BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780452|ref|YP_003064865.1| hypothetical protein
CLIBASIA_01685 [Candidatus Liberibacter asiaticus str. psy62]
         (259 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|15889937|ref|NP_355618.1| hypothetical protein Atu2682 [Agrobacterium tumefaciens str. C58]
 gi|15157894|gb|AAK88403.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 260

 Score =  178 bits (451), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 149/260 (57%), Positives = 197/260 (75%), Gaps = 1/260 (0%)

Query: 1   MSDIRNYQ-RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D  NYQ R+  + +  G+ ID+GLRAYM++VYNLMAL L +TG+ +F   +LATT DP
Sbjct: 1   MADFNNYQNRMAQTRAQSGAMIDEGLRAYMLKVYNLMALALVITGVAAFGFAMLATTTDP 60

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
            AA   +  G MLT  GAL+Y SPLRW+ + APLG+  FL+ R+ ++S  AA+  F +Y+
Sbjct: 61  AAAVATLPNGKMLTSLGALVYASPLRWVVMLAPLGLVFFLSFRIQNMSVSAAQSTFWVYA 120

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           AL+G+SLSS FL YT  SIVQTFF+TAASFG+LSLYGYTTK+DL  IGSF+IMG FGL +
Sbjct: 121 ALMGVSLSSIFLRYTEGSIVQTFFVTAASFGALSLYGYTTKKDLSGIGSFLIMGLFGLII 180

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            S+VN+F+ S A+   +SA+G++IF+ LTAYDTQKIKE Y D  DVA A R++++GAL L
Sbjct: 181 ASIVNIFLGSGALQFAISAIGVLIFAGLTAYDTQKIKEMYFDADDVAVAGRKAIMGALTL 240

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y+DFI +F  LL+FLG+R D
Sbjct: 241 YLDFINLFTFLLQFLGNRND 260


>gi|90421112|ref|ZP_01229014.1| conserved hypothetical membrane protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334604|gb|EAS48384.1| conserved hypothetical membrane protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 295

 Score =  173 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 113/257 (43%), Positives = 173/257 (67%), Gaps = 6/257 (2%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M++ RN        +G  + IDQGLR+YM++VYNLMA G+ +TG+ ++ + +L+   +  
Sbjct: 44  MAEYRNAGARTVPAAGSRADIDQGLRSYMLKVYNLMAGGVALTGVAAYALYMLSFVTNDA 103

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                    V LT  G  ++ +PL+W+ + APLG+  FL+ R+H +S  AA+  F +YSA
Sbjct: 104 ------GNVVGLTQLGNTLFNTPLKWVVMLAPLGMVFFLSFRVHKMSVAAAQTTFWIYSA 157

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           ++G+SL+S F VYT +SI Q FFITAASFG+LSL+GYTTKRD+   GSF+ MG  G+ + 
Sbjct: 158 MVGVSLASIFAVYTGESITQVFFITAASFGALSLWGYTTKRDISGWGSFLFMGVIGIVIA 217

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +VN+F+ S A+   +S +G+++F+ LTAYDTQ+IKE Y +        R++V+GAL LY
Sbjct: 218 MVVNIFLASPALQFAISVIGVLVFAGLTAYDTQQIKEMYYEGDGSTVMGRKAVMGALRLY 277

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DF+ +F+ LL+  G+R
Sbjct: 278 LDFLNMFLFLLQLFGNR 294


>gi|222150083|ref|YP_002551040.1| hypothetical protein Avi_4182 [Agrobacterium vitis S4]
 gi|221737065|gb|ACM38028.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 256

