVSQVILMFVAPSAGTMRFIAAIAVLIFAGL 200

Query: 208 TAYDTQK---IKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           TA D QK   I EAY D+ ++   +  S+I A  LY+DFI +FV+LL  LG+RR
Sbjct: 201 TACDAQKTRAIYEAYDDQPEM--IKSISIICAFNLYLDFINMFVYLLELLGNRR 252


>gi|323339594|ref|ZP_08079868.1| integral membrane protein [Lactobacillus ruminis ATCC 25644]
 gi|323092989|gb|EFZ35587.1| integral membrane protein [Lactobacillus ruminis ATCC 25644]
          Length = 235

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 119/238 (50%), Gaps = 19/238 (7%)

Query: 18  GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
           G  + +    + +++Y  MA  +G++ + +F+    A  V P   S++ N  VM     +
Sbjct: 10  GQKLVKDANGFFMKMYGYMAAAVGISAVTAFM----AANV-PSVVSLVSNGLVM-----S 59

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           +++   L  +F  + L         L SL         + YS + GL LS     YT+  
Sbjct: 60  ILFIMQLVLVFRMSSLKAIRTSGKALSSL---------IFYSMIEGLFLSGLLYKYTAMD 110

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           I + F   A  F  L++ G +TK+DL  IG   +     L ++S+VNLF+ S+ I    S
Sbjct: 111 ITRAFIAAAVLFVVLAVMGTSTKKDLSGIGRQALAALIALIIVSIVNLFLHSTMIQYVFS 170

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
            +G+V+FSALTAYD+Q  K  Y         +  + +GAL LY+DF+ IF++LL+  G
Sbjct: 171 FIGIVVFSALTAYDSQTYKVMYYQYGSQVNTDSLAAVGALNLYLDFLNIFLYLLQIFG 228


>gi|189439135|ref|YP_001954216.1| membrane protein [Bifidobacterium longum DJO10A]
 gi|189427570|gb|ACD97718.1| Integral membrane protein [Bifidobacterium longum DJO10A]
          Length = 297

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 101/164 (61%), Gaps = 4/164 (2%)

Query: 97  IFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYG 156
           + L +R+  + +  A++MF +Y+AL+G +LSS F+VY   SI     +TAA F +L+++G
Sbjct: 134 VVLGMRVTKMKSATARVMFYVYAALMGFTLSSIFMVYDLGSIGVALGVTAAFFFALTMFG 193

Query: 157 YTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIK 216
            TTK ++   G  +++G   L +  +V  F++   +   + A+GL++F+ +T YD Q  +
Sbjct: 194 MTTKFNMLKAGPILMIGLIVLIISQIVLAFVQVDGMTKIVCAIGLILFAGMTIYDAQSTR 253

Query: 217 EAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFLGSR 257
              ++ Y+    E   + S++ AL LY+DF+ +F+++L+ LG+R
Sbjct: 254 ALLTE-YEAQGPEMVKKISILCALNLYLDFVNMFLYILQLLGNR 296


>gi|23465965|ref|NP_696568.1| hypothetical protein BL1405 [Bifidobacterium longum NCC2705]
 gi|227547643|ref|ZP_03977692.1| integral membrane protein [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239621248|ref|ZP_04664279.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|312132569|ref|YP_003999908.1| integral membrane protein [Bifidobacterium longum subsp. longum
           BBMN68]
 gi|322689421|ref|YP_004209155.1| hypothetical protein BLIF_1237 [Bifidobacterium longum subsp.
           infantis 157F]
 gi|322691388|ref|YP_004220958.1| hypothetical protein BLLJ_1199 [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|23326678|gb|AAN25204.1| conserved hypothetical protein with MutT type domain
           [Bifidobacterium longum NCC2705]
 gi|227211898|gb|EEI79794.1| integral membrane protein [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239515709|gb|EEQ55576.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|311773509|gb|ADQ02997.1| Integral Membrane protein [Bifidobacterium longum subsp. longum
           BBMN68]
 gi|320456244|dbj|BAJ66866.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|320460757|dbj|BAJ71377.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 299

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 100/164 (60%), Gaps = 4/164 (2%)

Query: 97  IFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYG 156
           + L +R+  + +  A++MF +Y+AL+G +LSS F+VY   SI     +TAA F +L+++G
Sbjct: 136 VVLGMRVTKMKSATARVMFYVYAALMGFTLSSIFMVYDLGSIGVALGVTAAFFFALTMFG 195

Query: 157 YTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIK 216
            TTK ++   G  +++G   L +  +V  F++   +   + A+GL++F+ +T YD Q  +
Sbjct: 196 MTTKFNMLKAGPILMIGLIVLIISQIVLAFVQVDGMTKIVCAIGLILFAGMTIYDAQSTR 255

Query: 217 EAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            A    Y+    E   + S++ AL LY+DF+ +F+++L+ LG+R
Sbjct: 256 -ALLTEYEAQGPEMVKKISILCALNLYLDFVNMFLYILQLLGNR 298


>gi|300361135|ref|ZP_07057312.1| integral membrane protein [Lactobacillus gasseri JV-V03]
 gi|300353754|gb|EFJ69625.1| integral membrane protein [Lactobacillus gasseri JV-V03]
          Length = 243

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 122/232 (52%), Gaps = 17/232 (7%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  ++ R+Y +M + + V+ + ++L             ++ + R  ++T F +      
Sbjct: 24  GLNRFLSRMYGMMTIAVLVSALSAYL-------------TMTVFRTQVMTLFAS---NPA 67

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           + WI +  PL +   ++ R  + +  A+ +M ++ + + G+  S     YT +SI   F 
Sbjct: 68  MTWILLLVPLALTFGISFR-ATRNPVASFVMLMIMAIVYGVEFSLIAGAYTGRSIASAFV 126

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
            ++  F ++++ G TTK++L  +GS+      GL +  L+N+F+R+  +    S + ++I
Sbjct: 127 ASSTVFITMAVIGTTTKKNLNNLGSYASAALIGLIVAMLINMFLRNPMVSYVFSFIAVII 186

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           F+ LTA+D Q++K+ Y +       +  +V GAL LY+DF+ +F+  L+  G
Sbjct: 187 FTILTAWDAQRMKQIYENYGGQVSVDGLAVAGALALYLDFVNLFLQFLQIFG 238


>gi|116333682|ref|YP_795209.1| integral membrane protein, interacts with FtsH [Lactobacillus
           brevis ATCC 367]
 gi|116099029|gb|ABJ64178.1| Integral membrane protein, interacts with FtsH [Lactobacillus
           brevis ATCC 367]
          Length = 234

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 84/139 (60%)

Query: 117 LYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFG 176
           +Y+ + G  +S + LVYT  S+V  F  +AA F +++  G  TKRDL  IG+       G
Sbjct: 89  VYAVITGGVISLYSLVYTQTSMVAAFVSSAAIFITMAGIGVFTKRDLSKIGTQATAALIG 148

Query: 177 LFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGA 236
           L +  +VN+F+RS+ I L  S + ++IF+ LTA+DTQ++++ Y    D       +V GA
Sbjct: 149 LIVAMIVNMFLRSALIALIFSFVAVIIFAVLTAWDTQRMQKMYLQYGDQVSTTGLAVNGA 208

Query: 237 LMLYMDFIQIFVHLLRFLG 255
           L LY+DF+ +F+ LL+  G
Sbjct: 209 LQLYLDFVNLFLQLLQIFG 227


>gi|282851226|ref|ZP_06260591.1| putative membrane protein [Lactobacillus gasseri 224-1]
 gi|282557194|gb|EFB62791.1| putative membrane protein [Lactobacillus gasseri 224-1]
          Length = 237

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 122/232 (52%), Gaps = 17/232 (7%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  ++ R+Y +M + + V+ + ++L             ++ + R  ++T F +      
Sbjct: 18  GLNRFLSRMYGMMTIAVLVSALSAYL-------------TMTVFRTQVMTLFAS---NPA 61

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           + WI +  PL +   ++ R  + +  A+ +M ++ + + G+  S     YT +SI   F 
Sbjct: 62  MTWILLLVPLALTFGISFR-ATRNPVASFVMLMIMAIVYGVEFSLIAGAYTGRSIASAFV 120

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
            ++  F ++++ G TTK++L  +GS+      GL +  L+N+F+R+  +    S + ++I
Sbjct: 121 ASSTVFITMAVIGTTTKKNLNNLGSYASAALIGLIVAMLINMFLRNPMVSYIFSFIAVII 180

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           F+ LTA+D Q++K+ Y +       +  +V GAL LY+DF+ +F+  L+  G
Sbjct: 181 FTILTAWDAQRMKQIYENYGGQVSVDGLAVAGALALYLDFVNLFLQFLQIFG 232


>gi|296454334|ref|YP_003661477.1| hypothetical protein BLJ_1196 [Bifidobacterium longum subsp. longum
           JDM301]
 gi|296183765|gb|ADH00647.1| protein of unknown function UPF0005 [Bifidobacterium longum subsp.
           longum JDM301]
          Length = 300

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 99/164 (60%), Gaps = 4/164 (2%)

Query: 97  IFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYG 156
           + L +R+  + +  A++MF +Y+AL+G +LSS F+VY   SI     +TAA F +L+++G
Sbjct: 137 VVLGMRVTKMKSATARVMFYVYAALMGFTLSSIFMVYDLGSIGVALGVTAAFFFALTMFG 196

Query: 157 YTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIK 216
            TTK D+   G  +++G   L +  +V  F++   +   + A+GL++F+ +  YD Q  +
Sbjct: 197 MTTKFDMLKAGPILMIGLIVLIISQIVLAFVQVDGMTKIVCAIGLILFAGMAIYDAQSTR 256

Query: 217 EAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            A    Y+    E   + S++ AL LY+DF+ +F+++L+ LG+R
Sbjct: 257 -ALLTEYEAQGPEMVKKISILCALNLYLDFVNMFLYILQLLGNR 299


>gi|291516735|emb|CBK70351.1| Integral membrane protein, interacts with FtsH [Bifidobacterium
           longum subsp. longum F8]
          Length = 300

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 100/164 (60%), Gaps = 4/164 (2%)

Query: 97  IFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYG 156
           + L +R+  + +  A++MF +Y+AL+G +LSS F+VY   SI     +TAA F +L+++G
Sbjct: 137 VVLGMRVTKMKSATARVMFYVYAALMGFTLSSIFMVYDLGSIGVALGVTAAFFFALTMFG 196

Query: 157 YTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIK 216
            TTK ++   G  +++G   L +  +V  F++   +   + A+GL++F+ +T YD Q  +
Sbjct: 197 MTTKFNMLKAGPILMIGLIVLIISQIVLAFVQVDGMTKIVCAIGLILFAGMTIYDAQSTR 256

Query: 217 EAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            A    Y+    E   + S++ AL LY+DF+ +F+++L+ LG+R
Sbjct: 257 -ALLTEYEAQGPEMVKKISILCALNLYLDFVNMFLYILQLLGNR 299


>gi|116630124|ref|YP_815296.1| integral membrane protein, interacts with FtsH [Lactobacillus
           gasseri ATCC 33323]
 gi|116095706|gb|ABJ60858.1| Integral membrane protein, interacts with FtsH [Lactobacillus
           gasseri ATCC 33323]
          Length = 243

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 122/232 (52%), Gaps = 17/232 (7%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  ++ R+Y +M + + V+ + ++L             ++ + R  ++T F +      
Sbjct: 24  GLNRFLSRMYGMMTIAVLVSALSAYL-------------TMTVFRTQVMTLFAS---NPA 67

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           + WI +  PL +   ++ R  + +  A+ +M ++ + + G+  S     YT +SI   F 
Sbjct: 68  MTWILLLVPLALTFGISFR-ATRNPVASFVMLMIMAIVYGVEFSLIAGAYTGRSIASAFV 126

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
            ++  F ++++ G TTK++L  +GS+      GL +  L+N+F+R+  +    S + ++I
Sbjct: 127 ASSTVFITMAVIGTTTKKNLNNLGSYASAALIGLIVAMLINMFLRNPMVSYIFSFIAVII 186

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           F+ LTA+D Q++K+ Y +       +  +V GAL LY+DF+ +F+  L+  G
Sbjct: 187 FTILTAWDAQRMKQIYENYGGQVSVDGLAVAGALALYLDFVNLFLQFLQIFG 238


>gi|238854160|ref|ZP_04644507.1| integral membrane protein, interacts with FtsH [Lactobacillus
           gasseri 202-4]
 gi|238833236|gb|EEQ25526.1| integral membrane protein, interacts with FtsH [Lactobacillus
           gasseri 202-4]
          Length = 237

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 122/232 (52%), Gaps = 17/232 (7%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  ++ R+Y +M + + V+ + ++L             ++ + R  ++T F +      
Sbjct: 18  GLNRFLSRMYGMMTIAVLVSALSAYL-------------TMTVFRTQVMTLFAS---NPA 61

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           + WI +  PL +   ++ R  + +  A+ +M ++ + + G+  S     YT +SI   F 
Sbjct: 62  MTWILLLVPLALTFGISFR-ATRNPVASFVMLMIMAIVYGVEFSLIAGAYTGRSIASAFV 120

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
            ++  F ++++ G TTK++L  +GS+      GL +  L+N+F+R+  +    S + ++I
Sbjct: 121 ASSTVFITMAVIGTTTKKNLNNLGSYASAALIGLIVAMLINMFLRNPMVSYIFSFIAVII 180

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           F+ LTA+D Q++K+ Y +       +  +V GAL LY+DF+ +F+  L+  G
Sbjct: 181 FTILTAWDAQRMKQIYENYGGQVSVDGLAVAGALALYLDFVNLFLQFLQIFG 232


>gi|332686693|ref|YP_004456467.1| hypothetical protein MPTP_1207 [Melissococcus plutonius ATCC 35311]
 gi|332370702|dbj|BAK21658.1| hypothetical protein MPTP_1207 [Melissococcus plutonius ATCC 35311]
          Length = 229

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 122/241 (50%), Gaps = 23/241 (9%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLV-NILATTVDPDAASIIINRGVMLTGFGALMY 80
            +GL  +  ++Y L+ +G+ ++ ++++LV N+    V                      Y
Sbjct: 9   KEGLNKFYGKIYGLLGIGISISALVAYLVMNVFRVQVL------------------FFFY 50

Query: 81  TSPLRWIFIF-APLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIV 139
           T P+ +  I+ A + + + L+ +       A    F+ YS L GL+L+    +YT  +I 
Sbjct: 51  TKPMAFTVIWLAEIALVLLLSFKAAKQPTLAMSG-FIAYSFLNGLTLAVTLQLYTQATIF 109

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMSA 198
             F  TAA+F ++SL G  TKRDL  +G        G+F+  L+N F + S  +D  +S 
Sbjct: 110 GAFISTAATFFAMSLIGVFTKRDLSALGHAAYSALLGVFIALLLNAFLLHSEPVDYAISI 169

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           + ++IFS LTAYD QKI+  Y +   V  +   +V  AL LY+DFI +F+  +  LG + 
Sbjct: 170 LMVLIFSGLTAYDNQKIRSVYYNSM-VPSSTGVAVFLALQLYLDFINLFLSFVSILGGKN 228

Query: 259 D 259
           +
Sbjct: 229 N 229


>gi|227543924|ref|ZP_03973973.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri CF48-3A]
 gi|300909672|ref|ZP_07127133.1| integral membrane protein [Lactobacillus reuteri SD2112]
 gi|227186101|gb|EEI66172.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri CF48-3A]
 gi|300893537|gb|EFK86896.1| integral membrane protein [Lactobacillus reuteri SD2112]
          Length = 237

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 87/150 (58%), Gaps = 1/150 (0%)

Query: 111 AKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFM 170
           A +M +L + + G+  +    VY+  SI   F  +AA F +++LYG  TKRDL   G+  
Sbjct: 88  AFIMLMLTAIIYGVEFAIIAGVYSGASIASAFVSSAAVFVTMALYGTITKRDLSKFGAHA 147

Query: 171 IMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAER 230
           +     L +  L+N+F++S AI    S + ++IF+ LTA+D QK+K+ Y +         
Sbjct: 148 MAALIALMIAYLINMFLQSPAIAYIFSFIAVIIFTVLTAWDAQKMKQIYINYGGEVSTNG 207

Query: 231 QSVIGALMLYMDFIQIFVHLLRFLG-SRRD 259
            +V+GAL LY+DF+ +F+ LL+  G S R+
Sbjct: 208 LAVLGALQLYLDFVNLFISLLQIFGMSDRN 237


>gi|42519583|ref|NP_965513.1| hypothetical protein LJ1706 [Lactobacillus johnsonii NCC 533]
 gi|41583872|gb|AAS09479.1| hypothetical protein LJ_1706 [Lactobacillus johnsonii NCC 533]
          Length = 237

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 121/232 (52%), Gaps = 17/232 (7%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  ++ R+Y +M + + V+ + ++L             ++ + R  ++T F +      
Sbjct: 18  GLNRFLSRMYGMMTIAVLVSALSAYL-------------TMTVFRTQVMTLFAS---NPA 61

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           + WI +  PL +   ++ R  + +  A+ +M ++ + + G+  S     YT  SI   F 
Sbjct: 62  MTWILLLVPLALTFGISFR-ATRNPVASFVMLMIMAIVYGVEFSLIAGAYTGHSIASAFV 120

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
            ++  F ++++ G TTK++L  +GS+      GL +  L+N+F+R+  +    S + ++I
Sbjct: 121 ASSTVFITMAVIGTTTKKNLNNLGSYASAALIGLIVAMLINMFLRNPMVSYIFSFIAVII 180

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           F+ LTA+D Q++K+ Y +       +  +V GAL LY+DF+ +F+  L+  G
Sbjct: 181 FTILTAWDAQRMKQIYENYSGQVSVDGLAVAGALALYLDFVNLFLQFLQIFG 232


>gi|269123176|ref|YP_003305753.1| hypothetical protein Smon_0393 [Streptobacillus moniliformis DSM
           12112]
 gi|268314502|gb|ACZ00876.1| protein of unknown function UPF0005 [Streptobacillus moniliformis
           DSM 12112]
          Length = 228

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 90/157 (57%), Gaps = 4/157 (2%)

Query: 107 SAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPI 166
           SA   K++F+ YSA +G+ L      Y   SI+     T+A F  +S YGY T+ +L   
Sbjct: 72  SASVLKLVFIGYSAFLGILLIPIMYAYQMVSIITLLGSTSAMFVGMSAYGYFTRSNLQSY 131

Query: 167 GSFMIMGAFGLFLLSLVNLFM-RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY-- 223
             ++  G  G+ ++S++N+++ +S+  D+ +S  GL+IF   TA DTQ+IK    D Y  
Sbjct: 132 SKYLFGGLLGIIVMSVLNIYIFKSNTGDIMLSMAGLLIFIIYTAVDTQRIKSMILDAYYE 191

Query: 224 -DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            +    ++  + GALMLY DFI +F++LL   G RRD
Sbjct: 192 GNKDLLDKVKIFGALMLYSDFINMFLYLLSLFGKRRD 228


>gi|148544473|ref|YP_001271843.1| hypothetical protein Lreu_1249 [Lactobacillus reuteri DSM 20016]
 gi|227363099|ref|ZP_03847234.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri MM2-3]
 gi|325682795|ref|ZP_08162311.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri MM4-1A]
 gi|148531507|gb|ABQ83506.1| protein of unknown function UPF0005 [Lactobacillus reuteri DSM
           20016]
 gi|227071817|gb|EEI10105.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri MM2-3]
 gi|324977145|gb|EGC14096.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri MM4-1A]
          Length = 237

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 87/150 (58%), Gaps = 1/150 (0%)

Query: 111 AKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFM 170
           A +M +L + + G+  +    VY+  SI   F  +AA F +++LYG  TKRDL   G+  
Sbjct: 88  AFVMLMLTAIIYGVEFAIIAGVYSGASIASAFVSSAAVFVTMALYGTITKRDLSKFGAHA 147

Query: 171 IMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAER 230
           +     L +  L+N+F++S AI    S + ++IF+ LTA+D QK+K+ Y +         
Sbjct: 148 MAALIALMIAYLINMFLQSPAIAYIFSFIAVIIFTVLTAWDAQKMKQIYINYGGEVSTNG 207

Query: 231 QSVIGALMLYMDFIQIFVHLLRFLG-SRRD 259
            +V+GAL LY+DF+ +F+ LL+  G S R+
Sbjct: 208 LAVLGALQLYLDFVNLFISLLQIFGMSDRN 237


>gi|184153838|ref|YP_001842179.1| hypothetical protein LAR_1183 [Lactobacillus reuteri JCM 1112]
 gi|183225182|dbj|BAG25699.1| conserved hypothetical protein [Lactobacillus reuteri JCM 1112]
          Length = 238

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 87/150 (58%), Gaps = 1/150 (0%)

Query: 111 AKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFM 170
           A +M +L + + G+  +    VY+  SI   F  +AA F +++LYG  TKRDL   G+  
Sbjct: 89  AFVMLMLTAIIYGVEFAIIAGVYSGASIASAFVSSAAVFVTMALYGTITKRDLSKFGAHA 148

Query: 171 IMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAER 230
           +     L +  L+N+F++S AI    S + ++IF+ LTA+D QK+K+ Y +         
Sbjct: 149 MAALIALMIAYLINMFLQSPAIAYIFSFIAVIIFTVLTAWDAQKMKQIYINYGGEVSTNG 208

Query: 231 QSVIGALMLYMDFIQIFVHLLRFLG-SRRD 259
            +V+GAL LY+DF+ +F+ LL+  G S R+
Sbjct: 209 LAVLGALQLYLDFVNLFISLLQIFGMSDRN 238


>gi|300811374|ref|ZP_07091870.1| putative membrane protein [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
 gi|300497609|gb|EFK32635.1| putative membrane protein [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
          Length = 237

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 79/142 (55%)

Query: 114 MFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMG 173
           M +  + + GL  S     YT   I   F   +A F  ++ YG  TK++L  IG++    
Sbjct: 90  MLMAIAVVYGLEFSLLAFAYTGAQIGGAFISASAVFIGMAAYGSVTKKNLDTIGAYASAA 149

Query: 174 AFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSV 233
            +GL + SLVN+F++S+      S +G++IF+ LTA+D QK+K  Y+   D       +V
Sbjct: 150 IWGLIVASLVNMFLKSTPASFIFSIIGVIIFTILTAWDAQKMKSIYASYGDQLPELGLAV 209

Query: 234 IGALMLYMDFIQIFVHLLRFLG 255
            GALMLY+DFI +F+  LR  G
Sbjct: 210 NGALMLYLDFINLFLQFLRIFG 231


>gi|313123220|ref|YP_004033479.1| hypothetical protein LDBND_0452 [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|312279783|gb|ADQ60502.1| Conserved hypothetical membrane protein [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
          Length = 237

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 79/142 (55%)

Query: 114 MFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMG 173
           M +  + + GL  S     YT   I   F   +A F  ++ YG  TK++L  IG++    
Sbjct: 90  MLMAIAVIYGLEFSLLSFAYTGAQIGGAFISASAVFIGMAAYGSVTKKNLDTIGAYASAA 149

Query: 174 AFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSV 233
            +GL + SLVN+F++S+      S +G++IF+ LTA+D QK+K  Y+   D       +V
Sbjct: 150 IWGLIVASLVNMFLKSTPASFIFSIIGVIIFTILTAWDAQKMKSIYASYGDQLPELGLAV 209

Query: 234 IGALMLYMDFIQIFVHLLRFLG 255
            GALMLY+DFI +F+  LR  G
Sbjct: 210 NGALMLYLDFINLFLQFLRIFG 231


>gi|116513624|ref|YP_812530.1| integral membrane protein, interacts with FtsH [Lactobacillus
           delbrueckii subsp. bulgaricus ATCC BAA-365]
 gi|116092939|gb|ABJ58092.1| Integral membrane protein, interacts with FtsH [Lactobacillus
           delbrueckii subsp. bulgaricus ATCC BAA-365]
          Length = 237

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 79/142 (55%)

Query: 114 MFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMG 173
           M +  + + GL  S     YT   I   F   +A F  ++ YG  TK++L  IG++    
Sbjct: 90  MLMAIAVVYGLEFSLLAFAYTGAQIGGAFISASAVFIGMAAYGSVTKKNLDTIGAYASAA 149

Query: 174 AFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSV 233
            +GL + SLVN+F++S+      S +G++IF+ LTA+D QK+K  Y+   D       +V
Sbjct: 150 IWGLIVASLVNMFLKSTPASFIFSIIGVIIFTILTAWDAQKMKSIYASYGDQLPELGLAV 209

Query: 234 IGALMLYMDFIQIFVHLLRFLG 255
            GALMLY+DFI +F+  LR  G
Sbjct: 210 NGALMLYLDFINLFLQFLRIFG 231


>gi|291087131|ref|ZP_06345485.2| putative membrane protein [Clostridium sp. M62/1]
 gi|291075732|gb|EFE13096.1| putative membrane protein [Clostridium sp. M62/1]
          Length = 238

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 112/192 (58%), Gaps = 8/192 (4%)

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNV--RLHSLSAYAAKMMFLLYSALIGLSLSSFF 130
           TG   L++++P   IF+   + +F+ +++  R+H +S  AA+ MFL Y+AL G+  S++F
Sbjct: 50  TGITMLVFSNPYG-IFVITGIELFVVISMSARIHKISVSAARAMFLFYAALNGIVFSAYF 108

Query: 131 LVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSS 190
           L+  S  ++  F  T+  FG ++   Y  K DL  I   +I G   L + +L+++F+  +
Sbjct: 109 LLIGSGMLIFIFGATSVFFGLMAAVSYVAKIDLSRIRPLLIGGLLFLIVFNLLSMFLNLT 168

Query: 191 AIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIF 247
           A++  +  +G++IF ALTAYD   I+  Y   Y  + +E   + S+  AL LY+DFI +F
Sbjct: 169 AMETGICYLGIIIFLALTAYDVGMIRRNY--EYFSSNSELLAKASIFSALQLYLDFINLF 226

Query: 248 VHLLRFLGSRRD 259
           ++LLR     R+
Sbjct: 227 LYLLRLFARNRN 238


>gi|104773632|ref|YP_618612.1| hypothetical protein Ldb0509 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|103422713|emb|CAI97340.1| Conserved hypothetical membrane protein [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC 11842]
          Length = 237

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 79/142 (55%)

Query: 114 MFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMG 173
           M +  + + GL  S     YT   I   F   +A F  ++ YG  TK++L  IG++    
Sbjct: 90  MLMAIAVVYGLEFSLLAFAYTGAQIGGAFISASAVFIGMAAYGSVTKKNLDTIGAYASAA 149

Query: 174 AFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSV 233
            +GL + SLVN+F++S+      S +G++IF+ LTA+D QK+K  Y+   D       +V
Sbjct: 150 IWGLIVASLVNMFLKSTPASFIFSIIGVIIFTILTAWDAQKMKSIYASYGDQLPELGLAV 209

Query: 234 IGALMLYMDFIQIFVHLLRFLG 255
            GALMLY+DFI +F+  LR  G
Sbjct: 210 NGALMLYLDFINLFLQFLRIFG 231


>gi|213691829|ref|YP_002322415.1| protein of unknown function UPF0005 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|213523290|gb|ACJ52037.1| protein of unknown function UPF0005 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 227

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 99/164 (60%), Gaps = 4/164 (2%)

Query: 97  IFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYG 156
           + L +R+  + +  A++M  +Y+AL+G +LSS F+VY   SI     +TAA F +L+++G
Sbjct: 64  VVLGMRVTKMKSATARVMLYMYAALMGFTLSSIFMVYDLGSIGVALGVTAAFFFALTMFG 123

Query: 157 YTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIK 216
            TTK D+   G  +++G   L +  +V  F++   +   + A+GL++F+ +  YD Q  +
Sbjct: 124 MTTKFDMLKAGPILMIGLIVLIISQIVLAFVQVDGMTKIVCAIGLILFAGMAIYDAQSTR 183

Query: 217 EAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFLGSR 257
              ++ Y+    E   + S++ AL LY+DF+ +F+++L+ LG+R
Sbjct: 184 ALLTE-YEAQGPEMVKKISILCALNLYLDFVNMFLYILQLLGNR 226


>gi|170017480|ref|YP_001728399.1| integral membrane protein, interacts with FtsH [Leuconostoc citreum
           KM20]
 gi|169804337|gb|ACA82955.1| Integral membrane protein, interacts with FtsH [Leuconostoc citreum
           KM20]
          Length = 239

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 116/245 (47%), Gaps = 33/245 (13%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVN--ILATTVDPDAASIIINRGVM----- 71
           + +D G+RA+  + Y+ M L + VT +  F+V    LA      A ++I    ++     
Sbjct: 13  TGMDAGMRAFFKQTYSFMGLAVLVTAVTGFIVQKFFLAQVYALIAGNLIGTLALLGIQLL 72

Query: 72  -LTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFF 130
            +T  G   + +P R                         A  + + ++ + GL++    
Sbjct: 73  IITMIGRATFKNPAR-------------------------AFGLLMAFAVVEGLTVGLLL 107

Query: 131 LVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSS 190
            +YT  SI+  F   AA FG ++LYG  TKRDL  +G  +     GLF+  L+N+F  + 
Sbjct: 108 AIYTGASIMMAFVSAAAVFGGMALYGVFTKRDLSGMGGALFGMLIGLFVAMLINMFFPNG 167

Query: 191 AIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHL 250
            + L +S + +++FS  TAYD Q +K  YS     A     ++ GAL LY+DFI +F  L
Sbjct: 168 IVSLLISFVSVIVFSLYTAYDNQSLKVMYSQFAGQADTTGLAINGALRLYLDFINLFFAL 227

Query: 251 LRFLG 255
           +R  G
Sbjct: 228 VRIFG 232


>gi|292558996|gb|ADE31997.1| membrane protein [Streptococcus suis GZ1]
          Length = 157

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 85/147 (57%), Gaps = 2/147 (1%)

Query: 114 MFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMG 173
           MFL YS   G+++S   + YTS+++V  F   A  F  +++ G TTK+DL  +   +   
Sbjct: 12  MFLAYSVTNGITISMILMFYTSETVVLAFVSAALMFAIMAVIGMTTKKDLSGMAQALRAA 71

Query: 174 AFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSV 233
            +G+ + S++N+F+RSS +   MS + + +FS L AYD Q+I+  +  +      +   V
Sbjct: 72  LWGIIIASVINIFLRSSGLSFMMSIISVWVFSGLIAYDNQRIRNVF-KQTGGNVGQGWVV 130

Query: 234 IGALMLYMDFIQIFVHLLRFLGS-RRD 259
             AL LY+DFI +F++LLR  G   RD
Sbjct: 131 SMALQLYLDFINLFLNLLRIFGGLSRD 157


>gi|320457924|dbj|BAJ68545.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 300

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 98/164 (59%), Gaps = 4/164 (2%)

Query: 97  IFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYG 156
           + L +R+  + +  A++M  +Y+AL+G +LSS F+VY   SI     +TAA F +L+++G
Sbjct: 137 VVLGMRVTKMKSATARVMLYMYAALMGFTLSSIFMVYDLGSIGVALGVTAAFFFALTMFG 196

Query: 157 YTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIK 216
            TTK D+   G  +++G   L +  +V  F++   +   + A+GL++F+ +  YD Q  +
Sbjct: 197 MTTKFDMLKAGPILMIGLIVLIISQIVLAFVQVDGMTKIVCAIGLILFAGMAIYDAQSTR 256

Query: 217 EAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            A    Y+    E   + S++ AL LY+DF+ +F+++L+ LG+R
Sbjct: 257 -ALLTEYEAQGPEMVKKISILCALNLYLDFVNMFLYILQLLGNR 299


>gi|295091589|emb|CBK77696.1| Integral membrane protein, interacts with FtsH [Clostridium cf.
           saccharolyticum K10]
          Length = 236

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 111/192 (57%), Gaps = 8/192 (4%)

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNV--RLHSLSAYAAKMMFLLYSALIGLSLSSFF 130
           TG   L++++P   IF+   + +F+ +++  R+H +S  AA+ MFL Y+AL G+  S++F
Sbjct: 48  TGITMLVFSNPYG-IFVITGIELFVVISMSARIHKISVSAARAMFLFYAALNGIVFSAYF 106

Query: 131 LVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSS 190
           L+  S  ++  F  T+  FG ++   Y  K DL  I   +I G   L + +L++ F+  +
Sbjct: 107 LLIGSGMLIFIFGATSVFFGLMAAVSYVAKIDLSRIRPLLIGGLLFLIVFNLLSTFLNLT 166

Query: 191 AIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIF 247
           A++  +  +G++IF ALTAYD   I+  Y   Y  + +E   + S+  AL LY+DFI +F
Sbjct: 167 AMETGICYLGIIIFLALTAYDVGMIRRNY--EYFSSNSELLAKASIFSALQLYLDFINLF 224

Query: 248 VHLLRFLGSRRD 259
           ++LLR     R+
Sbjct: 225 LYLLRLFARNRN 236


>gi|19704201|ref|NP_603763.1| integral membrane protein [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|19714423|gb|AAL95062.1| Integral membrane protein [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
          Length = 224

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 58/173 (33%), Positives = 101/173 (58%), Gaps = 4/173 (2%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           + A L +   +++ ++ +S+  A+++F  YS + G++L+   L+Y  + I   F IT   
Sbjct: 53  VIAELAMVFSISLFINKMSSSLARILFFAYSLVNGITLTVIGLIYAPQVIFYAFMITLTI 112

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           F   ++YGYTT+ DL     F I+    L +LS++N+FMR   ++  ++  G+VIF+ L 
Sbjct: 113 FIVTAIYGYTTQEDLSSYRRFFIIALISLIILSIINVFMRVGMLEWVITIAGVVIFTGLI 172

Query: 209 AYDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYD  +IK      +D  D    E+  +IGAL LY+DFI +F+++LR  G ++
Sbjct: 173 AYDVNRIKFISYQLADG-DNETIEKMGIIGALNLYLDFINLFIYILRIFGRKK 224


>gi|116617822|ref|YP_818193.1| integral membrane protein, interacts with FtsH [Leuconostoc
           mesenteroides subsp. mesenteroides ATCC 8293]
 gi|116096669|gb|ABJ61820.1| Integral membrane protein, interacts with FtsH [Leuconostoc
           mesenteroides subsp. mesenteroides ATCC 8293]
          Length = 239

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 113/243 (46%), Gaps = 33/243 (13%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLV-NILATTVDPDAASIIIN-------RGVML 72
           +D+G+RA+  + Y+ M + + +T +  F+V N     V       +I        + +++
Sbjct: 15  VDEGMRAFFKQTYSFMGIAVLLTAVTGFIVQNFFLEQVAKLLVGNVIGLLALLGIQMLII 74

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
           T  G   + +P R                         A  + + ++ + GL+L     V
Sbjct: 75  TMIGRATFKNPAR-------------------------AFGLLMAFAVVEGLTLGVLLAV 109

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT  S+V  F   +A FG ++ YG  TKRDL  +GS +     GL + S+ N+F  S  +
Sbjct: 110 YTGASVVMAFVSASAVFGGMAAYGVFTKRDLTGLGSILFGLLIGLLIASIANMFFYSGIV 169

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
            L +S   +V+FS  TAYD Q +K  YS     A     +V GAL LY+DF+ IF  LLR
Sbjct: 170 SLLLSWASVVVFSLFTAYDNQNLKVMYSQFAGQADTTGLAVNGALRLYLDFVNIFFALLR 229

Query: 253 FLG 255
             G
Sbjct: 230 IFG 232


>gi|222152575|ref|YP_002561750.1| membrane protein [Streptococcus uberis 0140J]
 gi|222113386|emb|CAR41032.1| putative membrane protein [Streptococcus uberis 0140J]
          Length = 229

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 121/238 (50%), Gaps = 19/238 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GL  +  ++Y+L+ +G+G++  +S+L+      + P   ++I           +++  
Sbjct: 11  DAGLNRFFAKIYSLVGMGVGLSAFVSYLM------LFPFRENLI-----------SIISQ 53

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
            P  +    A   + +F+       +   A  +FL+YSAL G +LS     YT  ++++ 
Sbjct: 54  HPFVYYGAAAVELILVFIASSAAQRNTPMALPLFLIYSALNGFTLSFIIAAYTGTTVLEA 113

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +AA F +++  G   K+DL  +   M+    G+ L S++N+FM S  +   +S + +
Sbjct: 114 FVSSAAVFFAMAFIGARVKKDLSGMRKAMMAALIGIILASVINIFMGSGTMSFIISIISV 173

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +IFS L A D Q IK  Y +  +    +  +V  AL LY+DFI +F+ LLR  G R D
Sbjct: 174 LIFSGLIASDNQMIKRVY-EANNGQVGDGWAVAMALSLYLDFINLFISLLRIFG-RND 229


>gi|296328585|ref|ZP_06871102.1| inner membrane protein [Fusobacterium nucleatum subsp. nucleatum
           ATCC 23726]
 gi|296154184|gb|EFG94985.1| inner membrane protein [Fusobacterium nucleatum subsp. nucleatum
           ATCC 23726]
          Length = 249

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 58/173 (33%), Positives = 101/173 (58%), Gaps = 4/173 (2%)

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           + A L +   +++ ++ +S+  A+++F  YS + G++L+   L+Y  + I   F IT   
Sbjct: 78  VIAELAMVFSISLFINKMSSSLARILFFAYSLVNGITLTVIGLIYAPQVIFYAFMITLTI 137

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           F   ++YGYTT+ DL     F I+    L +LS++N+FMR   ++  ++  G+VIF+ L 
Sbjct: 138 FIVTAIYGYTTQEDLSSYRRFFIIALISLIILSIINVFMRVGMLEWVITIAGVVIFTGLI 197

Query: 209 AYDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYD  +IK      +D  D    E+  +IGAL LY+DFI +F+++LR  G ++
Sbjct: 198 AYDVNRIKFISYQLADG-DNETIEKMGIIGALNLYLDFINLFIYILRIFGRKK 249


>gi|332638561|ref|ZP_08417424.1| integral membrane protein [Weissella cibaria KACC 11862]
          Length = 243

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 125/244 (51%), Gaps = 28/244 (11%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFL-VNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
           GL  +  +VY  MAL L VT   ++L V + A  +                   A +++S
Sbjct: 20  GLNDFFKKVYTYMALALLVTAATAYLGVTLFAAQI-------------------AAIFSS 60

Query: 83  PLRWIFIFAPLGVFIFL-NVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
            +  + +FA +  F++L + R+++    A  M+ + +S L G++ +   L  +   I   
Sbjct: 61  TMSSLVMFAVMMGFVWLFSSRVYTNPGQAFGML-MGFSVLNGVTFAVIGLTTSLGMIASA 119

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FF TA  F  ++LYG+TTK+ +  + S +      L +  ++NLF  +S + L +S +G+
Sbjct: 120 FFTTALLFAGMALYGFTTKKSMSSLSSILFGSVIALIIGGIINLFFFNSIVYLFLSVVGV 179

Query: 202 VIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF---LG 255
           V+F+ +TAYD  ++K     Y  + D    +  +V GAL LYMDFI +F+++LR     G
Sbjct: 180 VVFAIMTAYDMNRLKTMYIEYGSQGDATLTQGLAVSGALSLYMDFINLFIYILRLFTAFG 239

Query: 256 SRRD 259
             RD
Sbjct: 240 GSRD 243


>gi|322387094|ref|ZP_08060705.1| membrane protein [Streptococcus infantis ATCC 700779]
 gi|321142081|gb|EFX37575.1| membrane protein [Streptococcus infantis ATCC 700779]
          Length = 227

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 120/236 (50%), Gaps = 19/236 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  +  +VY  + +G+ ++ I+S L   + TT       ++IN  + L   G +     
Sbjct: 11  GLNQFYAKVYAFVGIGIALSAIVSAL---MLTTFQDLLVQLMINARIWLIVTGIVEVA-- 65

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
              + IFA           L   ++ A   +FLLYSA+ G SLS    +Y   +++  F 
Sbjct: 66  ---LVIFAS---------GLAVKNSPATFPIFLLYSAINGFSLSFIVSLYLPGTVLTAFI 113

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
            +AA F  +++ G   K+DL  IG  +I   FGL L  +VN+F+ S  +D  +S + +++
Sbjct: 114 SSAALFFVMAIVGVVIKKDLSGIGRALIAALFGLILAMVVNIFLNSDLMDYIISIVMVLV 173

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           F+ L A+D QKI+  Y +  D   A   ++  AL LY+DFI +F+  LR  G R D
Sbjct: 174 FAGLIAWDNQKIRYVYEES-DGQVATGWAISLALSLYLDFINLFLSFLRIFG-RDD 227


>gi|325684585|gb|EGD26744.1| integral membrane protein, interacts with FtsH [Lactobacillus
           delbrueckii subsp. lactis DSM 20072]
          Length = 237

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 78/139 (56%)

Query: 114 MFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMG 173
           M +  + + GL  S     YT   I   F   +A F  ++ YG  TK++L  IG++    
Sbjct: 90  MLMAIAVIYGLEFSLLAFAYTGAQIGGAFISASAVFIGMAAYGSVTKKNLDTIGAYASAA 149

Query: 174 AFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSV 233
            +GL + SLVN+F++S+      S +G++IF+ LTA+D QK+K  Y+   D       +V
Sbjct: 150 IWGLIVASLVNMFLKSTPASFIFSIIGVIIFTILTAWDAQKMKSIYASYGDQLPELGLAV 209

Query: 234 IGALMLYMDFIQIFVHLLR 252
            GALMLY+DFI +F+  LR
Sbjct: 210 NGALMLYLDFINLFLQFLR 228


>gi|237737335|ref|ZP_04567816.1| integral membrane protein [Fusobacterium mortiferum ATCC 9817]
 gi|229421197|gb|EEO36244.1| integral membrane protein [Fusobacterium mortiferum ATCC 9817]
          Length = 235

 Score = 88.2 bits (217), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 59/171 (34%), Positives = 103/171 (60%), Gaps = 2/171 (1%)

Query: 91  APLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFG 150
           A + +  FL++ ++ +S+  A+ +F +Y+ + G+  SS   V+   SI+ T  +T   F 
Sbjct: 65  AEVALVFFLSLGINKMSSVTARFLFYVYALMNGILFSSLAFVFHPISILYTLGVTTIMFI 124

Query: 151 SLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAY 210
            + +YGYTTK DL     F++ G   + ++SL+N+F+++  +    + +G+VIFS L A+
Sbjct: 125 VIGVYGYTTKEDLTKYSKFLMTGLITIIIISLINIFIKAPMLYWVGTILGVVIFSGLIAF 184

Query: 211 DTQKIKE-AYS-DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           D  +IK  AY+    D    E+  +IGAL LY+DFI +F++LLR  G +R+
Sbjct: 185 DINRIKYIAYNIAGSDEEMVEKMGIIGALNLYLDFINLFLYLLRIFGKKRN 235


>gi|225351357|ref|ZP_03742380.1| hypothetical protein BIFPSEUDO_02951 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225157701|gb|EEG70984.1| hypothetical protein BIFPSEUDO_02951 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 277

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 130/244 (53%), Gaps = 30/244 (12%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           +Q  R+ +   Y  M LGL VT +++ +                     M   + AL+ T
Sbjct: 55  EQAERSSVNSAYTHMTLGLIVTAVVAIITQ-------------------MSGAYLALIQT 95

Query: 82  SPLRWIFIFAP----LGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           + +  I IFAP    + + I+L  R+H++    A +MF +Y+AL+G +LS+ F+ Y   +
Sbjct: 96  TGI--IGIFAPAVIEIVLAIYLGARIHTMKVSTAYVMFYVYAALMGFTLSTIFMAYDLGT 153

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV-NLFMRSSAIDLTM 196
           I  +  + A  F +L+++G TTK ++   G  + +G   L +  ++  +F   +   + +
Sbjct: 154 IGISLALCAGFFFALTMFGRTTKINMLKAGPILFVGLIVLIIAEVILMIFAPGNTTLMIV 213

Query: 197 SAMGLVIFSALTAYDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
           SA+GL++F+ +T YD Q  +   E YS +      ++ S++ AL LY+DF+ +F+++L+ 
Sbjct: 214 SAIGLLLFAGMTVYDAQATRAMLEQYSAQ-GPEMVKKVSILCALNLYLDFVNMFMYILQL 272

Query: 254 LGSR 257
           LG+R
Sbjct: 273 LGNR 276


>gi|283783539|ref|YP_003374293.1| hypothetical protein HMPREF0424_1092 [Gardnerella vaginalis 409-05]
 gi|298252621|ref|ZP_06976415.1| hypothetical membrane protein [Gardnerella vaginalis 5-1]
 gi|283441094|gb|ADB13560.1| putative membrane protein [Gardnerella vaginalis 409-05]
 gi|297532985|gb|EFH71869.1| hypothetical membrane protein [Gardnerella vaginalis 5-1]
          Length = 248

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 104/183 (56%), Gaps = 15/183 (8%)

Query: 86  WIFI-FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
           WI +  A + + + L  RL  +S    +++F  Y+AL G +LSS F V++  S+   F +
Sbjct: 72  WIMLAIAQVVIAVVLGTRLMKMSETTVRVLFYAYAALTGFTLSSVFQVFSLGSVALVFAL 131

Query: 145 TAASFGSLSLYGYTTKRDL---GPIGSFMIMGAFGLFLLS--LVNLFMRSSAIDLTMSAM 199
           TA  F  L++   TTK+DL   GPI    +M A  +F+++  +++   + +     M+ +
Sbjct: 132 TAGFFLCLTMLALTTKKDLLKAGPI----LMVALLVFVVAQIIISFIGQDTGTMRLMAGI 187

Query: 200 GLVIFSALTAYDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           G+VIF+ LTAYD Q+ +     Y ++ ++   ++ S+  A  L++DFI +F++LL  LG 
Sbjct: 188 GIVIFAGLTAYDAQQTRALLAQYENQPEM--VKKVSIFCAFQLFLDFINMFIYLLELLGD 245

Query: 257 RRD 259
            RD
Sbjct: 246 NRD 248


>gi|262047046|ref|ZP_06020005.1| integral membrane protein [Lactobacillus crispatus MV-3A-US]
 gi|293381903|ref|ZP_06627871.1| conserved hypothetical protein [Lactobacillus crispatus 214-1]
 gi|295692396|ref|YP_003601006.1| hypothetical protein LCRIS_00534 [Lactobacillus crispatus ST1]
 gi|312984355|ref|ZP_07791696.1| putative membrane protein [Lactobacillus crispatus CTV-05]
 gi|260572623|gb|EEX29184.1| integral membrane protein [Lactobacillus crispatus MV-3A-US]
 gi|290921550|gb|EFD98584.1| conserved hypothetical protein [Lactobacillus crispatus 214-1]
 gi|295030502|emb|CBL49981.1| Membrane protein [Lactobacillus crispatus ST1]
 gi|310894249|gb|EFQ43330.1| putative membrane protein [Lactobacillus crispatus CTV-05]
          Length = 236

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 119/246 (48%), Gaps = 35/246 (14%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
             + +++ ++Y+LM L + V+   +FL     TTV    AS I N             + 
Sbjct: 17  SAVNSFLTKMYSLMILAVLVSAATAFLT----TTV---FASAIANM------------SQ 57

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAK------MMFLLYSALIGLSLSSFFLVYTSK 136
            + WI +F P+       V   ++S  AAK      ++ L+ SA+ G   +     +TS 
Sbjct: 58  AVYWIIVFVPI-------VLCMTISFKAAKNPTLGIVLLLILSAVYGFEFAFIAGAFTSA 110

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLT 195
           SI   F   A  F +++++G  TKRDL   GS++     G  +  LVN  F+RS A    
Sbjct: 111 SIAGAFLSAAGVFAAMAVFGSVTKRDLSNWGSYLGAALIGFLVAWLVNAFFIRSGAATFI 170

Query: 196 MSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF-- 253
            S +G++IF+ LTAYD    K+ +            +V+GAL +Y+DFI IF+ LL+   
Sbjct: 171 FSCIGVLIFTGLTAYDAHNAKKIFMTYGGQVSDTGLAVMGALSMYLDFINIFMFLLQIFG 230

Query: 254 LGSRRD 259
           +G  RD
Sbjct: 231 MGGDRD 236


>gi|296111924|ref|YP_003622306.1| integral membrane protein [Leuconostoc kimchii IMSNU 11154]
 gi|295833456|gb|ADG41337.1| integral membrane protein [Leuconostoc kimchii IMSNU 11154]
          Length = 239

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 112/237 (47%), Gaps = 21/237 (8%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVN--ILATTVDPDAASIIINRGVMLTGFGAL 78
           +D+G+RA+  + Y  M + + VT I  F+V    L   +   A + I    + L G   L
Sbjct: 15  VDEGMRAFFKQTYTFMGIAVLVTAITGFIVQKFFLEQAIALLAGNFI--GALALIGIQML 72

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           + T   R  F               +   A+   M F   + + GL+      +YT  S+
Sbjct: 73  IITMIGRSTF--------------KNPARAFGLLMAF---AVVEGLTFGLLLAIYTGASV 115

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           V  F   +A FG ++LYG  TKRDL  + S +     G+ + S+VN+   S  + L +S 
Sbjct: 116 VMAFVSASAVFGGMALYGVFTKRDLTGMRSILFGALIGIIVASVVNMIFYSGIVSLLLSI 175

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           + +V+F+  TAYD Q +K  YS     A     +V GAL LY+DF+ +F  L+R  G
Sbjct: 176 VSVVVFALYTAYDNQNLKIMYSQFAGQADTTGLAVNGALRLYLDFVNLFFALIRIFG 232


>gi|297243812|ref|ZP_06927742.1| hypothetical membrane protein [Gardnerella vaginalis AMD]
 gi|296888233|gb|EFH26975.1| hypothetical membrane protein [Gardnerella vaginalis AMD]
          Length = 248

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 124/239 (51%), Gaps = 34/239 (14%)

Query: 49  LVNILATTVDPDAASIIINR-------GVMLTGFGALMYTSPLRWI-FIFAPLG------ 94
           +++  AT    +A  + + R       G+++T   AL   S   W+ F+FA  G      
Sbjct: 16  VIDTQATYAFEEAKRVSVGRTYGEMTLGLIVTTLVALFTQSGNFWLRFMFATRGWGWMML 75