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 141/258 (54%), Positives = 194/258 (75%), Gaps = 2/258 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MSD RNYQ    +G G    IDQGLR+YM++VYNLM LGL +TG+ ++++ +LATT D  
Sbjct: 1   MSDFRNYQ--ARTGVGSAEMIDQGLRSYMLKVYNLMGLGLAITGVAAYVIAMLATTTDTS 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A      G+MLT  GA +Y SPL+W+ + AP+G+  FL+ ++ S+S  AA+  FL+Y+ 
Sbjct: 59  QAVGQFGNGIMLTSLGAAIYGSPLKWVIMLAPIGLVFFLSFKIQSMSVSAARTTFLVYAG 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L+YT +S+VQTFF+TAASFG+LSLYGYTTKR L  +GSF+IMG FGL + 
Sbjct: 119 LVGLSLSSILLIYTGQSVVQTFFVTAASFGALSLYGYTTKRSLSAMGSFLIMGLFGLIIA 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           SLVN+F++SSA+   +SA+G+VIF+ LTAYDTQKIKE Y ++     A R++++GAL LY
Sbjct: 179 SLVNIFLQSSALAFAVSAIGVVIFAGLTAYDTQKIKEMYFEQDGADTAGRKAILGALTLY 238

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DFI +F+ +LRF+G RR
Sbjct: 239 LDFINLFLFMLRFMGDRR 256


>gi|118592344|ref|ZP_01549736.1| hypothetical protein SIAM614_25991 [Stappia aggregata IAM 12614]
 gi|118435002|gb|EAV41651.1| hypothetical protein SIAM614_25991 [Stappia aggregata IAM 12614]
          Length = 260

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 122/255 (47%), Positives = 179/255 (70%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D ++      +G+   + IDQGLR YM+ VYN M +GL +TG ++    +LATT DP++A
Sbjct: 5   DRQSQGAYTVAGARAEAGIDQGLRTYMLGVYNYMTIGLALTGFLALATVMLATTTDPNSA 64

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
              +  G MLT  G  +Y SPL+W+ + APLG+  +L+ R+ S+SA AA+ +F +Y++++
Sbjct: 65  VASLGNGRMLTQLGVAIYDSPLKWVVMLAPLGMVFWLSFRIQSMSAGAARTLFFVYASVM 124

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G+SLSS FLVYT  SI Q FFITA +FG+LSL+GYTTK+DL   GSF+ +G  G+ + SL
Sbjct: 125 GISLSSIFLVYTPGSIAQVFFITAGTFGALSLFGYTTKKDLSGWGSFLFIGLIGIVIASL 184

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           VN+FM SSA+   +S +G+++F+ LTAYDTQ+IKE Y +      A ++SV+GAL LY+D
Sbjct: 185 VNIFMASSALQFAISVIGVLVFAGLTAYDTQQIKEMYYEGDSGEVATKKSVMGALRLYLD 244

Query: 243 FIQIFVHLLRFLGSR 257
           FI +F+ LL+  G+R
Sbjct: 245 FINLFIMLLQLFGNR 259


>gi|315122100|ref|YP_004062589.1| hypothetical protein CKC_01750 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495502|gb|ADR52101.1| hypothetical protein CKC_01750 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 259

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 181/259 (69%), Positives = 219/259 (84%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MSDIR+YQRV NS  GF STIDQGLRAYMI+VYNLMALGL VTGI+SFL++  ATT+DP 
Sbjct: 1   MSDIRDYQRVQNSRGGFDSTIDQGLRAYMIKVYNLMALGLVVTGIVSFLISGFATTLDPY 60

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
           AAS ++  GVMLT FG L+Y SPL W+ +FAPLGV IF++VR++SLS  AA++ F +Y+A
Sbjct: 61  AASYVLKSGVMLTSFGTLLYASPLSWVVMFAPLGVCIFMSVRINSLSINAARITFFVYAA 120

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           LIGL++SS F++YT+KSIVQTFFITAASF SLSLYGYTTK+DLGPIGSFM+MG  GLFLL
Sbjct: 121 LIGLAISSIFIMYTNKSIVQTFFITAASFVSLSLYGYTTKKDLGPIGSFMLMGVCGLFLL 180

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            L N+FM SS +D+ ++AMG+VIFSALTAYDTQ IKE Y+D Y + Y ERQSV+GAL LY
Sbjct: 181 MLANIFMGSSVVDMAIAAMGVVIFSALTAYDTQVIKEQYADNYGMEYIERQSVLGALRLY 240