Query: 95  ------VFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
                 + + L  RL  +S    +++F  Y+AL G +LSS F V++  S+   F +TA  
Sbjct: 76  AIAQVVIAVVLGTRLMKMSETTVRVLFYAYAALTGFTLSSVFQVFSLGSVALVFALTAGF 135

Query: 149 FGSLSLYGYTTKRDL---GPIGSFMIMGAFGLFLLS--LVNLFMRSSAIDLTMSAMGLVI 203
           F  L++   TTK+DL   GPI    +M A  +F+++  +++   + +     M+ +G+VI
Sbjct: 136 FLCLTMLALTTKKDLLKAGPI----LMVALLVFVVAQIIISFIGQDTGTMRLMAGIGIVI 191

Query: 204 FSALTAYDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           F+ LTAYD Q+ +     Y ++ ++   ++ S+  A  L++DFI +F++LL  LG  RD
Sbjct: 192 FAGLTAYDAQQTRALLAQYENQPEM--VKKVSIFCAFQLFLDFINMFIYLLELLGDNRD 248


>gi|317482471|ref|ZP_07941488.1| hypothetical protein HMPREF0177_00882 [Bifidobacterium sp.
           12_1_47BFAA]
 gi|316916131|gb|EFV37536.1| hypothetical protein HMPREF0177_00882 [Bifidobacterium sp.
           12_1_47BFAA]
          Length = 299

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 98/164 (59%), Gaps = 4/164 (2%)

Query: 97  IFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYG 156
           + L +R+  + +  A++MF +Y+AL+G +LSS F+VY   SI      TAA F +L+++G
Sbjct: 136 VVLGMRVTKMKSATARVMFYVYAALMGFTLSSIFMVYDLGSIGVALGATAAFFFALTMFG 195

Query: 157 YTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIK 216
            TTK ++   G  +++G   L +  +V  F++   +   + A+GL++F+ +  YD Q  +
Sbjct: 196 MTTKFNMLKAGPILMIGLIVLIISQIVLAFVQVDGMTKIVCAIGLILFAGMAIYDAQSTR 255

Query: 217 EAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            A    Y+    E   + S++ AL LY+DF+ +F+++L+ LG+R
Sbjct: 256 -ALLTEYEAQGPEMVKKISILCALNLYLDFVNMFLYILQLLGNR 298


>gi|329667372|gb|AEB93320.1| integral membrane protein [Lactobacillus johnsonii DPC 6026]
          Length = 237

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 119/240 (49%), Gaps = 21/240 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + GL +++ ++Y  MAL + V+ + ++L      T+   A  ++           +LM  
Sbjct: 16  EAGLNSFLSKIYGYMALAVFVSALSAYL------TMTVFARQMV-----------SLMVH 58

Query: 82  SPLR-WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI-GLSLSSFFLVYTSKSIV 139
            P   W+ +  P  + +   +   +     A  + L+ +A+I G++ +     YT + I 
Sbjct: 59  HPWTMWLLLLIP--IVLTFAINFQATRNPVASFILLMVTAIIYGVTFAFIAGTYTGQDIA 116

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
             F  +A  F  +++ G  TK+DL   GS+      GL +  L+N+F++SSA +   S +
Sbjct: 117 SAFVASATVFVVMAILGTVTKKDLSRWGSYASAALIGLIVAMLINMFLKSSAANYIFSFI 176

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++IF+ LTA+D Q++K  Y        A   +V+GAL LY+DF+ +F+  L   GS  +
Sbjct: 177 AVIIFTVLTAWDAQRMKNIYLQFGGEVSANGLAVMGALQLYLDFVNLFLQFLTIFGSNDN 236


>gi|295100005|emb|CBK89094.1| Integral membrane protein, interacts with FtsH [Eubacterium
           cylindroides T2-87]
          Length = 229

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 87/154 (56%), Gaps = 1/154 (0%)

Query: 107 SAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPI 166
           +A   K++F++Y+   G+SL+S F   +   +   F I+A  F  L+  G TTK++L  I
Sbjct: 76  TATGIKVLFMVYAVTFGISLTSLFYTNSQAQLTAAFLISAVYFICLAFIGLTTKKNLNSI 135

Query: 167 GSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKI-KEAYSDRYDV 225
           G   ++G   L +   V L    S     +S +GL++F+ +TA+D Q++ K  Y    DV
Sbjct: 136 GMICVIGLTVLIISQAVMLLFGVSFDTRMISIVGLLLFTGITAWDIQRMNKILYLSNGDV 195

Query: 226 AYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
              E+ ++  AL LY+DF+ IF+++LR LG  RD
Sbjct: 196 VSQEKIAIYMALELYLDFLNIFLYILRLLGYNRD 229


>gi|218281463|ref|ZP_03487906.1| hypothetical protein EUBIFOR_00471 [Eubacterium biforme DSM 3989]
 gi|218217385|gb|EEC90923.1| hypothetical protein EUBIFOR_00471 [Eubacterium biforme DSM 3989]
          Length = 202

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 84/152 (55%), Gaps = 4/152 (2%)

Query: 108 AYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIG 167
           A   K MF++YS  +G++++S   VY++  I   F I+A  F  L++ G TTK DL  +G
Sbjct: 55  ASTMKTMFIVYSLTMGINMTSLAYVYSAGQIAAAFGISAIYFACLAIIGKTTKMDLSKVG 114

Query: 168 SFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAY 227
           +  ++G   +       +  R        S +GL++F+ LTA+D QK+    +   D   
Sbjct: 115 NICLIGLIAMIFSQFFFMLFRVGMDVRLWSVIGLLLFTGLTAWDIQKMNYMLNGYED--- 171

Query: 228 AERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            E+ S+  AL LY+DF+ IF+++LR LG R D
Sbjct: 172 -EKISIYMALQLYLDFLNIFLYILRLLGRRDD 202


>gi|331701577|ref|YP_004398536.1| hypothetical protein Lbuc_1218 [Lactobacillus buchneri NRRL
           B-30929]
 gi|329128920|gb|AEB73473.1| protein of unknown function UPF0005 [Lactobacillus buchneri NRRL
           B-30929]
          Length = 240

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 75/260 (28%), Positives = 127/260 (48%), Gaps = 31/260 (11%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA 61
           ++ +  +RVVN+ +G        L A++ ++Y  M+L + V+   +FLV          +
Sbjct: 6   NEQQEARRVVNNAAG--------LNAFLTKMYGWMSLAVLVSAATAFLV----------S 47

Query: 62  ASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLS-AYAAKMMFLLYSA 120
            S+       + G   +M+ S + W        V  F+ + L +L     A  + +LYS 
Sbjct: 48  GSVAGGMAAYIAGHQGVMWGSMILWF-------VLPFV-ISLQALKRPTLAFTVLMLYSI 99

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L G   ++    YT  SI   F   +A F +++  G  T ++L   G+        L + 
Sbjct: 100 LSGFVFATIAWAYTGASIAAAFVSASAIFITMTTVGLVTHKNLDRWGAQATAALIALIIA 159

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKE---AYSDRYDVAYAERQSVIGAL 237
            ++N+F+RSS I    S + ++IF+ LTAYDTQK+K+    YS   DV+     +V GAL
Sbjct: 160 MIINIFLRSSVISFVFSIIAVLIFTVLTAYDTQKMKQMYNQYSGNGDVSMTGL-AVFGAL 218

Query: 238 MLYMDFIQIFVHLLRFLGSR 257
            LY+DF+ +F+ LL   G+ 
Sbjct: 219 QLYLDFVNLFLQLLSIFGNN 238


>gi|15903829|ref|NP_359379.1| hypothetical protein spr1787 [Streptococcus pneumoniae R6]
 gi|116516865|ref|YP_817192.1| hypothetical protein SPD_1769 [Streptococcus pneumoniae D39]
 gi|182684907|ref|YP_001836654.1| membrane protein [Streptococcus pneumoniae CGSP14]
 gi|15459471|gb|AAL00590.1| Conserved hypothetical protein [Streptococcus pneumoniae R6]
 gi|116077441|gb|ABJ55161.1| membrane protein, putative [Streptococcus pneumoniae D39]
 gi|182630241|gb|ACB91189.1| membrane protein [Streptococcus pneumoniae CGSP14]
          Length = 235

 Score = 86.3 bits (212), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 123/241 (51%), Gaps = 29/241 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  +  +VY  + LG+G++ ++S                     G+MLT F + +    
Sbjct: 19  GLNQFYAKVYAFVGLGIGLSALVS---------------------GLMLTVFQSQLVYLL 57

Query: 84  LR---WIFI--FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           ++   W+ I  FA L + +F+   + S ++ AA  +FLLYS L G +LS     YT  ++
Sbjct: 58  MQGRLWLTIATFAELAL-VFVASSMASRNSPAALPVFLLYSVLNGFTLSFVVAFYTPGTV 116

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  ++  G  TK+DL  IG  M+    GL +  +VN+F+ S   D  +S 
Sbjct: 117 LSAFVSSALLFFVMAAVGIFTKKDLSGIGRAMMAALIGLLIAMVVNIFLASGFFDYMISV 176

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             +++FS L A+D QKI+ AY ++     A    V  AL +Y+DFI +F+ +LR  G R 
Sbjct: 177 AMVLVFSGLIAWDNQKIRLAY-EQSQGRVATGWVVSMALSIYLDFINLFLSILRIFG-RN 234

Query: 259 D 259
           D
Sbjct: 235 D 235


>gi|148985552|ref|ZP_01818741.1| hypothetical protein CGSSp3BS71_11288 [Streptococcus pneumoniae
           SP3-BS71]
 gi|148989972|ref|ZP_01821247.1| hypothetical protein CGSSp6BS73_03941 [Streptococcus pneumoniae
           SP6-BS73]
 gi|148998502|ref|ZP_01825943.1| hypothetical protein CGSSp11BS70_11371 [Streptococcus pneumoniae
           SP11-BS70]
 gi|149003631|ref|ZP_01828496.1| hypothetical protein CGSSp14BS69_13373 [Streptococcus pneumoniae
           SP14-BS69]
 gi|149021922|ref|ZP_01835909.1| hypothetical protein CGSSp23BS72_00990 [Streptococcus pneumoniae
           SP23-BS72]
 gi|168484271|ref|ZP_02709223.1| membrane protein [Streptococcus pneumoniae CDC1873-00]
 gi|168492053|ref|ZP_02716196.1| membrane protein [Streptococcus pneumoniae CDC0288-04]
 gi|168576628|ref|ZP_02722494.1| membrane protein [Streptococcus pneumoniae MLV-016]
 gi|169832783|ref|YP_001695326.1| membrane protein [Streptococcus pneumoniae Hungary19A-6]
 gi|194398187|ref|YP_002038554.1| hypothetical protein SPG_1873 [Streptococcus pneumoniae G54]
 gi|225857546|ref|YP_002739057.1| membrane protein [Streptococcus pneumoniae P1031]
 gi|225859728|ref|YP_002741238.1| membrane protein [Streptococcus pneumoniae 70585]
 gi|225861790|ref|YP_002743299.1| membrane protein [Streptococcus pneumoniae Taiwan19F-14]
 gi|237650990|ref|ZP_04525242.1| membrane protein [Streptococcus pneumoniae CCRI 1974]
 gi|237821624|ref|ZP_04597469.1| membrane protein [Streptococcus pneumoniae CCRI 1974M2]
 gi|307068581|ref|YP_003877547.1| integral membrane protein [Streptococcus pneumoniae AP200]
 gi|307128171|ref|YP_003880202.1| membrane protein [Streptococcus pneumoniae 670-6B]
 gi|147755695|gb|EDK62741.1| hypothetical protein CGSSp11BS70_11371 [Streptococcus pneumoniae
           SP11-BS70]
 gi|147758363|gb|EDK65363.1| hypothetical protein CGSSp14BS69_13373 [Streptococcus pneumoniae
           SP14-BS69]
 gi|147922272|gb|EDK73393.1| hypothetical protein CGSSp3BS71_11288 [Streptococcus pneumoniae
           SP3-BS71]
 gi|147924632|gb|EDK75718.1| hypothetical protein CGSSp6BS73_03941 [Streptococcus pneumoniae
           SP6-BS73]
 gi|147929960|gb|EDK80948.1| hypothetical protein CGSSp23BS72_00990 [Streptococcus pneumoniae
           SP23-BS72]
 gi|168995285|gb|ACA35897.1| membrane protein [Streptococcus pneumoniae Hungary19A-6]
 gi|172042514|gb|EDT50560.1| membrane protein [Streptococcus pneumoniae CDC1873-00]
 gi|183573696|gb|EDT94224.1| membrane protein [Streptococcus pneumoniae CDC0288-04]
 gi|183577606|gb|EDT98134.1| membrane protein [Streptococcus pneumoniae MLV-016]
 gi|194357854|gb|ACF56302.1| conserved hypothetical protein [Streptococcus pneumoniae G54]
 gi|225720722|gb|ACO16576.1| membrane protein [Streptococcus pneumoniae 70585]
 gi|225724323|gb|ACO20175.1| membrane protein [Streptococcus pneumoniae P1031]
 gi|225727985|gb|ACO23836.1| membrane protein [Streptococcus pneumoniae Taiwan19F-14]
 gi|301794915|emb|CBW37376.1| putative membrane protein [Streptococcus pneumoniae INV104]
 gi|301800734|emb|CBW33382.1| putative membrane protein [Streptococcus pneumoniae OXC141]
 gi|301802650|emb|CBW35416.1| putative membrane protein [Streptococcus pneumoniae INV200]
 gi|306410118|gb|ADM85545.1| Integral membrane protein, interacts with FtsH [Streptococcus
           pneumoniae AP200]
 gi|306485233|gb|ADM92102.1| membrane protein [Streptococcus pneumoniae 670-6B]
 gi|327389137|gb|EGE87483.1| hypothetical protein SPAR5_1861 [Streptococcus pneumoniae GA04375]
 gi|332071950|gb|EGI82438.1| hypothetical protein SPAR148_1893 [Streptococcus pneumoniae
           GA17545]
 gi|332072158|gb|EGI82644.1| hypothetical protein SPAR68_2050 [Streptococcus pneumoniae GA41301]
 gi|332199287|gb|EGJ13365.1| hypothetical protein SPAR69_1923 [Streptococcus pneumoniae GA41317]
 gi|332199398|gb|EGJ13475.1| hypothetical protein SPAR93_2042 [Streptococcus pneumoniae GA47368]
 gi|332199984|gb|EGJ14058.1| hypothetical protein SPAR120_1906 [Streptococcus pneumoniae
           GA47901]
          Length = 227

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 123/241 (51%), Gaps = 29/241 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  +  +VY  + LG+G++ ++S                     G+MLT F + +    
Sbjct: 11  GLNQFYAKVYAFVGLGIGLSALVS---------------------GLMLTVFQSQLVYLL 49

Query: 84  LR---WIFI--FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           ++   W+ I  FA L + +F+   + S ++ AA  +FLLYS L G +LS     YT  ++
Sbjct: 50  MQGRLWLTIATFAELAL-VFVASSMASRNSPAALPVFLLYSVLNGFTLSFVVAFYTPGTV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  ++  G  TK+DL  IG  M+    GL +  +VN+F+ S   D  +S 
Sbjct: 109 LSAFVSSALLFFVMAAVGIFTKKDLSGIGRAMMAALIGLLIAMVVNIFLASGFFDYMISV 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             +++FS L A+D QKI+ AY ++     A    V  AL +Y+DFI +F+ +LR  G R 
Sbjct: 169 AMVLVFSGLIAWDNQKIRLAY-EQSQGRVATGWVVSMALSIYLDFINLFLSILRIFG-RN 226

Query: 259 D 259
           D
Sbjct: 227 D 227


>gi|298503743|ref|YP_003725683.1| membrane protein [Streptococcus pneumoniae TCH8431/19A]
 gi|298239338|gb|ADI70469.1| membrane protein [Streptococcus pneumoniae TCH8431/19A]
          Length = 235

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 123/241 (51%), Gaps = 29/241 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  +  +VY  + LG+G++ ++S                     G+MLT F + +    
Sbjct: 19  GLNQFYAKVYAFVGLGIGLSALVS---------------------GLMLTVFQSQLVYFL 57

Query: 84  LR---WIFI--FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           ++   W+ I  FA L + +F+   + S ++ AA  +FLLYS L G +LS     YT  ++
Sbjct: 58  MQGRLWLTIATFAELAL-VFVASSMASRNSPAALPVFLLYSVLNGFTLSFVVAFYTPGTV 116

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  ++  G  TK+DL  IG  M+    GL +  +VN+F+ S   D  +S 
Sbjct: 117 LSAFVSSALLFFVMAAVGIFTKKDLSGIGRAMMAALIGLLIAMVVNIFLASGFFDYMISV 176

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             +++FS L A+D QKI+ AY ++     A    V  AL +Y+DFI +F+ +LR  G R 
Sbjct: 177 AMVLVFSGLIAWDNQKIRLAY-EQSQGRVATGWVVSMALSIYLDFINLFLSILRIFG-RN 234

Query: 259 D 259
           D
Sbjct: 235 D 235


>gi|148993167|ref|ZP_01822733.1| hypothetical protein CGSSp9BS68_09631 [Streptococcus pneumoniae
           SP9-BS68]
 gi|168489977|ref|ZP_02714176.1| membrane protein [Streptococcus pneumoniae SP195]
 gi|168494787|ref|ZP_02718930.1| membrane protein [Streptococcus pneumoniae CDC3059-06]
 gi|183603346|ref|ZP_02711618.2| membrane protein [Streptococcus pneumoniae CDC1087-00]
 gi|221232697|ref|YP_002511851.1| hypothetical protein SPN23F_19930 [Streptococcus pneumoniae ATCC
           700669]
 gi|225855463|ref|YP_002736975.1| membrane protein [Streptococcus pneumoniae JJA]
 gi|298230169|ref|ZP_06963850.1| membrane protein [Streptococcus pneumoniae str. Canada MDR_19F]
 gi|298254775|ref|ZP_06978361.1| membrane protein [Streptococcus pneumoniae str. Canada MDR_19A]
 gi|303254104|ref|ZP_07340219.1| hypothetical protein CGSSpBS455_01420 [Streptococcus pneumoniae
           BS455]
 gi|303260345|ref|ZP_07346315.1| membrane protein [Streptococcus pneumoniae SP-BS293]
 gi|303262493|ref|ZP_07348435.1| membrane protein [Streptococcus pneumoniae SP14-BS292]
 gi|303265124|ref|ZP_07351037.1| membrane protein [Streptococcus pneumoniae BS397]
 gi|303266014|ref|ZP_07351909.1| membrane protein [Streptococcus pneumoniae BS457]
 gi|303268054|ref|ZP_07353855.1| membrane protein [Streptococcus pneumoniae BS458]
 gi|147928141|gb|EDK79159.1| hypothetical protein CGSSp9BS68_09631 [Streptococcus pneumoniae
           SP9-BS68]
 gi|183569956|gb|EDT90484.1| membrane protein [Streptococcus pneumoniae CDC1087-00]
 gi|183571619|gb|EDT92147.1| membrane protein [Streptococcus pneumoniae SP195]
 gi|183575328|gb|EDT95856.1| membrane protein [Streptococcus pneumoniae CDC3059-06]
 gi|220675159|emb|CAR69743.1| putative membrane protein [Streptococcus pneumoniae ATCC 700669]
 gi|225722781|gb|ACO18634.1| membrane protein [Streptococcus pneumoniae JJA]
 gi|302598937|gb|EFL65968.1| hypothetical protein CGSSpBS455_01420 [Streptococcus pneumoniae
           BS455]
 gi|302636393|gb|EFL66886.1| membrane protein [Streptococcus pneumoniae SP14-BS292]
 gi|302638511|gb|EFL68976.1| membrane protein [Streptococcus pneumoniae SP-BS293]
 gi|302642414|gb|EFL72760.1| membrane protein [Streptococcus pneumoniae BS458]
 gi|302644455|gb|EFL74707.1| membrane protein [Streptococcus pneumoniae BS457]
 gi|302645341|gb|EFL75575.1| membrane protein [Streptococcus pneumoniae BS397]
          Length = 227

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 123/241 (51%), Gaps = 29/241 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  +  +VY  + LG+G++ ++S                     G+MLT F + +    
Sbjct: 11  GLNQFYAKVYAFVGLGIGLSALVS---------------------GLMLTVFQSQLVYFL 49

Query: 84  LR---WIFI--FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           ++   W+ I  FA L + +F+   + S ++ AA  +FLLYS L G +LS     YT  ++
Sbjct: 50  MQGRLWLTIATFAELAL-VFVASSMASRNSPAALPVFLLYSVLNGFTLSFVVAFYTPGTV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  ++  G  TK+DL  IG  M+    GL +  +VN+F+ S   D  +S 
Sbjct: 109 LSAFVSSALLFFVMAAVGIFTKKDLSGIGRAMMAALIGLLIAMVVNIFLASGFFDYMISV 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             +++FS L A+D QKI+ AY ++     A    V  AL +Y+DFI +F+ +LR  G R 
Sbjct: 169 AMVLVFSGLIAWDNQKIRLAY-EQSQGRVATGWVVSMALSIYLDFINLFLSILRIFG-RN 226

Query: 259 D 259
           D
Sbjct: 227 D 227


>gi|15901795|ref|NP_346399.1| hypothetical protein SP_1972 [Streptococcus pneumoniae TIGR4]
 gi|111658859|ref|ZP_01409480.1| hypothetical protein SpneT_02000030 [Streptococcus pneumoniae
           TIGR4]
 gi|14973479|gb|AAK76039.1| membrane protein [Streptococcus pneumoniae TIGR4]
          Length = 235

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 123/241 (51%), Gaps = 29/241 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  +  +VY  + LG+G++ ++S                     G+MLT F + +    
Sbjct: 19  GLNQFYAKVYAFVGLGIGLSALVS---------------------GLMLTVFQSQLVYLL 57

Query: 84  LR---WIFI--FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           ++   W+ I  FA L + +F+   + S ++ AA  +FLLYS L G +LS     YT  ++
Sbjct: 58  MQGRLWLTIATFAELAL-VFVASSMASRNSPAALPVFLLYSVLNGFTLSFVVAFYTPGTV 116

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  ++  G  TK+DL  IG  M+    GL +  +VN+F+ S   D  +S 
Sbjct: 117 LSAFVSSALLFFVMAAVGIFTKKDLSGIGRAMMAALIGLLIAMVVNIFLASGFFDYMISV 176

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             +++FS L A+D QKI+ AY ++     A    V  AL +Y+DFI +F+ +LR  G R 
Sbjct: 177 AMVLVFSGLIAWDNQKIRLAY-EQSQGRVATGWVVSMALSIYLDFINLFLSILRIFG-RN 234

Query: 259 D 259
           D
Sbjct: 235 D 235


>gi|229817421|ref|ZP_04447703.1| hypothetical protein BIFANG_02683 [Bifidobacterium angulatum DSM
           20098]
 gi|229785210|gb|EEP21324.1| hypothetical protein BIFANG_02683 [Bifidobacterium angulatum DSM
           20098]
          Length = 287

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 100/179 (55%), Gaps = 7/179 (3%)

Query: 87  IFIFAPLGVFIFLNV----RLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
           I +FAPL + I L +    R+  +    A++MF +Y+AL+G SLS  F VY   +I    
Sbjct: 109 IGVFAPLVIEIVLAIALGARITKMKTSTARVMFYIYAALMGFSLSVIFAVYDLGTIGIAL 168

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS-LVNLFMRSSAIDLTMSAMGL 201
            + A  F +L++ G TTK DL   G  + +G   L +   L+ +F       + +SA+GL
Sbjct: 169 ALCAGFFFALTMLGMTTKVDLLKAGPILGVGLIVLIIAEVLLMIFAPGQTTLMLVSAIGL 228

Query: 202 VIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++F+  T YD Q+ +  ++     D    ++ S++ AL LY+DF+ +F+++L+ LG+R 
Sbjct: 229 ILFAGFTVYDAQQTRAIFAQYSGQDPEIIKKISILCALNLYLDFVNMFLYILQLLGNRE 287


>gi|42519089|ref|NP_965019.1| hypothetical protein LJ1163 [Lactobacillus johnsonii NCC 533]
 gi|41583376|gb|AAS08985.1| hypothetical protein LJ_1163 [Lactobacillus johnsonii NCC 533]
          Length = 238

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 119/240 (49%), Gaps = 21/240 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + GL +++ ++Y  MAL + V+ + ++L      T+   A+ ++           +LM  
Sbjct: 16  ESGLNSFLSKIYGYMALAVFVSALSAYL------TMTVFASQMV-----------SLMVH 58

Query: 82  SPLR-WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI-GLSLSSFFLVYTSKSIV 139
            P   W+ +  P  + +   +   +     A  + L+ +A++ G++ +     YT + I 
Sbjct: 59  HPWTMWLLLLIP--IVLTFAINFQATRNPVASFILLMITAIVYGVTFAFIAGTYTGQDIA 116

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
             F  +A  F  +++ G  TK+DL   GS+      GL +  L+N+F++SSA +   S +
Sbjct: 117 SAFIASATVFVVMAILGTVTKKDLSRWGSYASAALIGLIVAMLINMFLKSSAANYIFSFI 176

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++IF+ LTA+D Q++K  Y            +++GAL LY+DF+ +F+  L   GS  +
Sbjct: 177 AVIIFTVLTAWDAQRMKNIYLQFGGELPTNGLAIVGALQLYLDFVNLFLQFLTIFGSNDN 236


>gi|323694831|ref|ZP_08108986.1| hypothetical protein HMPREF9475_03850 [Clostridium symbiosum
           WAL-14673]
 gi|323501147|gb|EGB17054.1| hypothetical protein HMPREF9475_03850 [Clostridium symbiosum
           WAL-14673]
          Length = 236

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 105/187 (56%), Gaps = 16/187 (8%)

Query: 87  IFIFA-PLGVFI----------FLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTS 135
           +F+FA P G+ +          +++ R++ +S  AA+ +FL Y+AL G+  S++FLV+  
Sbjct: 52  LFVFAIPYGLIVISGLELLTVFWMSARVNKMSVGAARGIFLFYAALNGIVFSAYFLVFGV 111

Query: 136 KSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLT 195
             ++  F  T+  FG ++      K D+  I   ++ G   L +  ++++F+   A++  
Sbjct: 112 VQLLLVFVATSLFFGIMAGVSLIFKIDISGIRPILVGGLIFLIIFGILSMFLNLGAMETV 171

Query: 196 MSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           M  +G+ +F   TAYDT KI++ Y   ++  +V   E+ S+  AL LY+DFI +F+++LR
Sbjct: 172 MCYVGIAVFLGFTAYDTGKIRQNYVHFAENQEV--LEKASIFSALSLYLDFINLFLYILR 229

Query: 253 FLGSRRD 259
            L   R+
Sbjct: 230 LLNRSRN 236


>gi|227432301|ref|ZP_03914294.1| integral membrane protein, interacts with FtsH [Leuconostoc
           mesenteroides subsp. cremoris ATCC 19254]
 gi|227351907|gb|EEJ42140.1| integral membrane protein, interacts with FtsH [Leuconostoc
           mesenteroides subsp. cremoris ATCC 19254]
          Length = 239

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 115/236 (48%), Gaps = 19/236 (8%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLV-NILATTVDPDAASIIINRGVMLTGFGALM 79
           +D+G+RA+  + Y+ M + + +T +  F+V N     V    A +++     + G  AL+
Sbjct: 15  VDEGMRAFFKQTYSFMGIAVLLTAVTGFIVQNFFLEQV----AKLLVGN---VIGLLALL 67

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIV 139
               L    I   +G   F N       A+   M F   + + GL+L     VYT  S++
Sbjct: 68  GIQML----IMTMIGRATFKN----PARAFGLLMAF---AVVEGLTLGVLLAVYTGASVM 116

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
             F   +A FG ++ YG  TKRDL  +GS +     GL + S+ N+F  S  + L +S  
Sbjct: 117 MAFVSASAVFGGMAAYGVFTKRDLTGLGSILFGLLIGLLIASIANMFFYSGIVSLLLSWA 176

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
            +V+FS  TAYD Q +K  YS           +V GAL LY+DF+ IF  LLR  G
Sbjct: 177 SVVVFSLFTAYDNQNLKVMYSQFAGQVDTTGLAVNGALRLYLDFVNIFFALLRIFG 232


>gi|326692716|ref|ZP_08229721.1| integral membrane protein [Leuconostoc argentinum KCTC 3773]
          Length = 238

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 117/245 (47%), Gaps = 23/245 (9%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVN--ILATTVDPDAASIIINRGVMLTGFG 76
           + +D G+RA+  + Y+ M + + VT    F+V    LA      A ++I      L  FG
Sbjct: 13  TGMDAGMRAFFKQTYSFMGIAVLVTAFTGFIVQKFFLAQVYALIAGNLIGT----LALFG 68

Query: 77  ALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK 136
                     I I   +G   F N       A+   M F   + + GL+L     VYT  
Sbjct: 69  I--------QILIMTMIGRSTFKN----PARAFGLLMAF---AVIEGLTLGLLLAVYTGA 113

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTM 196
           S++  F   A+ FG ++LYG  TKRDL  +GS +     GL + SL+NLF  +  + L +
Sbjct: 114 SVMMAFASAASVFGGMALYGVFTKRDLTGMGSILFGMLIGLIIASLINLFFYNGIVSLLI 173

Query: 197 SAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF--L 254
           S + ++IF+  TAYD Q +K  Y            +V GAL LY+DFI +F   ++   +
Sbjct: 174 SGVTVIIFALYTAYDNQNLKMMYGQYAGQVDTTGLAVNGALRLYLDFINLFFAFIQLFGI 233

Query: 255 GSRRD 259
           G+ RD
Sbjct: 234 GNSRD 238


>gi|256843325|ref|ZP_05548813.1| LOW QUALITY PROTEIN: integral membrane protein [Lactobacillus
           crispatus 125-2-CHN]
 gi|256849929|ref|ZP_05555360.1| LOW QUALITY PROTEIN: integral membrane protein [Lactobacillus
           crispatus MV-1A-US]
 gi|256614745|gb|EEU19946.1| LOW QUALITY PROTEIN: integral membrane protein [Lactobacillus
           crispatus 125-2-CHN]
 gi|256713418|gb|EEU28408.1| LOW QUALITY PROTEIN: integral membrane protein [Lactobacillus
           crispatus MV-1A-US]
          Length = 161

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 72/127 (56%)

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           Y+ ++I   F  +A  F ++++ G  TK+DL  IGS+      GL +  L NLF+ +  I
Sbjct: 34  YSGQNIASAFVASATVFVTMAILGTITKKDLSRIGSYASAALIGLIVAMLANLFLHNPII 93

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           D   S + ++IF+ LTA+D Q++K+ Y    D       +V+GAL LY+DF+ +F+  L 
Sbjct: 94  DYVFSIIAVIIFTILTAWDAQRMKDIYLQYGDDLSTNGLAVLGALQLYLDFVNLFLQFLD 153

Query: 253 FLGSRRD 259
             G+  D
Sbjct: 154 IFGANED 160


>gi|212715614|ref|ZP_03323742.1| hypothetical protein BIFCAT_00513 [Bifidobacterium catenulatum DSM
           16992]
 gi|212660981|gb|EEB21556.1| hypothetical protein BIFCAT_00513 [Bifidobacterium catenulatum DSM
           16992]
          Length = 291

 Score = 85.5 bits (210), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 128/244 (52%), Gaps = 30/244 (12%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           +Q  R+ +   Y  M LGL VT +++ +                     M   + AL+ T
Sbjct: 69  EQAERSSVNSAYTHMTLGLIVTAVVAIITQ-------------------MSGAYLALIQT 109

Query: 82  SPLRWIFIFAP----LGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           + +  I IFAP    + + I+L  R+H +    A +MF +Y+AL+G +LS+ F+ Y   +
Sbjct: 110 TGI--IGIFAPAIIEIVLAIYLGARIHKMKVSTAYVMFYVYAALMGFTLSTIFMAYDLGT 167

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL-FLLSLVNLFMRSSAIDLTM 196
           I  +  + A  F +L++ G TTK ++   G  + +G   L F   ++ +F   +   + +
Sbjct: 168 IGISLALCAGFFFALTMLGRTTKINMLKAGPILFVGLIMLIFAEVILMIFAPGNTTLMIV 227

Query: 197 SAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRF 253
           SA+GL++F+ +T YD Q  + A  ++Y     E   + S++ AL LY+DF+ +F+++L+ 
Sbjct: 228 SAIGLLLFAGMTVYDAQATR-AMLEQYSAQGPEMIKKVSILCALNLYLDFVNMFMYILQL 286

Query: 254 LGSR 257
           LG+R
Sbjct: 287 LGNR 290


>gi|149007447|ref|ZP_01831090.1| hypothetical protein CGSSp18BS74_06527 [Streptococcus pneumoniae
           SP18-BS74]
 gi|147761019|gb|EDK67988.1| hypothetical protein CGSSp18BS74_06527 [Streptococcus pneumoniae
           SP18-BS74]
          Length = 227

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 122/241 (50%), Gaps = 29/241 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  +  +VY  + LG+G++ ++S                     G+MLT F + +    
Sbjct: 11  GLNQFYAKVYAFVGLGIGLSALVS---------------------GLMLTVFQSQLVYLL 49

Query: 84  LR---WIFI--FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           ++   W+ I  FA L + +F+   + S ++ AA  +FLLYS L G +LS     YT  ++
Sbjct: 50  MQGRLWLTIATFAELAL-VFVASSMASRNSPAALPVFLLYSVLNGFTLSFVVAFYTPGTV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  +   G  TK+DL  IG  M+    GL +  +VN+F+ S   D  +S 
Sbjct: 109 LSAFVSSALLFFVMVAVGIFTKKDLSGIGRAMMAALIGLLIAMVVNIFLASGFFDYMISV 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             +++FS L A+D QKI+ AY ++     A    V  AL +Y+DFI +F+ +LR  G R 
Sbjct: 169 AMVLVFSGLIAWDNQKIRLAY-EQSQGRVATGWVVSMALSIYLDFINLFLSILRIFG-RN 226

Query: 259 D 259
           D
Sbjct: 227 D 227


>gi|283768570|ref|ZP_06341482.1| putative membrane protein [Bulleidia extructa W1219]
 gi|283104962|gb|EFC06334.1| putative membrane protein [Bulleidia extructa W1219]
          Length = 238

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 128/260 (49%), Gaps = 23/260 (8%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MS+ RN   V        S  +  +++YM +VY  MAL L +T  ++++           
Sbjct: 1   MSEFRNDSYV-------SSRPEVLVKSYMTKVYGFMALALFLTAAVAYM------GYQSL 47

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            +   I R ++ + FG         WI     LG+   L+  +    A+   +M ++YS 
Sbjct: 48  LSGGFIYR-LLRSEFGF--------WILFLIQLGLAFGLSAGISRFPAWMNGLMMVVYSV 98

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           + G++ S   +++   +I Q F  +A  F SL++ G  T  DL  I   +I G   L ++
Sbjct: 99  VTGITFSVLPVLFEMYTIYQAFIYSAVLFSSLAMVGTFTSFDLSKISGILIGGLVALVII 158

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            L+ +++ S   ++ +S  GLVIF  LTA+D Q++K+    + +       ++ GA  LY
Sbjct: 159 HLIAIWVPSLHQNMWVSYAGLVIFMGLTAWDAQRLKKYALIQEEGNKQLNLAIYGAFELY 218

Query: 241 MDFIQIFVHLLRFL-GSRRD 259
           +DFI +F++LLR L G RR 
Sbjct: 219 LDFINMFIYLLRILSGGRRK 238


>gi|77405815|ref|ZP_00782899.1| membrane protein [Streptococcus agalactiae H36B]
 gi|77175602|gb|EAO78387.1| membrane protein [Streptococcus agalactiae H36B]
          Length = 188

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 91/150 (60%), Gaps = 2/150 (1%)

Query: 110 AAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSF 169
           AA  +FL+YSAL G +LS     YT  +++Q F  +AA F +++L G  TK+DL  +   
Sbjct: 41  AALPLFLIYSALNGFTLSFIIARYTQTTVLQAFITSAAVFFAMALIGAKTKKDLSGMRKA 100

Query: 170 MIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE 229
           ++    G+ + SLVNLF+ S  +   +S + ++IFS L AYD Q IK  Y+ +     A+
Sbjct: 101 LMAALIGILIASLVNLFIGSGGMSYIISIVYVIIFSGLIAYDNQMIKYVYNSQGG-QVAD 159

Query: 230 RQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
             +V  AL LY+DFI +F+++LR L +R D
Sbjct: 160 GWAVSMALSLYLDFINLFLNILR-LFARND 188


>gi|116629636|ref|YP_814808.1| integral membrane protein, interacts with FtsH [Lactobacillus
           gasseri ATCC 33323]
 gi|116095218|gb|ABJ60370.1| Integral membrane protein, interacts with FtsH [Lactobacillus
           gasseri ATCC 33323]
          Length = 244

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 71/127 (55%)

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT + I   F  +A+ F  +++ G  TKRDL  IGS+      GL +  L+NLF+++  I
Sbjct: 117 YTGEDIASAFIASASVFIVMAILGTVTKRDLSRIGSYASAALIGLIVAMLINLFLKNPTI 176

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           D   S + ++IF+ LTA+D Q+IK  Y            +V+GAL LY+DF+ +F+  L 
Sbjct: 177 DYIFSFIAVIIFTILTAWDAQRIKNIYLQFGGELSTNGLAVLGALQLYLDFVNLFLQFLD 236

Query: 253 FLGSRRD 259
             GS  +
Sbjct: 237 IFGSNDN 243


>gi|322377612|ref|ZP_08052102.1| membrane protein [Streptococcus sp. M334]
 gi|321281377|gb|EFX58387.1| membrane protein [Streptococcus sp. M334]
          Length = 227

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 123/241 (51%), Gaps = 29/241 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  +  +VY  + LG+G++ ++S                     G+MLT F + +    
Sbjct: 11  GLNQFYAKVYAFVGLGIGLSALVS---------------------GLMLTVFQSQLVYFL 49

Query: 84  LR---WIFI--FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           ++   W+ I  FA L + +F+   + S ++ AA  +FLLYS L G +LS     YT  ++
Sbjct: 50  MQGRLWLTIATFAELAL-VFVASSMASKNSPAALPVFLLYSVLNGFTLSFVVAFYTPGTV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  ++  G  TK+DL  IG  M+    GL +  +VN+F+ S   D  +S 
Sbjct: 109 LSAFVSSALLFFVMAAVGMFTKKDLSGIGRAMMAALIGLLIAMVVNIFLASGFFDYMISV 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             +++FS L A+D Q+I+ AY ++     A    V  AL +Y+DFI +F+ +LR  G R 
Sbjct: 169 AMVLVFSGLIAWDNQRIRLAY-EQSQGRVATGWVVSMALSIYLDFINLFLSILRIFG-RN 226

Query: 259 D 259
           D
Sbjct: 227 D 227


>gi|311110721|ref|ZP_07712118.1| integral membrane protein [Lactobacillus gasseri MV-22]
 gi|311065875|gb|EFQ46215.1| integral membrane protein [Lactobacillus gasseri MV-22]
          Length = 244

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 71/127 (55%)

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT + I   F  +A+ F  +++ G  TKRDL  IGS+      GL +  L+NLF+++  I
Sbjct: 117 YTGEDIASAFIASASVFIVMAILGTVTKRDLSRIGSYASAALIGLIVAMLINLFLKNPTI 176

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           D   S + ++IF+ LTA+D Q+IK  Y            +V+GAL LY+DF+ +F+  L 
Sbjct: 177 DYIFSFIAVIIFTILTAWDAQRIKNIYLQFGGELSTNGLAVLGALQLYLDFVNLFLQFLD 236

Query: 253 FLGSRRD 259
             GS  +
Sbjct: 237 IFGSNDN 243


>gi|149012439|ref|ZP_01833470.1| OxaA-like protein precursor [Streptococcus pneumoniae SP19-BS75]
 gi|147763495|gb|EDK70431.1| OxaA-like protein precursor [Streptococcus pneumoniae SP19-BS75]
          Length = 227

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 123/241 (51%), Gaps = 29/241 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  +  +VY  + LG+G++ ++S                     G+MLT F + +    
Sbjct: 11  GLNQFYAKVYAFVGLGIGLSALVS---------------------GLMLTVFQSQLVYFL 49

Query: 84  LR---WIFI--FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           ++   W+ I  FA L + +F+   + S ++ +A  +FLLYS L G +LS     YT  ++
Sbjct: 50  MQGRLWLTIATFAELAL-VFVASSMASRNSPSALPVFLLYSVLNGFTLSFVVAFYTPGTV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  ++  G  TK+DL  IG  M+    GL +  +VN+F+ S   D  +S 
Sbjct: 109 LSAFVSSALLFFVMAAVGIFTKKDLSGIGRAMMAALIGLLIAMVVNIFLASGFFDYMISV 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             +++FS L A+D QKI+ AY ++     A    V  AL +Y+DFI +F+ +LR  G R 
Sbjct: 169 AMVLVFSGLIAWDNQKIRLAY-EQSQGRVATGWVVSMALSIYLDFINLFLSILRIFG-RN 226

Query: 259 D 259
           D
Sbjct: 227 D 227


>gi|315640779|ref|ZP_07895881.1| membrane protein [Enterococcus italicus DSM 15952]
 gi|315483534|gb|EFU74028.1| membrane protein [Enterococcus italicus DSM 15952]
          Length = 225

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 85/141 (60%), Gaps = 7/141 (4%)

Query: 115 FLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGA 174
           F++Y+ L G +LS   ++Y+  SI   F     +F  +SLYG  TKRDL  +G   I   
Sbjct: 84  FIVYALLNGFTLSVTLMLYSQASIALAFATATLTFIGMSLYGMFTKRDLSRVGQLAIGLL 143

Query: 175 FGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVI 234
           +G+ + +L+N F+ SSA++  +S + ++IF  LTAYD Q+I++ Y+     +  + Q+ +
Sbjct: 144 WGVIIATLLNFFLASSAVNYFLSYVTVLIFIGLTAYDNQQIRKLYA----ASQGQNQTGL 199

Query: 235 GALM---LYMDFIQIFVHLLR 252
            A M   LY+DFI +F+ LLR
Sbjct: 200 AAFMALQLYLDFINLFLALLR 220


>gi|282851162|ref|ZP_06260529.1| putative membrane protein [Lactobacillus gasseri 224-1]
 gi|282557694|gb|EFB63289.1| putative membrane protein [Lactobacillus gasseri 224-1]
          Length = 237

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 71/127 (55%)

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT + I   F  +A+ F  +++ G  TKRDL  IGS+      GL +  L+NLF+++  I
Sbjct: 110 YTGEDIASAFIASASVFIVMAILGTVTKRDLSRIGSYASAALIGLIVAMLINLFLKNPTI 169

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           D   S + ++IF+ LTA+D Q+IK  Y            +V+GAL LY+DF+ +F+  L 
Sbjct: 170 DYIFSFIAVIIFTILTAWDAQRIKNIYLQFGGELSTNGLAVLGALQLYLDFVNLFLQFLD 229

Query: 253 FLGSRRD 259
             GS  +
Sbjct: 230 IFGSNDN 236


>gi|119026053|ref|YP_909898.1| hypothetical protein BAD_1035 [Bifidobacterium adolescentis ATCC
           15703]
 gi|154488822|ref|ZP_02029671.1| hypothetical protein BIFADO_02130 [Bifidobacterium adolescentis
           L2-32]
 gi|118765637|dbj|BAF39816.1| hypothetical protein [Bifidobacterium adolescentis ATCC 15703]
 gi|154082959|gb|EDN82004.1| hypothetical protein BIFADO_02130 [Bifidobacterium adolescentis
           L2-32]
          Length = 293

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 122/239 (51%), Gaps = 20/239 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           ++   A + R Y  M +GL VT  ++ L       +     ++I + GV+    GA    
Sbjct: 71  ERAEHASVTRAYGEMTIGLLVTAAVAILTQATGAYI-----ALIQSLGVI----GA---- 117

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
               W      + + I+L  R+  +    A++MF +Y+A++G SLS+ F+ Y   +I  +
Sbjct: 118 ----WAPFVVEIVIAIYLGARIEKIKPSTARVMFYVYAAIMGFSLSTIFMAYDLGTIGIS 173

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS-LVNLFMRSSAIDLTMSAMG 200
             + A  F +L++ G TTK ++   G  +++G   L +   L+ +F     + + +SA+G
Sbjct: 174 LALCAGFFFALTMLGMTTKVNMLKAGPILLVGLIVLIVAEVLLMIFAPGQTMLMVISAIG 233

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAY--AERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           LV+F+ +T YD Q  +  ++          ++ S+I AL LY+DFI +F+++L+  G R
Sbjct: 234 LVLFAGMTVYDAQATRALFAQYAGQGEDMVKKVSIICALNLYLDFINMFLYILQLFGDR 292


>gi|322375835|ref|ZP_08050346.1| membrane protein [Streptococcus sp. C300]
 gi|321279103|gb|EFX56145.1| membrane protein [Streptococcus sp. C300]
          Length = 227

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 123/242 (50%), Gaps = 31/242 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA-----L 78
           GL  +  +VY  + LG+G++ ++S                      +MLT F A     L
Sbjct: 11  GLNQFYAKVYAFVGLGIGLSALVS---------------------ALMLTVFQAQLTYFL 49

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           M+      I  FA LG+ +F+   + + ++ AA  +FL+YS L G +LS    +YT  ++
Sbjct: 50  MHGRLWLMIATFAELGL-VFVASSMATKNSPAALPVFLVYSVLNGFTLSFVVALYTPGTV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  ++  G  TK+DL  +G  ++    GL +  +VNLF+ +S  D  +S 
Sbjct: 109 LSAFVSSALLFFVMAAIGIFTKKDLSGMGRALMAALVGLIIAMVVNLFLANSFFDYMISI 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
             +++FS L A+D QKI+  Y   R  VA     S+  AL +Y+DFI +F+ +LR  G R
Sbjct: 169 AMVLVFSGLIAWDNQKIRYVYEQSRGQVATGWVISM--ALSIYLDFINLFLSILRIFG-R 225

Query: 258 RD 259
            D
Sbjct: 226 ND 227


>gi|257865985|ref|ZP_05645638.1| conserved hypothetical protein [Enterococcus casseliflavus EC30]
 gi|257799919|gb|EEV28971.1| conserved hypothetical protein [Enterococcus casseliflavus EC30]
          Length = 259

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/237 (30%), Positives = 112/237 (47%), Gaps = 19/237 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
           QGL  +  +VY    +GL ++ I ++   I            I N  +  TG        
Sbjct: 12  QGLNRFYSKVYLFFGVGLAISAISAY---IFGEVFQAQTLQFISNFPLGFTGL------- 61

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
              WI     + + I L V+     +      FL+YS L GL+LS   ++Y   SIV  F
Sbjct: 62  ---WIL---QIILVIVLGVKAQKNPSLTVAG-FLVYSLLNGLTLSVTLMIYDFGSIVGAF 114

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMSAMGL 201
              A +FG +S +G  TKRDL  +G        G+ + +L+N+F +RS  +D  +S + +
Sbjct: 115 VSAAVTFGVMSAFGIMTKRDLSVVGRIGYGLLLGIIISTLLNVFILRSQPVDFFLSIVTV 174

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            +F  +TAYD Q+I+  Y      A     +V  AL LY+DFI +F+ LLR  G  +
Sbjct: 175 FVFMGITAYDNQQIRNVYFATNGGA-NTGVAVFMALQLYLDFINLFLALLRIFGKNK 230


>gi|320526787|ref|ZP_08027977.1| membrane family protein [Solobacterium moorei F0204]
 gi|320132755|gb|EFW25295.1| membrane family protein [Solobacterium moorei F0204]
          Length = 244

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 119/238 (50%), Gaps = 30/238 (12%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLV-------NILATTVDPDAASIIINRGVMLTG 74
           + GL+AY+ +V+  M +GL +T  +++L          LA  V    +++ I  G++++ 
Sbjct: 16  EAGLKAYITKVFTHMGIGLTITSAVAYLFYHSLVTRGTLARIVFYSESALFIQIGLLISQ 75

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           F                   + I LN  +  LS  A   +FL Y+A+ G++     L Y 
Sbjct: 76  FV------------------LVISLNAAITRLSKGACNALFLTYAAVTGVTFGVIPLAYG 117

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
              + Q F   A  F S ++ G+ T  DL      ++ G F L + S+V++F+ +   +L
Sbjct: 118 VGVVFQAFVFAAILFISCAVIGHVTNVDLTKYQGILVGGLFALIIASIVSIFIPALRNNL 177

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
            ++ +GL IF   TA+D Q+IK+ Y   +D  D    E+ ++ GAL LY+DF+ +F++
Sbjct: 178 LIAYLGLFIFMIYTAFDIQRIKQFYYMSADGTD--QREKLAIYGALQLYLDFVNMFLY 233


>gi|323484633|ref|ZP_08089995.1| integral membrane protein [Clostridium symbiosum WAL-14163]
 gi|323402016|gb|EGA94352.1| integral membrane protein [Clostridium symbiosum WAL-14163]
          Length = 236

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 103/187 (55%), Gaps = 16/187 (8%)

Query: 87  IFIFA-PLGVFI----------FLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTS 135
           +F+FA P G+ +          +++ R++ +S  AA+ MFL Y+ L G+  S++FLV+  
Sbjct: 52  LFVFAIPYGLIVISGLELLTVFWMSARVNKMSVGAARGMFLFYAVLNGIVFSAYFLVFGV 111

Query: 136 KSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLT 195
             ++  F  T+  FG ++      K D+  I   ++ G   L +  ++++F+   A++  
Sbjct: 112 VQLLLVFVATSLFFGIMAGVSLIFKIDISGIRPILVGGLIFLIIFGILSMFLNLGAMETV 171

Query: 196 MSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           M  +G+ +F   TAYDT KI++ Y   +   +V   E+ S+  AL LY+DFI +F+++LR
Sbjct: 172 MCYVGIAVFLGFTAYDTGKIRQNYVHFAGNQEV--LEKASIFSALSLYLDFINLFLYILR 229