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           MDF+ IF+ LLR LG+RRD
Sbjct: 241 MDFVNIFISLLRLLGNRRD 259


>gi|319780702|ref|YP_004140178.1| hypothetical protein Mesci_0964 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166590|gb|ADV10128.1| protein of unknown function UPF0005 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 259

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 141/259 (54%), Positives = 192/259 (74%), Gaps = 1/259 (0%)

Query: 1   MSD-IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D IRNYQ     G G G+ IDQGLRAYMI+VYNLM LGL +TG+ +    +LATT DP
Sbjct: 1   MADPIRNYQTRAVPGVGVGADIDQGLRAYMIKVYNLMGLGLLITGLAAVGTIMLATTTDP 60

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
            +A   +  G MLT FG  ++ SPLRW+ + APL   +FL+ R+ S+S  AA+  F +Y+
Sbjct: 61  ASAVATLPSGEMLTSFGYAIFGSPLRWVVMLAPLAAVLFLSFRVQSMSVSAAQTTFWVYA 120

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
            L+GLSLSS FLVYT+ SI QTFF TAA+FG+LSL+GYTTKRDL  +GSF+IMG FG+ +
Sbjct: 121 GLVGLSLSSIFLVYTTASISQTFFATAAAFGALSLFGYTTKRDLTAMGSFLIMGVFGIII 180

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            S++N+F++SSA+   +SA+G+++F+ LTAYDTQKIKE Y +      A R++++GAL L
Sbjct: 181 ASVINIFLQSSALSFAVSAIGVLVFAGLTAYDTQKIKEMYFEGDSSDVAGRKAIMGALTL 240

Query: 240 YMDFIQIFVHLLRFLGSRR 258
           Y+DFI +F+ LL+F+G RR
Sbjct: 241 YLDFINLFMFLLQFMGDRR 259


>gi|254780452|ref|YP_003064865.1| hypothetical protein CLIBASIA_01685 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040129|gb|ACT56925.1| hypothetical protein CLIBASIA_01685 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 259

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 259/259 (100%), Positives = 259/259 (100%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD
Sbjct: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
           AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA
Sbjct: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL
Sbjct: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY
Sbjct: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           MDFIQIFVHLLRFLGSRRD
Sbjct: 241 MDFIQIFVHLLRFLGSRRD 259


>gi|110635681|ref|YP_675889.1| hypothetical protein Meso_3353 [Mesorhizobium sp. BNC1]
 gi|110286665|gb|ABG64724.1| protein of unknown function UPF0005 [Chelativorans sp. BNC1]
          Length = 248

 Score =  168 bits (426), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 134/259 (51%), Positives = 189/259 (72%), Gaps = 11/259 (4%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D+RNYQ  V  G+   + ID+GLRAYMIRVYNLMALGL +TG+ ++     A   D  
Sbjct: 1   MADLRNYQARVTPGARVDTAIDEGLRAYMIRVYNLMALGLAITGLAAWGAFNFAVAADGQ 60

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                      LT FG L++ SPL+W+ IFAPL +  F++ R+H+LS  AA+ +F +Y+A
Sbjct: 61  -----------LTAFGQLLFVSPLKWVIIFAPLALVFFISFRIHTLSVSAAQSIFWVYAA 109

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLS+ FLVYT +SIV+TFFITAASFG+LSL+GYTT+RDL  +GSF+ MG  G+ + 
Sbjct: 110 LVGLSLSTIFLVYTQESIVRTFFITAASFGALSLWGYTTRRDLSGMGSFLFMGLIGIVIA 169

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           S+VN+F+ SSA+   +S +G+++F+ LTAYDTQ+IKE Y +  D   A R++++GAL LY
Sbjct: 170 SIVNIFLGSSALQFAISVIGVLVFAGLTAYDTQQIKEMYYEGDDQLVAGRKAIMGALRLY 229

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DF+ +F+ LL+FLGS R+
Sbjct: 230 LDFLNLFMFLLQFLGSNRE 248