Query: 253 FLGSRRD 259
            L   R+
Sbjct: 230 LLNRSRN 236


>gi|227877021|ref|ZP_03995113.1| integral membrane protein [Lactobacillus crispatus JV-V01]
 gi|256844668|ref|ZP_05550153.1| conserved hypothetical protein [Lactobacillus crispatus 125-2-CHN]
 gi|256850552|ref|ZP_05555978.1| conserved hypothetical protein [Lactobacillus crispatus MV-1A-US]
 gi|227863392|gb|EEJ70819.1| integral membrane protein [Lactobacillus crispatus JV-V01]
 gi|256613209|gb|EEU18413.1| conserved hypothetical protein [Lactobacillus crispatus 125-2-CHN]
 gi|256712575|gb|EEU27570.1| conserved hypothetical protein [Lactobacillus crispatus MV-1A-US]
          Length = 236

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 119/246 (48%), Gaps = 35/246 (14%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
             + +++ ++Y+LM L + V+   +FL     TTV    AS I N             + 
Sbjct: 17  SAVNSFLTKMYSLMILAVLVSAATAFLT----TTV---FASAIANM------------SQ 57

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAK------MMFLLYSALIGLSLSSFFLVYTSK 136
            + WI IF P+       V   ++S  AAK      ++ L+ SA+ G   +     +T+ 
Sbjct: 58  AVYWIIIFVPI-------VLCMTISFKAAKNPTLGLVLLLILSAVYGFEFAFIAGAFTTA 110

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLT 195
           SI   F   A  F +++++G  TKRDL   GS++     G  +  LVN  F+RS A    
Sbjct: 111 SIAGAFLSAAGVFAAMAIFGTVTKRDLSNWGSYLGAALIGFLVAWLVNAFFIRSGAATFI 170

Query: 196 MSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF-- 253
            S +G+++F+ LTAYD    K+ Y            +V+GAL +Y+DFI IF+ LL+   
Sbjct: 171 FSCIGVLLFTGLTAYDAHNAKKIYMTYGGQVSDTGLAVMGALNMYLDFINIFMFLLQIFG 230

Query: 254 LGSRRD 259
           +G  RD
Sbjct: 231 MGGNRD 236


>gi|307705546|ref|ZP_07642398.1| hypothetical protein SMSK597_1504 [Streptococcus mitis SK597]
 gi|307620823|gb|EFN99907.1| hypothetical protein SMSK597_1504 [Streptococcus mitis SK597]
          Length = 227

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 123/241 (51%), Gaps = 29/241 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  +  +VY  + LG+G++ ++S                     G+MLT F + +    
Sbjct: 11  GLNQFYAKVYAFVGLGIGLSALVS---------------------GLMLTVFQSQLVYFL 49

Query: 84  LR---WIFI--FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           ++   W+ I  FA L + +F+   + S ++ AA  +FLLYS L G +LS     YT  ++
Sbjct: 50  MQGRLWLTIATFAELAL-VFVASNMASRNSPAALPVFLLYSVLNGFTLSFVVAFYTPGTV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  ++  G  TK+DL  +G  M+    GL +  +VN+F+ S   D  +S 
Sbjct: 109 LSAFVSSALLFFVMAAVGMFTKKDLSGLGRAMMAALIGLLIAMVVNIFLASGFFDYMISV 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             +++FS L A+D Q+I+ AY ++     A    V  AL +Y+DFI +F+ +LR  G R 
Sbjct: 169 AMVLVFSGLIAWDNQRIRLAY-EQSQGRVATGWVVSMALSIYLDFINLFLSILRIFG-RN 226

Query: 259 D 259
           D
Sbjct: 227 D 227


>gi|227530464|ref|ZP_03960513.1| integral membrane protein, interacts with FtsH [Lactobacillus
           vaginalis ATCC 49540]
 gi|227349569|gb|EEJ39860.1| integral membrane protein, interacts with FtsH [Lactobacillus
           vaginalis ATCC 49540]
          Length = 237

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 82/145 (56%)

Query: 111 AKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFM 170
           A +M +L S + G+  +    VYT  SI   F  ++  F  +++YG  TKRDL   GS  
Sbjct: 88  AFVMLMLISIIYGVEFALIAGVYTGASIASAFVSSSVIFIVMAIYGTVTKRDLTKFGSHA 147

Query: 171 IMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAER 230
           +     L +  ++N+F++S AI    S + ++IF+ LT +D QK+K+ Y +  D      
Sbjct: 148 MAALIALIIAYIINMFLQSPAIAYIFSFIAVIIFTVLTGWDAQKMKQIYVNHGDQVSVTG 207

Query: 231 QSVIGALMLYMDFIQIFVHLLRFLG 255
            +V+GAL LY+DF+ +F+ LL+  G
Sbjct: 208 LAVLGALQLYLDFVNLFISLLQIFG 232


>gi|257875612|ref|ZP_05655265.1| conserved hypothetical protein [Enterococcus casseliflavus EC20]
 gi|257809778|gb|EEV38598.1| conserved hypothetical protein [Enterococcus casseliflavus EC20]
          Length = 230

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/237 (30%), Positives = 111/237 (46%), Gaps = 19/237 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
           QGL  +  +VY    +GL ++ I ++   I            I N  +  TG        
Sbjct: 12  QGLNRFYSKVYLFFGVGLAISAISAY---IFGEVFQAQTLQFISNFPLGFTGL------- 61

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
              WI     + + I L V+     +      FL+YS L GL+LS   ++Y   SIV  F
Sbjct: 62  ---WIL---QIILVIVLGVKAQKNPSLTVAG-FLVYSLLNGLTLSVTLMIYEFGSIVGAF 114

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMSAMGL 201
              A +FG +S +G  TKRDL  +G        G+ + +L+N+F +RS  +D  +S + +
Sbjct: 115 VSAAVTFGVMSAFGIMTKRDLSVVGRIGYGLLIGIIISTLLNVFILRSQPVDFFLSIVTV 174

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            +F  +TAYD Q+I+  Y      A     +V  AL LY+DFI +F+ LLR  G   
Sbjct: 175 FVFMGITAYDNQQIRNVYFATNGGA-NTGVAVFMALQLYLDFINLFLALLRIFGKNN 230


>gi|289167185|ref|YP_003445452.1| hypothetical protein smi_0312 [Streptococcus mitis B6]
 gi|288906750|emb|CBJ21584.1| conserved hypothetical protein [Streptococcus mitis B6]
          Length = 227

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 123/241 (51%), Gaps = 29/241 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  +  +VY  + LG+G++ ++S                     G+MLT F + +    
Sbjct: 11  GLNQFYAKVYAFVGLGIGLSALVS---------------------GLMLTVFQSQLVYFL 49

Query: 84  LR---WIFI--FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           ++   W+ I  FA L + +F+   + S ++ AA  +FLLYS L G +LS     YT  ++
Sbjct: 50  MQGRLWLTIATFAELAL-VFVASSMASRNSPAALPVFLLYSVLNGFTLSFVVAFYTPGTV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  ++  G  TK+DL  +G  M+    GL +  +VN+F+ S   D  +S 
Sbjct: 109 LSAFVSSALLFFVMAAVGIFTKKDLSGLGRAMMAALIGLLIAMVVNIFLASGFFDYMISV 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             +++FS L A+D Q+I+ AY ++     A    V  AL +Y+DFI +F+ +LR  G R 
Sbjct: 169 AMVLVFSGLIAWDNQRIRLAY-EQSQGRVATGWVVSMALSIYLDFINLFLSILRIFG-RN 226

Query: 259 D 259
           D
Sbjct: 227 D 227


>gi|257872318|ref|ZP_05651971.1| conserved hypothetical protein [Enterococcus casseliflavus EC10]
 gi|257806482|gb|EEV35304.1| conserved hypothetical protein [Enterococcus casseliflavus EC10]
          Length = 230

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/237 (30%), Positives = 111/237 (46%), Gaps = 19/237 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
           QGL  +  +VY    +GL ++ I ++   I            I N  +  TG        
Sbjct: 12  QGLNRFYSKVYLFFGVGLAISAISAY---IFGEVFQAQTLQFISNFPLGFTGL------- 61

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
              WI     + + I L V+     +      FL+YS L GL+LS   ++Y   SIV  F
Sbjct: 62  ---WIL---QIILVIVLGVKAQKNPSLTVAG-FLVYSLLNGLTLSVTLMIYDFGSIVGAF 114

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMSAMGL 201
              A +FG +S +G  TKRDL  +G        G+ + +L+N+F +RS  +D  +S + +
Sbjct: 115 VSAAVTFGVMSAFGIMTKRDLSVVGRIGYGLLLGIIISTLLNVFILRSQPVDFFLSIVTV 174

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            +F  +TAYD Q+I+  Y      A     +V  AL LY+DFI +F+ LLR  G   
Sbjct: 175 FVFMGITAYDNQQIRNVYFATNGGA-NTGVAVFMALQLYLDFINLFLALLRIFGKNN 230


>gi|28378221|ref|NP_785113.1| integral membrane protein [Lactobacillus plantarum WCFS1]
 gi|254556428|ref|YP_003062845.1| integral membrane protein [Lactobacillus plantarum JDM1]
 gi|300767152|ref|ZP_07077064.1| integral membrane protein [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|308180372|ref|YP_003924500.1| integral membrane protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|28271056|emb|CAD63961.1| integral membrane protein [Lactobacillus plantarum WCFS1]
 gi|254045355|gb|ACT62148.1| integral membrane protein [Lactobacillus plantarum JDM1]
 gi|300494971|gb|EFK30127.1| integral membrane protein [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|308045863|gb|ADN98406.1| integral membrane protein [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 238

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 88/147 (59%), Gaps = 1/147 (0%)

Query: 114 MFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMG 173
           + +L++ + G+ +S    +YT   I   F    A F ++++ G TTKRD+  IG+ +I  
Sbjct: 92  LLMLFAIIFGVEMSVTLSLYTGAVITGAFVAAGAVFATMAVIGTTTKRDISRIGTHLIAA 151

Query: 174 AFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSV 233
             GLF+ SLVN+F++S+ I    S +G++IF+ L+ +D  +++  Y    D   +   +V
Sbjct: 152 LIGLFVASLVNMFLQSAMISYIFSYIGVLIFAGLSMWDANRMRNMYLQYGDQVSSTGLAV 211

Query: 234 IGALMLYMDFIQIFVHLLR-FLGSRRD 259
            GAL LY+DF+ +F++ ++ F GS RD
Sbjct: 212 TGALQLYLDFVNLFLYFVQIFGGSSRD 238


>gi|325570068|ref|ZP_08145993.1| membrane protein [Enterococcus casseliflavus ATCC 12755]
 gi|325156896|gb|EGC69067.1| membrane protein [Enterococcus casseliflavus ATCC 12755]
          Length = 230

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 81/145 (55%), Gaps = 2/145 (1%)

Query: 115 FLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGA 174
           FL+YS L GL+LS   ++Y   SIV  F   A +FG +S +G  TKRDL  +G       
Sbjct: 87  FLVYSLLNGLTLSVTLMIYDFGSIVGAFVSAAVTFGVMSAFGIMTKRDLSVVGRIGYGLL 146

Query: 175 FGLFLLSLVNLF-MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSV 233
            G+ + +L+N+F +RS  +D  +S + + +F  +TAYD Q+I+  Y      A     +V
Sbjct: 147 IGIIISTLLNVFILRSQPVDFFLSIVTVFVFMGITAYDNQQIRNVYFATNGGA-NTGVAV 205

Query: 234 IGALMLYMDFIQIFVHLLRFLGSRR 258
             AL LY+DFI +F+ LLR  G   
Sbjct: 206 FMALQLYLDFINLFLALLRIFGKNN 230


>gi|237741806|ref|ZP_04572287.1| integral membrane protein [Fusobacterium sp. 4_1_13]
 gi|229429454|gb|EEO39666.1| integral membrane protein [Fusobacterium sp. 4_1_13]
          Length = 224

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 91/159 (57%), Gaps = 4/159 (2%)

Query: 103 LHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRD 162
           ++ +S+  AK++F  YS + G++L+    +Y  + I   F IT   F   ++YGYTT+ D
Sbjct: 67  INKISSSLAKILFFAYSLVNGVTLTVIGFIYAPQIIFYAFMITLTIFVVTAIYGYTTQED 126

Query: 163 LGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIK---EAY 219
           L     F ++    L +LS++N FM    ++  ++  G+VIF+ L AYD  +IK      
Sbjct: 127 LSSYRRFFMIALISLIILSIINAFMGVGMLEWVITIGGVVIFTGLIAYDVNRIKFISYQL 186

Query: 220 SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +D  D    E+  +IGAL LY+DFI +F+++LR  G ++
Sbjct: 187 ADG-DNEAMEKMGIIGALNLYLDFINLFIYILRIFGRKK 224


>gi|307710738|ref|ZP_07647166.1| putative membrane protein [Streptococcus mitis SK321]
 gi|307617344|gb|EFN96516.1| putative membrane protein [Streptococcus mitis SK321]
          Length = 227

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 122/241 (50%), Gaps = 29/241 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  +  +VY  + LG+G++ ++S                     G+MLT F + +    
Sbjct: 11  GLNQFYAKVYAFVGLGIGLSALVS---------------------GLMLTVFQSQLVYFL 49

Query: 84  LR---WIFI--FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           ++   W+ I  FA L + +F+   + S ++ AA  +FLLYS L G +LS     YT  ++
Sbjct: 50  MQGRLWLTIATFAELAL-VFVASSMASRNSPAALPVFLLYSVLNGFTLSFVVAFYTPGTV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  ++  G  TK+DL  +G  M+    GL +  +VN+F+ S   D  +S 
Sbjct: 109 LSAFVSSALLFFVMAAVGMFTKKDLSGLGRAMMAALIGLLIAMVVNIFLASGFFDYMISV 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             +++FS L A D QKI+ AY ++     A    V  AL +Y+DFI +F+ +LR  G R 
Sbjct: 169 AMVLVFSGLIASDNQKIRYAY-EQSQGRVATGWVVSMALSIYLDFINLFLSILRIFG-RN 226

Query: 259 D 259
           D
Sbjct: 227 D 227


>gi|306830167|ref|ZP_07463351.1| membrane protein [Streptococcus mitis ATCC 6249]
 gi|304427693|gb|EFM30789.1| membrane protein [Streptococcus mitis ATCC 6249]
          Length = 227

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 122/242 (50%), Gaps = 31/242 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA-----L 78
           GL  +  +VY  + LG+G++ ++S                      +MLT F +     L
Sbjct: 11  GLNQFYAKVYAFVGLGIGLSALVS---------------------ALMLTVFQSQLVYFL 49

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           M+      I  FA LG+ +F+   + + ++ AA  +FL+YS L G +LS     YT  ++
Sbjct: 50  MHGRLWLMIATFAELGL-VFVASSMAAKNSPAALPVFLVYSVLNGFTLSFVVAFYTPGTV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  ++  G  TK+DL  +G  ++    GL +  +VNLF+ +S  D  +S 
Sbjct: 109 LSAFVSSALLFFVMAAIGIFTKKDLSGMGRALMAALVGLIIAMIVNLFLANSFFDYMISI 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
             +++FS L A+D QKI+  Y   R  VA     S+  AL +Y+DFI +F+ +LR  G R
Sbjct: 169 AMVLVFSGLIAWDNQKIRYVYEQSRGQVATGWVISM--ALSIYLDFINLFLSILRIFG-R 225

Query: 258 RD 259
            D
Sbjct: 226 ND 227


>gi|256845148|ref|ZP_05550606.1| integral membrane protein [Fusobacterium sp. 3_1_36A2]
 gi|294785553|ref|ZP_06750841.1| membrane protein [Fusobacterium sp. 3_1_27]
 gi|256718707|gb|EEU32262.1| integral membrane protein [Fusobacterium sp. 3_1_36A2]
 gi|294487267|gb|EFG34629.1| membrane protein [Fusobacterium sp. 3_1_27]
          Length = 228

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 91/159 (57%), Gaps = 4/159 (2%)

Query: 103 LHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRD 162
           ++ +S+  AK++F  YS + G++L+    +Y  + I   F IT   F   ++YGYTT+ D
Sbjct: 71  INKISSSLAKILFFAYSLVNGVTLTVIGFIYAPQIIFYAFMITLTIFVVTAIYGYTTQED 130

Query: 163 LGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIK---EAY 219
           L     F ++    L +LS++N FM    ++  ++  G+VIF+ L AYD  +IK      
Sbjct: 131 LSSYRRFFMIALISLIILSIINAFMGVGMLEWVITIGGVVIFTGLIAYDVNRIKFISYQL 190

Query: 220 SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +D  D    E+  +IGAL LY+DFI +F+++LR  G ++
Sbjct: 191 ADG-DNEAMEKMGIIGALNLYLDFINLFIYILRIFGRKK 228


>gi|15618879|ref|NP_225165.1| transport permease [Chlamydophila pneumoniae CWL029]
 gi|15836503|ref|NP_301027.1| transport permease [Chlamydophila pneumoniae J138]
 gi|16752060|ref|NP_445426.1| hypothetical protein CP0888 [Chlamydophila pneumoniae AR39]
 gi|33242338|ref|NP_877279.1| putative transport permease [Chlamydophila pneumoniae TW-183]
 gi|4377297|gb|AAD19108.1| Transport Permease [Chlamydophila pneumoniae CWL029]
 gi|7189801|gb|AAF38676.1| conserved hypothetical protein [Chlamydophila pneumoniae AR39]
 gi|8979344|dbj|BAA99178.1| transport permease [Chlamydophila pneumoniae J138]
 gi|33236849|gb|AAP98936.1| putative transport permease [Chlamydophila pneumoniae TW-183]
          Length = 238

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 72/213 (33%), Positives = 111/213 (52%), Gaps = 17/213 (7%)

Query: 62  ASIIINRGVMLTGFGALMYTS--PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
           A +I+   V L  + + +Y S     W++ FA LGV  F+N ++ +LS  A   +FLLYS
Sbjct: 28  AGLIVTSCVALGLYFSGLYRSLFSFWWVWCFATLGVSFFINSKIQTLSVSAVGGLFLLYS 87

Query: 120 ALIGLSLSSFFLVYTSK---SIVQTFFITAA-SFGSLSLYGYTTKRDLGPIGSFMIMGAF 175
            L G+   +   VY ++    ++   F +AA  FG  ++YG  TK DL  I   M     
Sbjct: 88  TLEGMFFGTLLPVYAAQYGGGVIWAAFGSAALVFGLAAVYGAFTKSDLTKISKIMTFALI 147

Query: 176 GLFLLSL----VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYS---DRYDVAYA 228
           GL L++L    V++F+    I L +  +GLVIF  LTA D Q I+   S   D   ++Y 
Sbjct: 148 GLLLVTLVFAVVSMFVSMPLIYLLICYLGLVIFVGLTAADAQAIRRISSTIGDNNTLSY- 206

Query: 229 ERQSVIGALMLYMDFIQIFVHLLRFLGS--RRD 259
            + S++ AL +Y + I +F +LL+   S   RD
Sbjct: 207 -KLSLMFALKMYCNVIMVFWYLLQIFSSSGNRD 238


>gi|269302761|gb|ACZ32861.1| putative lipoprotein [Chlamydophila pneumoniae LPCoLN]
          Length = 238

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 72/213 (33%), Positives = 111/213 (52%), Gaps = 17/213 (7%)

Query: 62  ASIIINRGVMLTGFGALMYTS--PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
           A +I+   V L  + + +Y S     W++ FA LGV  F+N ++ +LS  A   +FLLYS
Sbjct: 28  AGLIVTSCVALGLYFSGLYRSLFSFWWVWCFATLGVSFFINSKIQTLSVSAVGGLFLLYS 87

Query: 120 ALIGLSLSSFFLVYTSK---SIVQTFFITAA-SFGSLSLYGYTTKRDLGPIGSFMIMGAF 175
            L G+   +   VY ++    ++   F +AA  FG  ++YG  TK DL  I   M     
Sbjct: 88  TLEGMFFGTLLPVYAAQYGGGVIWAAFGSAALVFGLAAVYGAFTKSDLTKISKIMTFALI 147

Query: 176 GLFLLSL----VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYS---DRYDVAYA 228
           GL L++L    V++F+    I L +  +GLVIF  LTA D Q I+   S   D   ++Y 
Sbjct: 148 GLLLVTLVFAVVSMFVSMPLIYLLICYLGLVIFVGLTAADAQAIRRISSTIGDNNTLSY- 206

Query: 229 ERQSVIGALMLYMDFIQIFVHLLRFLGS--RRD 259
            + S++ AL +Y + I +F +LL+   S   RD
Sbjct: 207 -KLSLMFALKMYCNVIMVFWYLLQIFSSSGNRD 238


>gi|114797078|ref|YP_761894.1| hypothetical protein HNE_3219 [Hyphomonas neptunium ATCC 15444]
 gi|114737252|gb|ABI75377.1| putative membrane protein [Hyphomonas neptunium ATCC 15444]
          Length = 257

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 127/260 (48%), Gaps = 40/260 (15%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           ++++ GLR +M+ VY  +ALG+ ++G ++FLV                    ++ G   L
Sbjct: 18  TSVNAGLRTFMLGVYQKLALGIALSGGIAFLVG-----------------SGLVPGLTQL 60

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +  +PL ++F F PL + +     + + S  A  +++     ++G+ LS +  +  +++ 
Sbjct: 61  LLGTPLFYLFQFGPLVLILGSAFLMKNPSPLATGILYWTIVVMLGVCLSIWVAMAAAQTG 120

Query: 139 VQT----------------FFITAASFGSLSLYGYTTKRDLGPIG---SFMIMGAFGLFL 179
           V T                F +TA++FG+LSL+GYTTK +L PIG    F + G  G+ L
Sbjct: 121 VTTRGGAALNVTFMTMTKAFLLTASAFGALSLFGYTTKANLRPIGIIAVFALWGVVGISL 180

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY-SDRYDVAYAERQSVIGALM 238
           LS   LF  S   ++ +    L I   L A+ TQ++KE Y ++  D       +  GAL 
Sbjct: 181 LSF--LFPPSGMFEVIIQVAVLGISGVLVAFQTQELKEGYFANEGDTRSLAVMTNWGALN 238

Query: 239 LYMDFIQIFVHLLRFLGSRR 258
            ++ F  +F  L+  L SR 
Sbjct: 239 FFIMFYNMFTILMSLL-SRE 257


>gi|171780261|ref|ZP_02921165.1| hypothetical protein STRINF_02049 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171281609|gb|EDT47044.1| hypothetical protein STRINF_02049 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 230

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 113/223 (50%), Gaps = 18/223 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GL  +  ++Y L+ +G+G++  +SFL+  + T    +  +I+ N   +   +GA+   
Sbjct: 12  DSGLNRFFAKIYGLVGMGIGLSAFVSFLMLYVFT---DNMINIMTNHPFIY--YGAVF-- 64

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
             L    +F   G       R ++ SA     +FL YSAL G +LS   + YT  +++Q 
Sbjct: 65  --LELALVFLASGA-----ARKNTPSALP---LFLFYSALNGFTLSFIIVAYTQTTVLQA 114

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +A  FG +S+ G+  K+DL       +    G+ + S VN+F+ S  +   +S + +
Sbjct: 115 FVSSALVFGVMSVLGFVIKKDLSGFAKAALAALIGIIIASFVNIFIGSGMMSFVISIISV 174

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
           +IFS L AYD Q IK  Y +       +  ++  AL LY+DFI
Sbjct: 175 LIFSGLIAYDNQMIKRVY-EATGGQVGDGWAISMALSLYLDFI 216


>gi|307707581|ref|ZP_07644062.1| membrane protein [Streptococcus mitis NCTC 12261]
 gi|307616294|gb|EFN95486.1| membrane protein [Streptococcus mitis NCTC 12261]
          Length = 227

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 123/242 (50%), Gaps = 31/242 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  +  +VY  + LG+G++ ++S                     G+MLT F + +    
Sbjct: 11  GLNQFYAKVYAFVGLGIGLSALVS---------------------GLMLTVFQSQLVYFL 49

Query: 84  LR---WIFI--FAPLG-VFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           ++   W+ I  FA L  VF+  N+ L +  + AA  +FLLYS L G +LS     YT  +
Sbjct: 50  MQGRLWLTIATFAELALVFVASNMALKN--SPAALPVFLLYSVLNGFTLSFVVAFYTPGT 107

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           ++  F  +A  F  ++  G  TK+DL  +G  M+    GL +  +VN+F+ S   D  +S
Sbjct: 108 VLSAFVSSALLFFVMAAVGMFTKKDLSGLGRAMMAALIGLLIAMVVNIFLASGFFDYMIS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
              +++FS L A+D Q+I+ AY ++     A    V  AL +Y+DFI +F+ +LR  G R
Sbjct: 168 VAMVLVFSGLIAWDNQRIRLAY-EQSQGRVATGWVVSMALSIYLDFINLFLSILRIFG-R 225

Query: 258 RD 259
            D
Sbjct: 226 ND 227


>gi|229496381|ref|ZP_04390098.1| conserved membrane protein, YccA family [Porphyromonas endodontalis
           ATCC 35406]
 gi|229316700|gb|EEN82616.1| conserved membrane protein, YccA family [Porphyromonas endodontalis
           ATCC 35406]
          Length = 278

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 85/149 (57%), Gaps = 6/149 (4%)

Query: 115 FLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGA 174
           F+LYS   G++LSS F+ Y + SI+    ITA  FG++ L G  TKRDL  +GS +IM +
Sbjct: 128 FVLYSLANGMTLSSIFIGYDAFSIIAALGITAVMFGAMCLIGLLTKRDLSSLGSIVIMAS 187

Query: 175 FGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQS-- 232
            G  + S+V +F     +    S +G+V+FS +T +    IK    +R +   +E+ +  
Sbjct: 188 IGFVIASIVGMFATHPLVTWITSLVGVVLFSGMTIFSINGIKTTL-ERNNGHMSEQDANK 246

Query: 233 --VIGALMLYMDFIQIFVHLLRFLGSRRD 259
             +  A  LY+D I +F+ L++ L SRRD
Sbjct: 247 FVLQSAFHLYLDIINLFITLIQ-LFSRRD 274


>gi|300361692|ref|ZP_07057869.1| integral membrane protein [Lactobacillus gasseri JV-V03]
 gi|300354311|gb|EFJ70182.1| integral membrane protein [Lactobacillus gasseri JV-V03]
          Length = 237

 Score = 81.6 bits (200), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 70/127 (55%)

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT + I   F  +A+ F  +++ G  TKRDL  IGS+      GL +  L+N F+++  I
Sbjct: 110 YTGEDIASAFVASASVFIVMAILGIVTKRDLSRIGSYASAALIGLIVAMLINFFLKNPTI 169

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           D   S + ++IF+ LTA+D Q++K  Y            +V+GAL LY+DF+ +F+  L 
Sbjct: 170 DYIFSFIAVIIFTILTAWDAQRMKNIYLQFGGELSTNGLAVLGALQLYLDFVNLFLQFLD 229

Query: 253 FLGSRRD 259
             GS  +
Sbjct: 230 IFGSNDN 236


>gi|307709739|ref|ZP_07646190.1| hypothetical protein SMSK564_1072 [Streptococcus mitis SK564]
 gi|307619441|gb|EFN98566.1| hypothetical protein SMSK564_1072 [Streptococcus mitis SK564]
          Length = 227

 Score = 81.6 bits (200), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 122/241 (50%), Gaps = 29/241 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  +  +VY  + LG+ ++ ++S                     G+MLT F + +    
Sbjct: 11  GLNQFYAKVYAFVGLGIALSALVS---------------------GLMLTVFQSQLVYFL 49

Query: 84  LR---WIFI--FAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           ++   W+ I  FA L + +F+   + S ++ AA  +FLLYS L G +LS     YT  ++
Sbjct: 50  MQGRLWLTIATFAELAL-VFVASSMASKNSPAALPVFLLYSVLNGFTLSFVVAFYTPGTV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  ++  G  TK+DL  +G  M+    GL +  +VN+F+ S   D  +S 
Sbjct: 109 LSAFVSSALLFFVMAAVGIFTKKDLSGLGRAMMAALIGLLIAMVVNIFLASGFFDYMISV 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             +++FS L A+D Q+I+ AY ++     A    V  AL +Y+DFI +F+ +LR  G R 
Sbjct: 169 AMVLVFSGLIAWDNQRIRLAY-EQSQGRVATGWVVSMALSIYLDFINLFLSILRIFG-RN 226

Query: 259 D 259
           D
Sbjct: 227 D 227


>gi|306822496|ref|ZP_07455874.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|309801400|ref|ZP_07695527.1| putative membrane protein [Bifidobacterium dentium JCVIHMP022]
 gi|304554041|gb|EFM41950.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|308221915|gb|EFO78200.1| putative membrane protein [Bifidobacterium dentium JCVIHMP022]
          Length = 284

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 128/252 (50%), Gaps = 44/252 (17%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           ++  R  + R Y  M +GL VT +++ +                      +TG    +Y 
Sbjct: 62  EEAQRVSVTRAYGEMTIGLLVTAVVAIVTQ--------------------MTG----LYI 97

Query: 82  SPLRW--IF-IFAPLGVFI----FLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           + L++  IF +FAP  V I    +L  R+  ++  +A++MF +Y+AL+G +LS  F VY 
Sbjct: 98  TFLQYTGIFGVFAPAIVQIVLAVYLGARITRMTPSSARVMFYVYAALMGFTLSIIFAVYD 157

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS-LVNLFMRSSAID 193
             +I  +  + A  F +L++ G TTK ++   G  ++ G   L +   L+ +F       
Sbjct: 158 LGTIGISLALCAGFFFALTMLGRTTKFNMLKAGPVLLAGLIVLIIAEVLLAIFAPGDTAL 217

Query: 194 LTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYA-------ERQSVIGALMLYMDFIQI 246
           + +SA+GLV+F+ +T YD Q  +  ++      YA       ++ S++ AL LY+DF+ +
Sbjct: 218 MLISAIGLVLFAGMTVYDAQATRALFAQ-----YAGEGPDMIKKISILCALNLYLDFVNM 272

Query: 247 FVHLLRFLGSRR 258
           F+++LR  GSR 
Sbjct: 273 FLYILRLFGSRN 284


>gi|227551620|ref|ZP_03981669.1| integral membrane protein receptor [Enterococcus faecium TX1330]
 gi|257884458|ref|ZP_05664111.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
 gi|257887241|ref|ZP_05666894.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257895777|ref|ZP_05675430.1| conserved hypothetical protein [Enterococcus faecium Com12]
 gi|257898347|ref|ZP_05678000.1| conserved hypothetical protein [Enterococcus faecium Com15]
 gi|293377608|ref|ZP_06623797.1| membrane family protein [Enterococcus faecium PC4.1]
 gi|227179297|gb|EEI60269.1| integral membrane protein receptor [Enterococcus faecium TX1330]
 gi|257820296|gb|EEV47444.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
 gi|257823295|gb|EEV50227.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257832342|gb|EEV58763.1| conserved hypothetical protein [Enterococcus faecium Com12]
 gi|257836259|gb|EEV61333.1| conserved hypothetical protein [Enterococcus faecium Com15]
 gi|292643608|gb|EFF61729.1| membrane family protein [Enterococcus faecium PC4.1]
          Length = 227

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 118/241 (48%), Gaps = 19/241 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           ST   G+  +  +VY  + +GL ++ + S+L    A  V P   +  IN   +  GF  L
Sbjct: 5   STSMSGINRFYAKVYGFLGMGLALSAVTSYL----ALWVFPLQLATFINNFPL--GFMGL 58

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
                  WI     L + + L V+     + A    F+ YS L G++L+     Y   ++
Sbjct: 59  -------WI---VELILVMVLGVKAQKNPSLAIGG-FIAYSLLNGVTLAVTLAFYDIGTV 107

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMS 197
            Q F      F  +S+ G TTKRDL  +G        G+ +  ++N+F +RSSA++L +S
Sbjct: 108 TQAFLTATLMFMGMSVVGVTTKRDLSGVGRAGQAALIGVIIALVLNIFILRSSAVELFIS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            + +VIF+ +TAYD Q I+  Y      A++   +V  AL LY+DFI +F+  LR  G  
Sbjct: 168 LLLVVIFAGITAYDNQSIRNIYVQTNGTAHSG-IAVFMALKLYLDFINLFLAFLRIFGRN 226

Query: 258 R 258
            
Sbjct: 227 N 227


>gi|227544013|ref|ZP_03974062.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri CF48-3A]
 gi|300909528|ref|ZP_07126989.1| integral membrane protein [Lactobacillus reuteri SD2112]
 gi|227186005|gb|EEI66076.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri CF48-3A]
 gi|300893393|gb|EFK86752.1| integral membrane protein [Lactobacillus reuteri SD2112]
          Length = 235

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 93/175 (53%), Gaps = 3/175 (1%)

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI-GLSLSSFFLVYTSKSIVQTFFI 144
           W+ I  P  + +   +  ++  +    +  L+ +A++ G++ +     Y    I   F  
Sbjct: 62  WLVILLP--IILTFGINFNATRSPGLCLFLLILTAIVYGITFTFIAGAYAGTDIATAFVS 119

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           +A  F ++++ G  + RD   +GS+      G+ +  LVN F++S  I+  +S + ++IF
Sbjct: 120 SAGVFLTMAIIGTFSHRDFTRLGSYASAALIGMIIAMLVNFFVQSPIINYLLSIVAVIIF 179

Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +ALTA+D Q++K  Y++      +   +V+GAL LY+DFI +F+  L  LGS  +
Sbjct: 180 TALTAWDAQRMKNIYTECNGQVSSNGLAVLGALQLYLDFINLFISFLDILGSSNE 234


>gi|328479626|gb|EGF48817.1| integral membrane protein, interacts with FtsH [Lactobacillus
           rhamnosus MTCC 5462]
          Length = 148

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 79/141 (56%), Gaps = 4/141 (2%)

Query: 111 AKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFM 170
           A +MF L SA  G + +S  +V  + ++      TA  F  +S+ G+  KRDL   G+  
Sbjct: 6   ATLMFYLMSASFGFTFASVAMVAKTSNLAVALATTAVVFLVMSMVGHFGKRDLSKAGNIA 65

Query: 171 IMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY----SDRYDVA 226
           +   FG+ ++  VN+FM SS + + +S   L+IF  LTA+DTQ++K  Y    SD     
Sbjct: 66  MSALFGVIIMMFVNMFMGSSGMQMLISYAILIIFIVLTAWDTQRLKNLYLTAGSDGQAAI 125

Query: 227 YAERQSVIGALMLYMDFIQIF 247
                +V+GALMLY+DF+ +F
Sbjct: 126 STSSLAVVGALMLYLDFLNLF 146


>gi|293571804|ref|ZP_06682820.1| membrane protein [Enterococcus faecium E980]
 gi|291608058|gb|EFF37364.1| membrane protein [Enterococcus faecium E980]
          Length = 227

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 118/241 (48%), Gaps = 19/241 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           ST   G+  +  +VY  + +GL ++ + S+L    A  V P   +  IN   +  GF  L
Sbjct: 5   STSMSGINRFYAKVYGFLGMGLALSAVTSYL----ALWVFPLQLATFINNFPL--GFMGL 58

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
                  WI     L + + L V+     + A    F+ YS L G++L+     Y   ++
Sbjct: 59  -------WI---VELILVMVLGVKAQKNPSLAIGG-FIAYSLLNGVTLTVTLAFYDIGTV 107

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMS 197
            Q F      F  +S+ G TTKRDL  +G        G+ +  ++N+F +RSSA++L +S
Sbjct: 108 TQAFLTATLMFMGMSVVGVTTKRDLSGVGRAGQAALIGVIIALVLNIFILRSSAVELFIS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            + +VIF+ +TAYD Q I+  Y      A++   +V  AL LY+DFI +F+  LR  G  
Sbjct: 168 LLLVVIFAGITAYDNQSIRNIYVQTNGTAHSG-IAVFMALKLYLDFINLFLAFLRIFGRN 226

Query: 258 R 258
            
Sbjct: 227 N 227


>gi|293556211|ref|ZP_06674801.1| integral membrane protein [Enterococcus faecium E1039]
 gi|294615649|ref|ZP_06695504.1| integral membrane protein [Enterococcus faecium E1636]
 gi|291591478|gb|EFF23132.1| integral membrane protein [Enterococcus faecium E1636]
 gi|291601630|gb|EFF31892.1| integral membrane protein [Enterococcus faecium E1039]
          Length = 227

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 118/241 (48%), Gaps = 19/241 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           ST   G+  +  +VY  + +GL ++ + S+L    A  V P   +  IN   +  GF  L
Sbjct: 5   STSMSGINRFYAKVYGFLGMGLALSAVTSYL----ALWVFPLQLATFINNFPL--GFMGL 58

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
                  WI     L + + L V+     + A    F+ YS L G++L+     Y   ++
Sbjct: 59  -------WI---VELILVMVLGVKAQKNPSLAIGG-FIAYSLLNGVTLAVTLAYYDIGTV 107

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMS 197
            Q F      F  +S+ G TTKRDL  +G        G+ +  ++N+F +RSSA++L +S
Sbjct: 108 TQAFLTATLMFMGMSVVGVTTKRDLSGVGRAGQAALIGVIIALVLNIFILRSSAVELFIS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            + +VIF+ +TAYD Q I+  Y      A++   +V  AL LY+DFI +F+  LR  G  
Sbjct: 168 LLLVVIFAGITAYDNQSIRNIYVQTNGTAHSG-IAVFMALKLYLDFINLFLAFLRIFGRN 226

Query: 258 R 258
            
Sbjct: 227 N 227


>gi|270292100|ref|ZP_06198315.1| membrane protein [Streptococcus sp. M143]
 gi|270279628|gb|EFA25470.1| membrane protein [Streptococcus sp. M143]
          Length = 227

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 120/242 (49%), Gaps = 31/242 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA-----L 78
           GL  +  +VY  + LG+G++ ++S                      +MLT F       L
Sbjct: 11  GLNQFYAKVYAFVGLGIGLSALVS---------------------ALMLTVFQTQLVYFL 49

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           M+      I  FA LG+ +F+   + + ++ AA  +FL+YS L G +LS     YT  ++
Sbjct: 50  MHGRLWLMIATFAELGL-VFVASSMAAKNSPAALPVFLIYSVLNGFTLSFVVAFYTPGTV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  ++  G  TK+DL  +G  ++    GL +  +VN+F+ S   D  +S 
Sbjct: 109 LSAFVSSALLFFVMAAIGIFTKKDLSGMGRALMAALVGLIIAMIVNIFLASGFFDYMISI 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
             +++FS L A+D QKI+  Y   R  VA     S+  AL +Y+DFI +F+ +LR  G R
Sbjct: 169 AMVLVFSGLIAWDNQKIRYVYEQSRGQVATGWVISM--ALSIYLDFINLFLSILRIFG-R 225

Query: 258 RD 259
            D
Sbjct: 226 ND 227


>gi|148544614|ref|YP_001271984.1| hypothetical protein Lreu_1398 [Lactobacillus reuteri DSM 20016]
 gi|184153972|ref|YP_001842313.1| hypothetical protein LAR_1317 [Lactobacillus reuteri JCM 1112]
 gi|227363733|ref|ZP_03847842.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri MM2-3]
 gi|325682943|ref|ZP_08162459.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri MM4-1A]
 gi|148531648|gb|ABQ83647.1| protein of unknown function UPF0005 [Lactobacillus reuteri DSM
           20016]
 gi|183225316|dbj|BAG25833.1| conserved hypothetical protein [Lactobacillus reuteri JCM 1112]
 gi|227071227|gb|EEI09541.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri MM2-3]
 gi|324977293|gb|EGC14244.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri MM4-1A]
          Length = 235

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 71/127 (55%)

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           Y    I   F  +A+ F ++++ G  + RD   IGS+      GL +  LVN F++S  I
Sbjct: 108 YAGTDIATAFVSSASVFLTMAIIGTFSHRDFTRIGSYASAALIGLIIAMLVNFFVQSPMI 167

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           +  +S + ++IF+ALTA+D Q++K  Y +      +   +V+GAL LY+DFI +F+  L 
Sbjct: 168 NYLLSIVAVIIFTALTAWDAQRMKNIYIECNGQVSSNGLAVLGALQLYLDFINLFISFLD 227

Query: 253 FLGSRRD 259
             GS  D
Sbjct: 228 IFGSSND 234


>gi|322385980|ref|ZP_08059620.1| membrane protein [Streptococcus cristatus ATCC 51100]
 gi|321269963|gb|EFX52883.1| membrane protein [Streptococcus cristatus ATCC 51100]
          Length = 227

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 79/247 (31%), Positives = 122/247 (49%), Gaps = 37/247 (14%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           + GL ++  +VY  + +G+ ++ ++S                     G+MLT F   +  
Sbjct: 9   NSGLSSFYSKVYGFVGMGIAISALVS---------------------GLMLTTFQTALVD 47

Query: 82  SPL--RWIFIFAPLGVFIFLNVRL-HSLSAY------AAKMMFLLYSALIGLSLSSFFLV 132
             L  RWI+  A     IFL V L  S S+       AA  +FL YSAL G ++S    +
Sbjct: 48  ILLHYRWIYYGA-----IFLEVALVWSASSMGLRNSPAALPLFLSYSALNGFTMSFIVAM 102

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT   + + F ++AA F  ++  G   K+DL  +G  M  G  G+ + S VN+F+ S  I
Sbjct: 103 YTGGVVFKAFAVSAAVFLVMAAMGLVIKKDLSGMGRAMFAGLIGIVIASFVNIFLGSDMI 162

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           D  +S + +VIF+ L A+D QKI+  Y      A     ++  AL LY+DFI +F+ +LR
Sbjct: 163 DYIVSYVSVVIFAGLIAWDNQKIRYVYEQTGGQA-GLGWALSLALSLYLDFINLFLSILR 221

Query: 253 FLGSRRD 259
             G R D
Sbjct: 222 IFG-RND 227


>gi|320547385|ref|ZP_08041674.1| membrane protein [Streptococcus equinus ATCC 9812]
 gi|320447981|gb|EFW88735.1| membrane protein [Streptococcus equinus ATCC 9812]
          Length = 230

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/224 (31%), Positives = 115/224 (51%), Gaps = 20/224 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GL  +  ++Y L+ +G+G++  +SFL+  + T    +  +II N+  +   +GA+   
Sbjct: 12  DSGLNRFFAKIYGLVGMGIGLSAFVSFLMLYVFT---DNMINIITNQPFVY--YGAIFLE 66

Query: 82  SPLRWIFIFAPLGVFIFLNV-RLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
             L          VF+  N  R ++LSA     +FL YSAL G +LS   + YT  +++Q
Sbjct: 67  LAL----------VFLASNAARKNTLSALP---LFLFYSALNGFTLSFVIVAYTQTTVLQ 113

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            F  +A  FG +S+ G+  K+DL       I    G+ + S VN+F+ S  +   +S + 
Sbjct: 114 AFVSSALVFGVMSVLGFVIKKDLSGFAKAAIAALIGIIIASFVNMFIGSGMMSFVISIIS 173

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
           ++IFS L AYD Q IK  Y         +  ++  AL LY+DFI
Sbjct: 174 VLIFSGLIAYDNQMIKHVYQHT-GGNVGDGWAISMALSLYLDFI 216


>gi|227889984|ref|ZP_04007789.1| conserved hypothetical protein [Lactobacillus johnsonii ATCC 33200]
 gi|227849428|gb|EEJ59514.1| conserved hypothetical protein [Lactobacillus johnsonii ATCC 33200]
          Length = 131

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 70/127 (55%)

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT + I   F  +A  F  +++ G  TK+DL   GS+      GL +  L+N+F++SSA 
Sbjct: 3   YTGQDIASAFVASATVFVVMAILGTVTKKDLSRWGSYASAALIGLIVAMLINMFLKSSAA 62

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           +   S + ++IF+ LTA+D Q++K  Y            +V+GAL LY+DF+ +F+  L 
Sbjct: 63  NYIFSFIAVIIFTVLTAWDAQRMKNIYLQFGGEVSTNGLAVMGALQLYLDFVNLFLQFLT 122

Query: 253 FLGSRRD 259
             GS  +
Sbjct: 123 IFGSNDN 129


>gi|315611868|ref|ZP_07886787.1| membrane protein [Streptococcus sanguinis ATCC 49296]
 gi|331265657|ref|YP_004325287.1| hypothetical protein SOR_0259 [Streptococcus oralis Uo5]
 gi|315316046|gb|EFU64079.1| membrane protein [Streptococcus sanguinis ATCC 49296]
 gi|326682329|emb|CBY99946.1| conserved hypothetical protein [Streptococcus oralis Uo5]
          Length = 227

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 121/242 (50%), Gaps = 31/242 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA-----L 78
           GL  +  +VY  + LG+G++ ++S                      +MLT F +     L
Sbjct: 11  GLNQFYAKVYAFVGLGIGLSALVS---------------------ALMLTVFQSQLVYFL 49

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           M+      I  FA L + +F+   + + ++ AA  +FL+YS L G +LS     YT  ++
Sbjct: 50  MHGRLWLMIATFAELAL-VFVASSMAAKNSPAALPVFLVYSVLNGFTLSFVVAFYTPGTV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  ++  G  TK+DL  +G  ++    GL +  +VNLF+ +S  D  +S 
Sbjct: 109 LSAFVSSALLFFVMAAIGIFTKKDLSGMGRALMAALVGLIIAMVVNLFLANSFFDYMISI 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
             +++FS L A+D QKI+  Y   R  VA     S+  AL +Y+DFI +F+ +LR  G R
Sbjct: 169 AMVLVFSGLIAWDNQKIRYVYEQSRGQVATGWVISM--ALSIYLDFINLFLSILRIFG-R 225

Query: 258 RD 259
            D
Sbjct: 226 ND 227


>gi|303228474|ref|ZP_07315305.1| putative membrane protein [Veillonella atypica ACS-134-V-Col7a]
 gi|303231871|ref|ZP_07318582.1| putative membrane protein [Veillonella atypica ACS-049-V-Sch6]
 gi|302513478|gb|EFL55509.1| putative membrane protein [Veillonella atypica ACS-049-V-Sch6]
 gi|302516832|gb|EFL58743.1| putative membrane protein [Veillonella atypica ACS-134-V-Col7a]
          Length = 248

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 102/208 (49%), Gaps = 25/208 (12%)

Query: 74  GFGALMYTSPLRW------IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
           G   LM  S  R+      I + A + V    ++R +  +  +   MF +YSAL G++LS
Sbjct: 43  GIATLMNPSWARFAASNFNILLIAEVAVVFLFSMRTYKANVMSLYAMFFIYSALNGVTLS 102

Query: 128 SFFLVY-TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
              L Y   ++ V       A F + S+ G TTK++L  +  +++   FG+ ++SLV  F
Sbjct: 103 LVSLAYGIMEATVPALIGALAFFVAFSIVGLTTKKNLAGLTPYLVAAIFGMIIVSLV--F 160

Query: 187 MRSS-------------AIDLTMSAMGLVIFSALTAYDTQKIKEAYSD---RYDVAYAER 230
           M +S              I L +  +G+V+FS  TA D   IK + +      D    +R
Sbjct: 161 MAASYFSIPYLSSISYSTISLILGYIGVVVFSIFTAVDMNMIKNSVTQLALSEDETILDR 220

Query: 231 QSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             + GAL LY+DFI +F+ LLR  G+RR
Sbjct: 221 IEIAGALSLYLDFINLFLSLLRIFGNRR 248


>gi|306824476|ref|ZP_07457822.1| membrane protein [Streptococcus sp. oral taxon 071 str. 73H25AP]
 gi|304433263|gb|EFM36233.1| membrane protein [Streptococcus sp. oral taxon 071 str. 73H25AP]
          Length = 227

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 122/242 (50%), Gaps = 31/242 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA-----L 78
           GL  +  +VY  + LG+G++ ++S                      +MLT F +     L
Sbjct: 11  GLNQFYAKVYAFVGLGIGLSALVS---------------------ALMLTVFQSQLIYFL 49

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           M+      I  FA L + +F+   + + ++ AA  +FL+YS L G +LS     YT  ++
Sbjct: 50  MHGRLWLMIATFAELAL-VFVASSMATKNSPAALPVFLVYSVLNGFTLSFVVAFYTPGTV 108

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +  F  +A  F  +++ G  +K+DL  +G  ++    GL +  +VNLF+ +S  D  +S 
Sbjct: 109 LSAFISSALLFFVMAVIGIFSKKDLSGMGRALMAALVGLIIAMVVNLFLANSFFDYMISI 168

Query: 199 MGLVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
             +++FS L A+D QKI+  Y   R  VA     S+  AL +Y+DFI +F+ +LR  G R
Sbjct: 169 AMVLVFSGLIAWDNQKIRYVYEQSRGQVATGWIISM--ALSIYLDFINLFLSILRIFG-R 225

Query: 258 RD 259
            D
Sbjct: 226 ND 227


>gi|171742619|ref|ZP_02918426.1| hypothetical protein BIFDEN_01732 [Bifidobacterium dentium ATCC
           27678]
 gi|283456301|ref|YP_003360865.1| hypothetical protein BDP_1433 [Bifidobacterium dentium Bd1]
 gi|171278233|gb|EDT45894.1| hypothetical protein BIFDEN_01732 [Bifidobacterium dentium ATCC
           27678]
 gi|283102935|gb|ADB10041.1| Conserved hypothetical membrane protein [Bifidobacterium dentium
           Bd1]
          Length = 284

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 72/252 (28%), Positives = 128/252 (50%), Gaps = 44/252 (17%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           ++  R  + R Y  M +GL VT +++ +                      +TG    +Y 
Sbjct: 62  EEAQRVSVTRAYGEMTIGLLVTAVVAIVTQ--------------------MTG----LYI 97

Query: 82  SPLRW--IF-IFAPLGVFIFLNVRLHS----LSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           + L++  IF +FAP  V I L V L +    ++  +A++MF +Y+AL+G +LS  F VY 
Sbjct: 98  TFLQYTGIFGVFAPAIVQIVLAVYLGACITRMTPSSARVMFYVYAALMGFTLSIIFAVYD 157

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS-LVNLFMRSSAID 193
             +I  +  + A  F +L++ G TTK ++   G  ++ G   L +   L+ +F       
Sbjct: 158 LGTIGISLALCAGFFFALTMLGRTTKFNMLKAGPVLLAGLIVLIIAEVLLAIFAPGDTAL 217