>gi|307943801|ref|ZP_07659145.1| inner membrane protein YbhL [Roseibium sp. TrichSKD4]
 gi|307773431|gb|EFO32648.1| inner membrane protein YbhL [Roseibium sp. TrichSKD4]
          Length = 261

 Score =  168 bits (425), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 127/256 (49%), Positives = 180/256 (70%), Gaps = 1/256 (0%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D         +GS   + ID+GLRAYM+ VYN M  GL +TG  +    +LATT DP AA
Sbjct: 5   DRNTQAPYQVAGSHAEAGIDEGLRAYMLGVYNYMTFGLALTGFFALGTAMLATTSDPSAA 64

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
              +  G +LT  GA +Y SPL+W+ + APLG+ ++L+ R+ S+SA  A+ MFL+Y+A++
Sbjct: 65  VAQLGNGQLLTQLGATLYGSPLKWVVMLAPLGMVLWLSFRIQSMSASGARTMFLVYAAVM 124

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G+SLSS FLVYT  SI + FFITAA+FG LSL+GYTTK+DL  +GSF++MG  G+F+ SL
Sbjct: 125 GVSLSSIFLVYTGGSIARVFFITAAAFGGLSLFGYTTKKDLSGLGSFLVMGLIGIFIASL 184

Query: 183 VNL-FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYM 241
           VN+ F+ SSA+   +S +G+++F+ LTAYDTQ+IKE Y +      A ++SV+GAL LY+
Sbjct: 185 VNMLFLESSALQFAISVIGVLVFAGLTAYDTQQIKEMYYEGDGHEVATKKSVMGALRLYL 244

Query: 242 DFIQIFVHLLRFLGSR 257
           DFI +F+ LL+  G+R
Sbjct: 245 DFINLFLMLLQLFGNR 260


>gi|260467318|ref|ZP_05813492.1| protein of unknown function UPF0005 [Mesorhizobium opportunistum
           WSM2075]
 gi|259028922|gb|EEW30224.1| protein of unknown function UPF0005 [Mesorhizobium opportunistum
           WSM2075]
          Length = 257

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 141/255 (55%), Positives = 187/255 (73%), Gaps = 2/255 (0%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           IRNYQ  V  G+G    IDQGLRAYM++VYNLM LGL +TG+ +    +LATT DP +A 
Sbjct: 5   IRNYQTRVVPGAGVD--IDQGLRAYMVKVYNLMGLGLLITGLAAVGTIMLATTTDPASAV 62

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
             +  G MLT FG  ++ SPLRW+ I APL   +FL+ R+ S+S  AA+  F +Y+ L+G
Sbjct: 63  ATLPSGEMLTSFGYAIFGSPLRWVVILAPLAAVMFLSFRVQSMSVSAAQTTFWVYAGLVG 122

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSLSS FLVYT+ SI QTFF TAA FG+LSLYGYTTKRDL  +GSF+IMG FGL +  ++
Sbjct: 123 LSLSSIFLVYTTASIAQTFFATAAGFGALSLYGYTTKRDLTAMGSFLIMGVFGLIIAMVI 182

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F++SSA+   +SA+G++IF+ LTAYDTQKIKE Y +      A R++++GAL LY+DF
Sbjct: 183 NIFLQSSALSFAVSAIGVLIFAGLTAYDTQKIKEMYFEGDASDVAGRKAIMGALRLYLDF 242

Query: 244 IQIFVHLLRFLGSRR 258
           I +F+ LL+F+G RR
Sbjct: 243 INLFMFLLQFMGDRR 257


>gi|158422583|ref|YP_001523875.1| hypothetical protein AZC_0959 [Azorhizobium caulinodans ORS 571]
 gi|158329472|dbj|BAF86957.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 261

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 132/260 (50%), Positives = 187/260 (71%), Gaps = 1/260 (0%)

Query: 1   MSDI-RNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           MSD  RN      S +   + IDQGLRAYM+RVYN MALGL +TG  +  + +L+ T +P
Sbjct: 1   MSDYDRNVAARYGSVTRSEAAIDQGLRAYMLRVYNYMALGLAITGAAALGIFMLSVTTNP 60