Query: 194 LTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYA-------ERQSVIGALMLYMDFIQI 246
           + +SA+GLV+F+ +T YD Q  +  ++      YA       ++ S++ AL LY+DF+ +
Sbjct: 218 MLISAIGLVLFAGMTVYDAQATRALFAQ-----YAGEGPDMIKKISILCALNLYLDFVNM 272

Query: 247 FVHLLRFLGSRR 258
           F+++LR  GSR 
Sbjct: 273 FLYILRLFGSRN 284


>gi|269798462|ref|YP_003312362.1| hypothetical protein Vpar_1404 [Veillonella parvula DSM 2008]
 gi|282849950|ref|ZP_06259333.1| putative membrane protein [Veillonella parvula ATCC 17745]
 gi|294792869|ref|ZP_06758016.1| putative membrane protein [Veillonella sp. 6_1_27]
 gi|294794629|ref|ZP_06759765.1| putative membrane protein [Veillonella sp. 3_1_44]
 gi|269095091|gb|ACZ25082.1| protein of unknown function UPF0005 [Veillonella parvula DSM 2008]
 gi|282580387|gb|EFB85787.1| putative membrane protein [Veillonella parvula ATCC 17745]
 gi|294454959|gb|EFG23332.1| putative membrane protein [Veillonella sp. 3_1_44]
 gi|294456768|gb|EFG25131.1| putative membrane protein [Veillonella sp. 6_1_27]
          Length = 247

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 104/205 (50%), Gaps = 20/205 (9%)

Query: 74  GFGALMYTSPLRW------IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
           GF AL+  + LR+      I +   LGV    + R +S +    + MF LYSAL GL+L+
Sbjct: 43  GFAALVNPNWLRFAYQNFNIILLVELGVVFLFSARAYSANVMTLRGMFFLYSALNGLTLT 102

Query: 128 SFFLVYTSKSIVQTFFI-TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
              L Y    +V    I T A F   ++ G TTKR+L  +  +++   FG+ ++SLV + 
Sbjct: 103 LVSLRYNVFDVVIPALIGTLAFFIGFAVVGATTKRNLSSLTPYVMAALFGMIIVSLVMMG 162

Query: 187 MR----------SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD---RYDVAYAERQSV 233
            R          S  + L +  +G+V+FS  TA D  +IK   +      D    +R  +
Sbjct: 163 ARFFNWTVLSGFSDTVSLVLGYVGVVVFSIFTAIDVNRIKNNVTQVALMEDETILDRIEI 222

Query: 234 IGALMLYMDFIQIFVHLLRFLGSRR 258
            GAL LY+DFI +F+ LLR  G++R
Sbjct: 223 TGALSLYLDFINLFLSLLRIFGNKR 247


>gi|312865998|ref|ZP_07726219.1| putative membrane protein [Streptococcus downei F0415]
 gi|311098402|gb|EFQ56625.1| putative membrane protein [Streptococcus downei F0415]
          Length = 234

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 119/238 (50%), Gaps = 20/238 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D GL  +  ++Y L+ +G+G++ I+S L+      V P+    I + G M+   GA++  
Sbjct: 16  DAGLSRFFAKIYGLVGMGIGLSAIISALM----IFVFPENMYAIKSGGRMIY-LGAILLE 70

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
             L            +F+       +   A  +FL+YSA+ G +LS     YT   +V  
Sbjct: 71  IAL------------VFVASSAARRNTPWALPLFLIYSAMNGFTLSFVIAAYTGVEVVGA 118

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F  +AA F  ++  G T K+DL  +   +I G  G+ +  LVNLF+ S  I L +S + +
Sbjct: 119 FVSSAAVFFIMAAVGATIKKDLSGMAKALIAGLIGIIIAGLVNLFLGSGMISLLISLVTV 178

Query: 202 VIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           VIFS L AY+ Q IK  Y   R  V   +  ++  AL LY+DFI +F+ +L   G R 
Sbjct: 179 VIFSGLIAYENQMIKRVYGQTRGQV--TDGWAISMALSLYLDFINLFLSILNIFGRRN 234


>gi|255311659|ref|ZP_05354229.1| putative membrane transport protein [Chlamydia trachomatis 6276]
 gi|255317960|ref|ZP_05359206.1| putative membrane transport protein [Chlamydia trachomatis 6276s]
          Length = 238

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 112/237 (47%), Gaps = 35/237 (14%)

Query: 31  RVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIF 90
           RVY  M  GL VT + S  + + AT                    GA     P+ WI+ F
Sbjct: 21  RVYGWMTAGLAVTALTS--LGLYAT--------------------GAYRALFPMWWIWCF 58

Query: 91  APLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK---SIVQTFFITAA 147
           A LGV  ++  ++  LS  A   +FL YS L G+   +   VY ++    +V   F +A 
Sbjct: 59  ATLGVSFYIQAQIQKLSVPAVMGLFLAYSILEGMFFGTLVPVYAAQFGGGVVWAAFGSAG 118

Query: 148 -SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL----VNLFMRSSAIDLTMSAMGLV 202
             FG  + YG  TK DL  I   +++   GL ++SL    V+LF     + L +  +GL+
Sbjct: 119 IIFGLSAAYGAFTKNDLTQIHRILMLALVGLVVISLAFLIVSLFTPMPLLYLLICYLGLI 178

Query: 203 IFSALTAYDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           IF  LT  D Q I+    +  D  D++Y  + S+I AL +Y + I IF +LL+   S
Sbjct: 179 IFVGLTVVDAQSIRRVARSVGDHGDLSY--KLSLIMALQMYCNVIMIFWYLLQIFAS 233


>gi|257878420|ref|ZP_05658073.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257882838|ref|ZP_05662491.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|257889381|ref|ZP_05669034.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
 gi|257894394|ref|ZP_05674047.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|258616061|ref|ZP_05713831.1| hypothetical protein EfaeD_10133 [Enterococcus faecium DO]
 gi|260560009|ref|ZP_05832187.1| conserved hypothetical protein [Enterococcus faecium C68]
 gi|293559955|ref|ZP_06676463.1| integral membrane protein [Enterococcus faecium E1162]
 gi|293569015|ref|ZP_06680328.1| integral membrane protein [Enterococcus faecium E1071]
 gi|294623287|ref|ZP_06702152.1| integral membrane protein [Enterococcus faecium U0317]
 gi|314937783|ref|ZP_07845100.1| membrane family protein [Enterococcus faecium TX0133a04]
 gi|314941671|ref|ZP_07848551.1| membrane family protein [Enterococcus faecium TX0133C]
 gi|314948918|ref|ZP_07852287.1| membrane family protein [Enterococcus faecium TX0082]
 gi|314950963|ref|ZP_07854030.1| membrane family protein [Enterococcus faecium TX0133A]
 gi|314992965|ref|ZP_07858361.1| membrane family protein [Enterococcus faecium TX0133B]
 gi|314996412|ref|ZP_07861455.1| membrane family protein [Enterococcus faecium TX0133a01]
 gi|257812648|gb|EEV41406.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257818496|gb|EEV45824.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|257825741|gb|EEV52367.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
 gi|257830773|gb|EEV57380.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|260073844|gb|EEW62168.1| conserved hypothetical protein [Enterococcus faecium C68]
 gi|291588448|gb|EFF20283.1| integral membrane protein [Enterococcus faecium E1071]
 gi|291597315|gb|EFF28501.1| integral membrane protein [Enterococcus faecium U0317]
 gi|291606043|gb|EFF35469.1| integral membrane protein [Enterococcus faecium E1162]
 gi|313589394|gb|EFR68239.1| membrane family protein [Enterococcus faecium TX0133a01]
 gi|313592488|gb|EFR71333.1| membrane family protein [Enterococcus faecium TX0133B]
 gi|313596818|gb|EFR75663.1| membrane family protein [Enterococcus faecium TX0133A]
 gi|313599562|gb|EFR78405.1| membrane family protein [Enterococcus faecium TX0133C]
 gi|313642814|gb|EFS07394.1| membrane family protein [Enterococcus faecium TX0133a04]
 gi|313644708|gb|EFS09288.1| membrane family protein [Enterococcus faecium TX0082]
          Length = 227

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 117/241 (48%), Gaps = 19/241 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           ST   G+  +  +VY  + +GL ++ + S+L    A  V P   +  IN   +  GF  L
Sbjct: 5   STSMSGINRFYAKVYGFLGMGLALSAVTSYL----ALWVFPLQLATFINNFPL--GFVGL 58

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
                  WI     L + + L V+     + A    F+ YS L G++L+     Y   ++
Sbjct: 59  -------WI---VELILVMVLGVKAQKNPSLAIGG-FIAYSLLNGITLAVTLAYYDIGTV 107

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMS 197
            Q F      F  +S+ G TTKRDL  +G        G+ +  ++N+F +RSS ++L +S
Sbjct: 108 TQAFLTATLMFMGMSVVGVTTKRDLSGVGRAGQAALIGVIIALVLNIFILRSSVVELFIS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            + +VIF+ +TAYD Q I+  Y      A++   +V  AL LY+DFI +F+  LR  G  
Sbjct: 168 LLLVVIFAGITAYDNQSIRNIYVQTNGTAHSG-IAVFMALKLYLDFINLFLAFLRIFGRN 226

Query: 258 R 258
            
Sbjct: 227 N 227


>gi|15605554|ref|NP_220340.1| transport permease [Chlamydia trachomatis D/UW-3/CX]
 gi|76789564|ref|YP_328650.1| transporter [Chlamydia trachomatis A/HAR-13]
 gi|166154163|ref|YP_001654281.1| putative membrane transport protein [Chlamydia trachomatis 434/Bu]
 gi|166155038|ref|YP_001653293.1| putative membrane transport protein [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|237803251|ref|YP_002888445.1| putative membrane transport protein [Chlamydia trachomatis
           B/Jali20/OT]
 gi|237805172|ref|YP_002889326.1| putative membrane transport protein [Chlamydia trachomatis
           B/TZ1A828/OT]
 gi|255349223|ref|ZP_05381230.1| putative membrane transport protein [Chlamydia trachomatis 70]
 gi|255503760|ref|ZP_05382150.1| putative membrane transport protein [Chlamydia trachomatis 70s]
 gi|255507441|ref|ZP_05383080.1| putative membrane transport protein [Chlamydia trachomatis
           D(s)2923]
 gi|301335407|ref|ZP_07223651.1| putative membrane transport protein [Chlamydia trachomatis L2tet1]
 gi|15214368|sp|O84826|Y819_CHLTR RecName: Full=Uncharacterized protein CT_819
 gi|3329288|gb|AAC68416.1| Transport Permease [Chlamydia trachomatis D/UW-3/CX]
 gi|76168094|gb|AAX51102.1| transporter [Chlamydia trachomatis A/HAR-13]
 gi|165930151|emb|CAP03635.1| putative membrane transport protein [Chlamydia trachomatis 434/Bu]
 gi|165931026|emb|CAP06589.1| putative membrane transport protein [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|231273472|emb|CAX10388.1| putative membrane transport protein [Chlamydia trachomatis
           B/TZ1A828/OT]
 gi|231274485|emb|CAX11281.1| putative membrane transport protein [Chlamydia trachomatis
           B/Jali20/OT]
 gi|289525865|emb|CBJ15347.1| putative membrane transport protein [Chlamydia trachomatis Sweden2]
 gi|296435450|gb|ADH17628.1| putative membrane transport protein [Chlamydia trachomatis E/150]
 gi|296436374|gb|ADH18548.1| putative membrane transport protein [Chlamydia trachomatis G/9768]
 gi|296437305|gb|ADH19475.1| putative membrane transport protein [Chlamydia trachomatis G/11222]
 gi|296438233|gb|ADH20394.1| putative membrane transport protein [Chlamydia trachomatis G/11074]
 gi|296439167|gb|ADH21320.1| putative membrane transport protein [Chlamydia trachomatis E/11023]
 gi|297140734|gb|ADH97492.1| putative membrane transport protein [Chlamydia trachomatis G/9301]
 gi|297748948|gb|ADI51494.1| Transporter [Chlamydia trachomatis D-EC]
 gi|297749828|gb|ADI52506.1| Transporter [Chlamydia trachomatis D-LC]
          Length = 238

 Score = 79.3 bits (194), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 112/237 (47%), Gaps = 35/237 (14%)

Query: 31  RVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIF 90
           RVY  M  GL VT + S  + + AT                    GA     P+ WI+ F
Sbjct: 21  RVYGWMTAGLAVTALTS--LGLYAT--------------------GAYRALFPMWWIWCF 58

Query: 91  APLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK---SIVQTFFITAA 147
           A LGV  ++  ++  LS  A   +FL YS L G+   +   VY ++    +V   F +A 
Sbjct: 59  ATLGVSFYIQAQIQKLSVPAVMGLFLAYSILEGMFFGTLVPVYAAQFGGGVVWAAFGSAG 118

Query: 148 -SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL----VNLFMRSSAIDLTMSAMGLV 202
             FG  + YG  TK DL  I   +++   GL ++SL    V+LF     + L +  +GL+
Sbjct: 119 IIFGLSAAYGAFTKNDLTQIHRILMLALVGLVVISLAFLIVSLFTPMPLLYLLICYLGLI 178

Query: 203 IFSALTAYDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           IF  LT  D Q I+    +  D  D++Y  + S+I AL +Y + I IF +LL+   S
Sbjct: 179 IFVGLTVVDAQSIRRVARSVGDHGDLSY--KLSLIMALQMYCNVIMIFWYLLQIFAS 233


>gi|218282598|ref|ZP_03488836.1| hypothetical protein EUBIFOR_01422 [Eubacterium biforme DSM 3989]
 gi|218216469|gb|EEC90007.1| hypothetical protein EUBIFOR_01422 [Eubacterium biforme DSM 3989]
          Length = 236

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 123/235 (52%), Gaps = 24/235 (10%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP- 83
           L++ +++ Y  MA+ L +T ++S+   + AT              +M+     L+ T P 
Sbjct: 15  LKSALLKSYAWMAVALSITAVVSY--GLYAT------------NALMI-----LLSTMPF 55

Query: 84  LRWIFIFAPLGVFIFLNVRL-HSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
           L  +F+ AP  + I   V +  S S+   K+M +LY+  +G+SL+S   VY   +I   F
Sbjct: 56  LFMLFVIAPFILSIAFGVSMARSTSSTGMKVMLVLYAICMGVSLTSIGYVYDVATIGTAF 115

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            ++A  F SL++ G T+K+D    GS  ++G F L +     +  R S     +S + L+
Sbjct: 116 LVSAVYFISLAVIGTTSKKDFTSFGSLCMIGLFVLIITQCFMMLFRVSMDVRLLSIITLL 175

Query: 203 IFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           IF+ +T +D Q++      SD   VA  ++ ++  AL LY+DF+ IF+ +L+ +G
Sbjct: 176 IFTGITVWDVQRMNRLLIQSDGSIVA-QDKIAIFMALQLYLDFLNIFLRILQLIG 229


>gi|194466863|ref|ZP_03072850.1| protein of unknown function UPF0005 [Lactobacillus reuteri 100-23]
 gi|194453899|gb|EDX42796.1| protein of unknown function UPF0005 [Lactobacillus reuteri 100-23]
          Length = 235

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 70/127 (55%)

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           Y    I   F  +A  F ++++ G  + RD   IGS+      GL +  LVN F++S  I
Sbjct: 108 YAGTDIATAFVSSAGVFLTMAIIGTFSHRDFTRIGSYASAALIGLIIAMLVNFFVQSPMI 167

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           +  +S + ++IF+ALTA+D Q++K  Y +      +   +V+GAL LY+DFI +F+  L 
Sbjct: 168 NYLLSIVAVIIFTALTAWDAQRMKNIYIECNGQVSSNGLAVLGALQLYLDFINLFISFLD 227

Query: 253 FLGSRRD 259
             GS  +
Sbjct: 228 IFGSSNE 234


>gi|15834826|ref|NP_296585.1| hypothetical protein TC0206 [Chlamydia muridarum Nigg]
 gi|270284992|ref|ZP_06194386.1| hypothetical protein CmurN_01028 [Chlamydia muridarum Nigg]
 gi|270289015|ref|ZP_06195317.1| hypothetical protein CmurW_01073 [Chlamydia muridarum Weiss]
 gi|301336389|ref|ZP_07224591.1| hypothetical protein CmurM_01100 [Chlamydia muridarum MopnTet14]
 gi|15214357|sp|Q9PLA1|Y206_CHLMU RecName: Full=Uncharacterized protein TC_0206
 gi|7190243|gb|AAF39078.1| conserved hypothetical protein [Chlamydia muridarum Nigg]
          Length = 238

 Score = 78.6 bits (192), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 112/237 (47%), Gaps = 35/237 (14%)

Query: 31  RVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIF 90
           RVY  M  GL VT + S  + + AT                    GA      L W++ F
Sbjct: 21  RVYGWMTAGLAVTALTS--LGLYAT--------------------GAYRTLFSLWWVWCF 58

Query: 91  APLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK---SIVQTFFITAA 147
           A LGV  ++  ++  LS  A   +FL YS L G+   +   VY ++    IV   F +AA
Sbjct: 59  ATLGVSFYIQAQIQKLSVPAVMGLFLAYSVLEGMFFGTMVPVYAAQFGGGIVWAAFGSAA 118

Query: 148 S-FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL----VNLFMRSSAIDLTMSAMGLV 202
             FG  + YG  TK DL  I   +++   GL ++SL    V+LF     + L +  +GL+
Sbjct: 119 VIFGLSAAYGAFTKSDLTQIHRILMLALIGLMVISLGFLVVSLFTPMPLMYLLICYLGLI 178

Query: 203 IFSALTAYDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           IF  LT  D Q I+    +  D  D++Y  + S+I AL +Y + I IF +LL+   S
Sbjct: 179 IFVGLTVVDAQSIRRVARSVGDHGDLSY--KLSLIMALQMYCNVIMIFWYLLQIFAS 233


>gi|294790988|ref|ZP_06756146.1| putative membrane protein [Scardovia inopinata F0304]
 gi|294458885|gb|EFG27238.1| putative membrane protein [Scardovia inopinata F0304]
          Length = 298

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 127/265 (47%), Gaps = 37/265 (13%)

Query: 5   RNYQRVVNSGSGFGSTID-QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + YQ  +++ + +  T D Q  R  +IR Y  M LG+ VT +++FL              
Sbjct: 61  QAYQNTIDTTASY--TQDAQAQRVSVIRAYFEMFLGILVTAVVAFL-------------- 104

Query: 64  IIINRGVMLTGFGALMY-----TSPLR-WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
                    T +    Y     T  +  W    A + +   L+ R+  +S   A+++F L
Sbjct: 105 ---------TAYNGWYYYYAKATGTIGLWGLFIAQIAIVFVLSTRVTKMSTPVARLVFYL 155

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           Y+A +G +LS+ F +Y   +I     +++  F  L++ G TTKR+L   G  ++     L
Sbjct: 156 YAATMGFTLSTIFAIYNIGTIGIALGLSSLFFLVLTMIGLTTKRNLLKAGPILMAALITL 215

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIK---EAYSDRYDVAYAERQSVI 234
            ++ ++ L + +S   + +S + +V+F+  T YD Q  +     Y  + ++   +R S++
Sbjct: 216 LVVEVILLIINASGSTMLISGISVVLFAGFTMYDAQSSRALLAQYQGQPEM--IKRVSIL 273

Query: 235 GALMLYMDFIQIFVHLLRFLGSRRD 259
            AL LY+DFI  F++LL  LG   +
Sbjct: 274 CALNLYLDFINFFINLLSLLGGSDN 298


>gi|293364740|ref|ZP_06611457.1| membrane protein [Streptococcus oralis ATCC 35037]
 gi|307702987|ref|ZP_07639934.1| putative membrane protein [Streptococcus oralis ATCC 35037]
 gi|291316190|gb|EFE56626.1| membrane protein [Streptococcus oralis ATCC 35037]
 gi|307623380|gb|EFO02370.1| putative membrane protein [Streptococcus oralis ATCC 35037]
          Length = 227

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 122/241 (50%), Gaps = 29/241 (12%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA-LMY-- 80
           GL  +  +VY  + LG+G++ ++S                      +MLT F + L+Y  
Sbjct: 11  GLNQFYAKVYAFVGLGIGLSALVS---------------------ALMLTVFQSQLVYFL 49

Query: 81  TSPLRWIFIFAPLG-VFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIV 139
           T    W+ I A +  V + +   + + ++ AA  +FL+YS L G +LS     YT  +++
Sbjct: 50  THGSLWLMIAAFVEFVLVVVASSMAAKNSPAALPVFLVYSVLNGFTLSFVVAFYTPGTVL 109

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
             F  +A  F  ++  G  TK+DL  +G  ++    GL +  +VNLF+ +S  D  +S  
Sbjct: 110 SAFVSSALLFFVMATIGIFTKKDLSGMGRALMAALVGLIIAMVVNLFLANSFFDYMISIA 169

Query: 200 GLVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            +++FS L A+D QKI+  Y   R  VA     S+  AL +Y+DFI +F+ +LR  G R 
Sbjct: 170 MVLVFSGLIAWDNQKIRYVYEQSRGQVATGWVISM--ALSIYLDFINLFLSILRIFG-RN 226

Query: 259 D 259
           D
Sbjct: 227 D 227


>gi|329943128|ref|ZP_08291902.1| hypothetical protein G5Q_0809 [Chlamydophila psittaci Cal10]
 gi|332287711|ref|YP_004422612.1| putative membrane transport protein [Chlamydophila psittaci 6BC]
 gi|325507088|gb|ADZ18726.1| putative membrane transport protein [Chlamydophila psittaci 6BC]
 gi|328814675|gb|EGF84665.1| hypothetical protein G5Q_0809 [Chlamydophila psittaci Cal10]
 gi|328914964|gb|AEB55797.1| membrane protein [Chlamydophila psittaci 6BC]
          Length = 237

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 79/243 (32%), Positives = 116/243 (47%), Gaps = 40/243 (16%)

Query: 31  RVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS--PLRWIF 88
           RVY  M  GL VT  +S                     G+  +G    MY S     W++
Sbjct: 21  RVYGWMTAGLAVTTFVSL--------------------GLYFSG----MYRSLFSFWWVW 56

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK---SIVQTFFIT 145
             A LGV  ++N ++H LS  A   +FL YSAL GL   +   VY ++    IV   F +
Sbjct: 57  CIATLGVSFYINAKIHKLSVPAVMGLFLAYSALEGLFFGTLVPVYAAQYGGGIVWAAFGS 116

Query: 146 AA-SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV----NLFMRSSAIDLTMSAMG 200
           A   FG  + YG  TK DL  + S ++    GL L+S++    +LF+      L +  +G
Sbjct: 117 AGLIFGLSAAYGAFTKSDLTQMSSILMFALIGLMLVSVIFGVASLFVYMPLFYLLICYLG 176

Query: 201 LVIFSALTAYDTQKIKEA---YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR-FLGS 256
           L IF  LT  D Q I+ A     +  D++Y  + S+I AL +Y + I IF +LL+ F  S
Sbjct: 177 LAIFVGLTVVDAQAIRRAAQNVGNDGDLSY--KLSLIMALKMYCNVIMIFWYLLQIFSSS 234

Query: 257 RRD 259
           +R+
Sbjct: 235 KRN 237


>gi|238854282|ref|ZP_04644626.1| integral membrane protein, interacts with FtsH [Lactobacillus
           gasseri 202-4]
 gi|238833093|gb|EEQ25386.1| integral membrane protein, interacts with FtsH [Lactobacillus
           gasseri 202-4]
          Length = 232

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 70/127 (55%), Gaps = 5/127 (3%)

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT + I      +A+ F  +++ G  TKRDL  IGS+      GL +  L+NLF+++  I
Sbjct: 110 YTGEDIA-----SASVFIVMAILGTVTKRDLSRIGSYASAALIGLIVAMLINLFLKNPTI 164

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           D   S + ++IF+ LTA+D Q+IK  Y            +V+GAL LY+DF+ +F+  L 
Sbjct: 165 DYIFSFIAVIIFTILTAWDAQRIKNIYLQFGGELSTNGLAVLGALQLYLDFVNLFLQFLD 224

Query: 253 FLGSRRD 259
             GS  +
Sbjct: 225 IFGSNDN 231


>gi|261207885|ref|ZP_05922570.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289566953|ref|ZP_06447357.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|260078268|gb|EEW65974.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289161252|gb|EFD09148.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
          Length = 227

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 116/241 (48%), Gaps = 19/241 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           ST   G+  +  +VY  + +GL ++ + S+L    A  V P   +  IN   +  GF  L
Sbjct: 5   STSMSGINRFYAKVYGFLGMGLALSAVTSYL----ALWVFPLQLATFINNFPL--GFVGL 58

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
                  WI     L + + L V+     + A    F+ YS L G++L+     Y   ++
Sbjct: 59  -------WI---VELILVMVLGVKAQKNPSLAIGG-FIAYSLLNGITLAVTLAYYDIGTV 107

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMS 197
            Q F      F  +S+ G TTKRDL  +G        G+ +   +N+F +RSS ++L +S
Sbjct: 108 TQAFLTATLMFMGMSVVGVTTKRDLSGVGRAGQAALIGVIIALGLNIFILRSSVVELFIS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            + +VIF+ +TAYD Q I+  Y      A++   +V  AL LY+DFI +F+  LR  G  
Sbjct: 168 LLLVVIFAGITAYDNQSIRNIYVQTNGTAHSG-IAVFMALKLYLDFINLFLAFLRIFGRN 226

Query: 258 R 258
            
Sbjct: 227 N 227


>gi|294617840|ref|ZP_06697451.1| integral membrane protein [Enterococcus faecium E1679]
 gi|291595913|gb|EFF27195.1| integral membrane protein [Enterococcus faecium E1679]
          Length = 227

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 116/241 (48%), Gaps = 19/241 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           ST   G+  +  +VY  + +GL ++ + S+L    A  V P   +  IN   +  GF  L
Sbjct: 5   STSMSGINRFYAKVYGFLGMGLALSAVTSYL----ALWVFPLQLATFINNFPL--GFVGL 58

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
                  WI     L + + L V+     + A    F+ YS L G++L+     Y   ++
Sbjct: 59  -------WI---VELILVMVLGVKAQKNPSLAIGG-FIAYSLLNGITLAVTLAYYDIGTV 107

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMS 197
            Q F      F  +S+ G TTKRDL   G        G+ +  ++N+F +RSS ++L +S
Sbjct: 108 TQAFLTATLMFMGMSVVGVTTKRDLSGGGRAGQAALIGVIIALVLNIFILRSSVVELFIS 167

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            + +VIF+ +TAYD Q I+  Y      A++   +V  AL LY+DFI +F+  LR  G  
Sbjct: 168 LLLVVIFAGITAYDNQSIRNIYVQTNGTAHSG-IAVFMALKLYLDFINLFLAFLRIFGRN 226

Query: 258 R 258
            
Sbjct: 227 N 227


>gi|315226652|ref|ZP_07868440.1| conserved hypothetical protein [Parascardovia denticolens DSM
           10105]
 gi|315120784|gb|EFT83916.1| conserved hypothetical protein [Parascardovia denticolens DSM
           10105]
          Length = 312

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 95/177 (53%), Gaps = 5/177 (2%)

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           W  + A L + + L+  +  ++   A+++F LY+A +G +LS  F VY   +I   F ++
Sbjct: 138 WGIVIAQLVLVVVLSTNISKMNTTVARLIFYLYAASMGFTLSVVFGVYGLTTIGLAFGLS 197

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           +  F  L++ G TT+R+L   G  +      L ++ ++ +   +    + +S + +V+F+
Sbjct: 198 SLFFLVLTMIGLTTRRNLLAWGPILFAALLTLVVVEILLMIFNAGGATMLISGISIVLFA 257

Query: 206 ALTAYDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
             TAYD QK +     Y  + ++   ++ S++ AL LY+DFI  FV LL+ LG   D
Sbjct: 258 GFTAYDAQKTRVILGQYQGQPEM--IKKVSILCALDLYLDFINFFVSLLQLLGGSSD 312


>gi|294787009|ref|ZP_06752263.1| inner membrane protein YbhL [Parascardovia denticolens F0305]
 gi|294485842|gb|EFG33476.1| inner membrane protein YbhL [Parascardovia denticolens F0305]
          Length = 290

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 95/177 (53%), Gaps = 5/177 (2%)

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           W  + A L + + L+  +  ++   A+++F LY+A +G +LS  F VY   +I   F ++
Sbjct: 116 WGIVIAQLVLVVVLSTNISKMNTTVARLIFYLYAASMGFTLSVVFGVYGLTTIGLAFGLS 175

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           +  F  L++ G TT+R+L   G  +      L ++ ++ +   +    + +S + +V+F+
Sbjct: 176 SLFFLVLTMIGLTTRRNLLAWGPILFAALLTLVVVEILLMIFNAGGATMLISGISIVLFA 235

Query: 206 ALTAYDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
             TAYD QK +     Y  + ++   ++ S++ AL LY+DFI  FV LL+ LG   D
Sbjct: 236 GFTAYDAQKTRVILGQYQGQPEM--IKKVSILCALDLYLDFINFFVSLLQLLGGSSD 290


>gi|313848285|emb|CBY17286.1| putative membrane protein [Chlamydophila psittaci RD1]
          Length = 237

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 116/243 (47%), Gaps = 40/243 (16%)

Query: 31  RVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS--PLRWIF 88
           RVY  M  GL VT  +S                     G+  +G    MY S     W++
Sbjct: 21  RVYGWMTAGLAVTTFVSL--------------------GLYFSG----MYRSLFSFWWVW 56

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK---SIVQTFFIT 145
             A LGV  ++N ++H LS  A   +FL YSAL GL   +   VY ++    IV   F +
Sbjct: 57  CIATLGVSFYINAKIHKLSVPAVMGLFLAYSALEGLFFGTLVPVYAAQYGGGIVWAAFGS 116

Query: 146 AA-SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV----NLFMRSSAIDLTMSAMG 200
           A   FG  + YG  TK DL  + S ++    GL L+S++    +LF+      L +  +G
Sbjct: 117 AGLIFGLSAAYGAFTKSDLTQMSSILMFALIGLMLVSVIFGVASLFVYMPLFYLLICYLG 176

Query: 201 LVIFSALTAYDTQKIKEA---YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR-FLGS 256
           L IF  LT  D Q I+ A     +  D++Y  + S+I AL ++ + I IF +LL+ F  S
Sbjct: 177 LAIFVGLTVVDAQAIRRAAQNVGNDGDLSY--KLSLIMALKMHCNVIMIFWYLLQIFSSS 234

Query: 257 RRD 259
           +R+
Sbjct: 235 KRN 237


>gi|330443812|ref|YP_004376798.1| transport permease [Chlamydophila pecorum E58]
 gi|328806922|gb|AEB41095.1| transport permease [Chlamydophila pecorum E58]
          Length = 238

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 95/185 (51%), Gaps = 11/185 (5%)

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK---SIVQTF 142
           WI+    LGV  F+N RL +LS      +FL+YS L G+   +   +Y ++    +V   
Sbjct: 54  WIWCLGTLGVSFFINARLQTLSLPTVMSLFLVYSVLEGMFFGTVLPIYAAQYGGGVVWAA 113

Query: 143 FITAA-SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMS 197
           F +AA  FG  +LYG  TK DL  +   + +   GL     + ++V+LF+      L + 
Sbjct: 114 FGSAALVFGMAALYGALTKNDLTQMSKILTVAVMGLLAITVVFAIVSLFVFMPLFYLLIC 173

Query: 198 AMGLVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
            +GLVIF  LTA D Q I+   ++   D   + + S++ AL +Y + I +F +LL+   S
Sbjct: 174 YLGLVIFVGLTAADAQAIRRVAANVGNDSVVSYKLSLVMALKMYCNVIMVFWYLLQIFSS 233

Query: 257 --RRD 259
              RD
Sbjct: 234 SGNRD 238


>gi|116491262|ref|YP_810806.1| integral membrane protein, interacts with FtsH [Oenococcus oeni
           PSU-1]
 gi|290890809|ref|ZP_06553876.1| hypothetical protein AWRIB429_1266 [Oenococcus oeni AWRIB429]
 gi|116091987|gb|ABJ57141.1| Integral membrane protein, interacts with FtsH [Oenococcus oeni
           PSU-1]
 gi|290479581|gb|EFD88238.1| hypothetical protein AWRIB429_1266 [Oenococcus oeni AWRIB429]
          Length = 240

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 85/149 (57%), Gaps = 10/149 (6%)

Query: 116 LLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAF 175
           L ++ + G+   + F +Y  +SIV  F + A  FG+++LYG+ TK++L  +   +     
Sbjct: 97  LAFAVVEGIFFGAIFAMYDLQSIVSAFLMAAVDFGAMALYGFFTKKNLSRLAPILFGAMI 156

Query: 176 GLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQS--- 232
            L +  +V++F+        MS +G+++FS   AYD  ++K+ Y   +++     Q+   
Sbjct: 157 ALMVGLVVSIFV--PGFSFIMSVLGVLVFSVYAAYDNNRLKQMY---FELQGQGNQTING 211

Query: 233 --VIGALMLYMDFIQIFVHLLRFLGSRRD 259
             + GAL LY+DF+ +F++LLR  G++R+
Sbjct: 212 LAISGALSLYLDFVNLFLYLLRIFGNQRN 240


>gi|227878801|ref|ZP_03996709.1| possible integral membrane protein, interacts with FtsH
           [Lactobacillus crispatus JV-V01]
 gi|262046824|ref|ZP_06019784.1| integral membrane protein [Lactobacillus crispatus MV-3A-US]
 gi|293381143|ref|ZP_06627155.1| conserved hypothetical protein [Lactobacillus crispatus 214-1]
 gi|227861601|gb|EEJ69212.1| possible integral membrane protein, interacts with FtsH
           [Lactobacillus crispatus JV-V01]
 gi|260572806|gb|EEX29366.1| integral membrane protein [Lactobacillus crispatus MV-3A-US]
 gi|290922293|gb|EFD99283.1| conserved hypothetical protein [Lactobacillus crispatus 214-1]
          Length = 109

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 62/108 (57%)

Query: 152 LSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYD 211
           +++ G  TK+DL  IGS+      GL +  L NLF+ +  ID   S + ++IF+ LTA+D
Sbjct: 1   MAILGTITKKDLSRIGSYASAALIGLIVAMLANLFLHNPIIDYVFSIIAVIIFTILTAWD 60

Query: 212 TQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            Q++K+ Y    D       +V+GAL LY+DF+ +F+  L   G+  D
Sbjct: 61  AQRMKDIYLQYGDDLSTNGLAVLGALQLYLDFVNLFLQFLDIFGANED 108


>gi|256852249|ref|ZP_05557635.1| conserved hypothetical protein [Lactobacillus jensenii 27-2-CHN]
 gi|260661719|ref|ZP_05862630.1| integral membrane protein [Lactobacillus jensenii 115-3-CHN]
 gi|282934857|ref|ZP_06340090.1| inner membrane protein YbhL [Lactobacillus jensenii 208-1]
 gi|256615295|gb|EEU20486.1| conserved hypothetical protein [Lactobacillus jensenii 27-2-CHN]
 gi|260547466|gb|EEX23445.1| integral membrane protein [Lactobacillus jensenii 115-3-CHN]
 gi|281301088|gb|EFA93399.1| inner membrane protein YbhL [Lactobacillus jensenii 208-1]
          Length = 235

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 88/176 (50%), Gaps = 4/176 (2%)

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           W+ IF P  + + ++ +          ++  L S + G+  S     YT  +I   F   
Sbjct: 61  WVIIFLPFALCLGISFKAAKNPTLGFTLLMFL-SVVYGVEFSIIASYYTGTTITSAFLSA 119

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMSAMGLVIF 204
           A  F +++L+G  TKRDL   GS++     G  + +LVN+F ++S A     S +G++IF
Sbjct: 120 AGVFAAMALFGTFTKRDLSNWGSYLRAAMIGFIVATLVNVFFVKSGAGAYIFSYIGVLIF 179

Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG--SRR 258
           +  TAYD    K  + +  D       +++GAL +Y+DFI +F+ LL   G   RR
Sbjct: 180 TGWTAYDANSAKRIFIEYGDQVSDSGLAIMGALNMYLDFINLFMLLLEIFGVNDRR 235


>gi|297205585|ref|ZP_06922981.1| membrane protein [Lactobacillus jensenii JV-V16]
 gi|297150163|gb|EFH30460.1| membrane protein [Lactobacillus jensenii JV-V16]
          Length = 221

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 88/176 (50%), Gaps = 4/176 (2%)

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           W+ IF P  + + ++ +          ++  L S + G+  S     YT  +I   F   
Sbjct: 47  WVIIFLPFALCLGISFKAAKNPTLGFTLLMFL-SVVYGVEFSIIASYYTGTTITSAFLSA 105

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMSAMGLVIF 204
           A  F +++L+G  TKRDL   GS++     G  + +LVN+F ++S A     S +G++IF
Sbjct: 106 AGVFAAMALFGTFTKRDLSNWGSYLRAAMIGFIVATLVNVFFVKSGAGAYIFSYIGVLIF 165

Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG--SRR 258
           +  TAYD    K  + +  D       +++GAL +Y+DFI +F+ LL   G   RR
Sbjct: 166 TGWTAYDANSAKRIFIEYGDQVSDSGLAIMGALNMYLDFINLFMLLLEIFGVNDRR 221


>gi|46850169|gb|AAT02516.1| unknown [Chlamydomonas reinhardtii]
          Length = 248

 Score = 75.5 bits (184), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 121/251 (48%), Gaps = 29/251 (11%)

Query: 11  VNSGSGFGSTIDQGLRAYMIR-VYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRG 69
           V  G+   +  ++ +R   +R V+ L+A+ L +T +++                     G
Sbjct: 18  VEKGAALNAFAERTVRQGFVRKVFGLLAVQLALTTVIA---------------------G 56

Query: 70  VMLTGFGALMYTSPLRWIFIF---APLGVFIFLNVRLHSLSAYAAKMMFL-LYSALIGLS 125
             +T      + +   W+ +    A  G+ + L +   +  ++   ++ L +++A  G+ 
Sbjct: 57  TFVTSTAVKTFVAAHPWVLMLGMLAGFGILLTLTLSSSARQSHPTNLILLFVFTAAEGVL 116

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           + +      +  ++  F +TA    ++++Y  TTK DL   G+ +    +GL L  LV +
Sbjct: 117 VGAASSASRTDVVLLAFGLTAGITAAMTVYALTTKNDLTMSGAALYSCLWGLLLAGLVGM 176

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F+R+SA ++ +SA+G V+FS   AYD Q +       +  A +  + V+GA+ +Y+D I 
Sbjct: 177 FVRTSAFNILLSAVGAVVFSVYIAYDVQCL---LGGEHKYAVSPDEYVLGAIAIYLDIIN 233

Query: 246 IFVHLLRFLGS 256
           +F+H+LR L  
Sbjct: 234 LFMHILRLLNE 244


>gi|89898034|ref|YP_515144.1| transport permease [Chlamydophila felis Fe/C-56]
 gi|89331406|dbj|BAE80999.1| transport permease [Chlamydophila felis Fe/C-56]
          Length = 238

 Score = 75.5 bits (184), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 112/239 (46%), Gaps = 39/239 (16%)

Query: 31  RVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS--PLRWIF 88
           RVY  M  GL VT  +S                     G+  +G    MY S     W++
Sbjct: 21  RVYGWMTAGLAVTTFVSL--------------------GLYFSG----MYKSLFAFWWVW 56

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK---SIVQTFFIT 145
             A LGV  ++N ++H LS  A   +FL YSAL GL   +   VY ++    IV   F +
Sbjct: 57  CIATLGVSFYINAKIHKLSVPAVMGLFLAYSALEGLFFGTLVPVYAAQYGGGIVWAAFGS 116

Query: 146 AA-SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS----LVNLFMRSSAIDLTMSAMG 200
           A   FG  + YG  TK DL  + S ++    GL L+S    LV++F+      L +  +G
Sbjct: 117 AGLIFGLSAAYGAFTKSDLTQMRSILMFALIGLMLVSVIFALVSIFVYMPMFYLLICYIG 176

Query: 201 LVIFSALTAYDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           L IF  LT  D Q I+   +   +  D++Y  + S+I AL +Y + I IF +LL+   S
Sbjct: 177 LAIFVGLTVVDAQAIRSVAKNVGNDGDLSY--KLSLIMALKMYCNVIMIFWYLLQIFSS 233


>gi|313892939|ref|ZP_07826516.1| putative membrane protein [Veillonella sp. oral taxon 158 str.
           F0412]
 gi|313442292|gb|EFR60707.1| putative membrane protein [Veillonella sp. oral taxon 158 str.
           F0412]
          Length = 247

 Score = 75.1 bits (183), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 104/205 (50%), Gaps = 20/205 (9%)

Query: 74  GFGALMYTSPLRW------IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
           GF AL   + LR+      I +   +GV +  + R ++ +    + MF LYSAL GL+L+
Sbjct: 43  GFAALANPNWLRFAYQNFNIILLVEIGVIVLFSARAYTANVMTLRGMFFLYSALNGLTLT 102

Query: 128 SFFLVYTSKSIVQTFFI-TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
              L Y    +V    + T A F   ++ G TTKR+L  +  +++    G+ ++S V + 
Sbjct: 103 LISLRYNVFDVVIPALVGTLAFFIGFAVVGATTKRNLSSLTPYVMAVLIGMIIVSFVMIG 162

Query: 187 MR----------SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD---RYDVAYAERQSV 233
            R          S  + L +  +G+V+FS  TA D  +IK   ++     D +  +R  +
Sbjct: 163 ARYFNWAVLSAFSDTVSLVLGYVGVVVFSIFTAIDVNRIKNNVTEVALMEDESILDRIEI 222

Query: 234 IGALMLYMDFIQIFVHLLRFLGSRR 258
            GAL LY+DFI +F+ LLR  G++R
Sbjct: 223 TGALNLYLDFINLFLSLLRIFGNKR 247


>gi|238855406|ref|ZP_04645717.1| putative integral membrane protein [Lactobacillus jensenii 269-3]
 gi|260665353|ref|ZP_05866201.1| integral membrane protein [Lactobacillus jensenii SJ-7A-US]
 gi|282932083|ref|ZP_06337540.1| inner membrane protein YbhL [Lactobacillus jensenii 208-1]
 gi|238832004|gb|EEQ24330.1| putative integral membrane protein [Lactobacillus jensenii 269-3]
 gi|260560857|gb|EEX26833.1| integral membrane protein [Lactobacillus jensenii SJ-7A-US]
 gi|281303762|gb|EFA95907.1| inner membrane protein YbhL [Lactobacillus jensenii 208-1]
          Length = 235

 Score = 75.1 bits (183), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 88/176 (50%), Gaps = 4/176 (2%)

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           W+ IF P  + + ++ +          ++  L S + G+  S     YT  +I   F   
Sbjct: 61  WVIIFLPFALCLGISFKAAKNPTLGFTLLMFL-SVVYGVEFSIIASYYTGTTITSAFLSA 119

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMSAMGLVIF 204
           A  F +++L+G  TK+DL   GS++     G  + +LVN+F ++S A     S +G++IF
Sbjct: 120 AGVFAAMALFGTFTKKDLSSWGSYLRAAMIGFIVATLVNIFFVKSGAGAYIFSYIGVLIF 179

Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG--SRR 258
           +  TAYD    K  + +  D       +++GAL +Y+DFI +F+ LL   G   RR
Sbjct: 180 TGWTAYDANSAKRIFIEYGDQVSDSGLAIMGALNMYLDFINLFMLLLEIFGVNDRR 235


>gi|126727998|ref|ZP_01743817.1| hypothetical protein RB2150_16554 [Rhodobacterales bacterium
           HTCC2150]
 gi|126702722|gb|EBA01836.1| hypothetical protein RB2150_16554 [Rhodobacterales bacterium
           HTCC2150]
          Length = 81

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 57/80 (71%), Gaps = 3/80 (3%)

Query: 182 LVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALM 238
           +VN+F++S AI   +S +G++IF+ LTAYDTQKIK  Y   +   D  +  + +++GAL 
Sbjct: 2   VVNIFLQSPAIMFAISIIGVLIFAGLTAYDTQKIKNTYLEMAHSGDQEWLAKSAIMGALN 61

Query: 239 LYMDFIQIFVHLLRFLGSRR 258
           LY+DF+ +F+ LL+FLG+R 
Sbjct: 62  LYLDFVNLFMFLLQFLGNRE 81


>gi|159476610|ref|XP_001696404.1| predicted transmembrane protein [Chlamydomonas reinhardtii]
 gi|158282629|gb|EDP08381.1| predicted transmembrane protein [Chlamydomonas reinhardtii]
 gi|294845977|gb|ADF43136.1| NMDA1p [Chlamydomonas reinhardtii]
 gi|294846021|gb|ADF43179.1| NMDA1m [Chlamydomonas reinhardtii]
          Length = 248

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 70/119 (58%), Gaps = 3/119 (2%)

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           ++  F +TA    ++++Y  TTK DL   G+ +    +GL L  LV +F+R+SA ++ +S
Sbjct: 129 VLLAFGLTAGITAAMTVYALTTKNDLTMSGAALYSCLWGLLLAGLVGMFVRTSAFNILLS 188

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           A+G V+FS   AYD Q +       +  A +  + V+GA+ +Y+D I +F+H+LR L  
Sbjct: 189 AVGAVVFSVYIAYDVQCL---LGGEHKYAVSPDEYVLGAIAIYLDIINLFMHILRLLNE 244


>gi|62185366|ref|YP_220151.1| hypothetical protein CAB754 [Chlamydophila abortus S26/3]
 gi|62148433|emb|CAH64201.1| putative membrane protein [Chlamydophila abortus S26/3]
          Length = 238

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/239 (31%), Positives = 110/239 (46%), Gaps = 39/239 (16%)

Query: 31  RVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS--PLRWIF 88
           RVY  M  GL VT                      I+ G+  +G    MY S     W++
Sbjct: 21  RVYGWMTAGLAVT--------------------TFISLGLYFSG----MYRSLFSFWWVW 56

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK---SIVQTFFIT 145
             A LGV  ++  R+H LS  A   +FL YSA  GL   +   VY ++    +V   F +
Sbjct: 57  CIATLGVSFYIKARIHKLSVPAVMGLFLAYSAFEGLFFGTLVPVYAAQYGGGVVWAAFGS 116

Query: 146 AA-SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS----LVNLFMRSSAIDLTMSAMG 200
           A   FG  + YG  TK DL  + S ++    GL L+S    LV++F+      L +  +G
Sbjct: 117 AGLIFGLSAAYGAFTKTDLTQMHSILMFALIGLLLVSVIFALVSIFVYMPIFYLLICYLG 176

Query: 201 LVIFSALTAYDTQKIKEA---YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           L IF  LT  D Q I+ A     +  D++Y  + S+I AL +Y + I IF +LL+   S
Sbjct: 177 LAIFVGLTVVDAQAIRRAAQNVGNDDDLSY--KVSLIMALKMYCNVIMIFWYLLQIFSS 233


>gi|58269994|ref|XP_572153.1| vacuole  protein [Cryptococcus neoformans var. neoformans JEC21]
 gi|134113673|ref|XP_774421.1| hypothetical protein CNBG0670 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257059|gb|EAL19774.1| hypothetical protein CNBG0670 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57228389|gb|AAW44846.1| vacuole protein, putative [Cryptococcus neoformans var. neoformans
           JEC21]
          Length = 283

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 117/246 (47%), Gaps = 37/246 (15%)

Query: 19  STIDQGLRAYMIR-VYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
           S  D  +R   IR VY+++ + L  T  +S L+++      P A                
Sbjct: 69  SDCDTEIRMLFIRKVYSILLIQLLATAGVSILLSL------PSAKD-------------- 108

Query: 78  LMYTSP-LRWIFIFAPLGVFIFLNVRLHSLSAYAAKM-MFLLYSA-LIGLSLSSFFLVYT 134
             +T+P + WI +        F+  + H   A    + +F L+ A +IGL++S     Y 
Sbjct: 109 FTHTNPWIMWIPLIGSFTSLFFVYWKRHQHPANLILLGLFTLFEATMIGLAVS----YYE 164

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR-SSAID 193
           S+ ++Q  FIT   F  L+L+ + TK D       + +G +GL    L+ +F+  ++ +D
Sbjct: 165 SRIVIQALFITLGVFIGLTLFTFQTKYDFSSFAPILFIGIWGLLTTYLIQIFLPFNATVD 224

Query: 194 LTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
           L ++    ++FS    YDTQ+I +  S          +++ GAL LY+DF+ +F+ +LR 
Sbjct: 225 LGIACFSTLLFSGFVLYDTQQIMKRLS--------VDEAIAGALTLYLDFLNLFLSILRI 276

Query: 254 LGSRRD 259
           L +  D
Sbjct: 277 LNNSND 282


>gi|302828320|ref|XP_002945727.1| hypothetical protein VOLCADRAFT_72329 [Volvox carteri f.
           nagariensis]
 gi|300268542|gb|EFJ52722.1| hypothetical protein VOLCADRAFT_72329 [Volvox carteri f.
           nagariensis]
          Length = 243

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 71/124 (57%), Gaps = 3/124 (2%)

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
           + ++V  F +TA    +++++  TTK D+   GS +  G  GL    LV  F++++A ++
Sbjct: 122 TDAVVLAFGLTAGITAAMAIWALTTKHDITTSGSALYAGLLGLIFAGLVGFFVQTTAFNI 181

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
            +S +G V+FS   AYD Q +       +  A +  + V+GA+ +Y+D I +F+H+LR L
Sbjct: 182 AVSGIGAVLFSIYIAYDVQCL---LGGDHKYAVSPDEYVMGAIAIYLDVINLFMHILRLL 238

Query: 255 GSRR 258
            S R
Sbjct: 239 SSNR 242


>gi|313893062|ref|ZP_07826639.1| putative membrane protein [Veillonella sp. oral taxon 158 str.
           F0412]
 gi|313442415|gb|EFR60830.1| putative membrane protein [Veillonella sp. oral taxon 158 str.
           F0412]
          Length = 248

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 93/189 (49%), Gaps = 19/189 (10%)

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY-TSKSIVQTFFIT 145
           I +   L V    ++R ++ +  +   MF +YSAL G++L