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
            AA+  +  G+MLT FG  ++ SPL+W+ + APL    FL+ R+ S+S  AA+ +F  Y+
Sbjct: 61  GAAAGQVAGGIMLTQFGYALFVSPLKWVVMLAPLAAVFFLSFRIQSMSVGAAQAVFWGYA 120

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           AL+G+SLSS FLVYT +SIV+ FFITAASFG+LSL+GYTTKRDL  +GSF+IMG FG+ +
Sbjct: 121 ALVGISLSSIFLVYTHESIVRVFFITAASFGALSLWGYTTKRDLTGMGSFLIMGLFGIII 180

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            SLVN+F+ SS +   +S +G+++F+ LTAYDTQ+IKE Y +  D   A +++++GAL L
Sbjct: 181 ASLVNIFLASSMLQFIVSVVGVLVFAGLTAYDTQRIKEMYFEADDDVVAGKKAIMGALTL 240

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y+DFI +F+ LL+  G+R +
Sbjct: 241 YLDFINLFMMLLQLFGNRNN 260


>gi|154245986|ref|YP_001416944.1| hypothetical protein Xaut_2043 [Xanthobacter autotrophicus Py2]
 gi|154160071|gb|ABS67287.1| protein of unknown function UPF0005 [Xanthobacter autotrophicus
           Py2]
          Length = 261

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 123/257 (47%), Positives = 180/257 (70%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D     R   S +   + IDQGLR YM+ VYN MALGL +TG  +  + +L+ T DP  A
Sbjct: 5   DRNVAGRFNPSVARSQAAIDQGLRTYMLSVYNYMALGLAITGAAALGIYLLSVTTDPSQA 64

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
           +  +  G+MLT FG  ++ SPL+W+ +FAPL    FL+ R+  +S  AA++ F +Y+AL+
Sbjct: 65  AGRVAGGIMLTQFGYALFVSPLKWVVMFAPLAAVFFLSFRIERMSVSAAQITFWVYAALV 124

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G SLS+ FLVYT +SIV+ FFITAASFG+LSLYGYTTK+DL  +GSF++MG FG+ + SL
Sbjct: 125 GTSLSTIFLVYTHESIVRVFFITAASFGALSLYGYTTKKDLSGMGSFLMMGLFGIIIASL 184

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           VN+F+ S+ +   +S +G+++F+ LTAYDTQ+IKE Y    D +   +++++GAL LY+D
Sbjct: 185 VNIFLGSTMLQFIVSVVGVLVFAGLTAYDTQRIKEMYFVGDDGSVMGKKAIMGALSLYLD 244

Query: 243 FIQIFVHLLRFLGSRRD 259
           FI +F+ LL+  G+R +
Sbjct: 245 FINMFMMLLQLFGNRNN 261


>gi|153007445|ref|YP_001368660.1| hypothetical protein Oant_0100 [Ochrobactrum anthropi ATCC 49188]
 gi|151559333|gb|ABS12831.1| protein of unknown function UPF0005 [Ochrobactrum anthropi ATCC
           49188]
          Length = 260

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 141/259 (54%), Positives = 184/259 (71%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNS--GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVD 58
           M+D RN Q       G+   + IDQGLR+YM+ VYN+MA+GL VTG+ +F V  LATT D
Sbjct: 1   MADFRNIQAQQRPVGGARADAGIDQGLRSYMLGVYNMMAIGLAVTGLAAFAVAALATTTD 60

Query: 59  PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
           P AA   +  G MLTG G  +YTSPLRW+ + APL    FL+ R+  LS   A  +F  Y
Sbjct: 61  PSAAVAQLANGKMLTGLGVALYTSPLRWVVMLAPLAAVFFLSFRIERLSVSTANAVFWGY 120

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
           +AL+GLSLSS FLV+T +SIV+TFF+TAASFG+LSLYGYTTKRDL  +GSF+IMG FGL 
Sbjct: 121 AALVGLSLSSIFLVFTGQSIVRTFFVTAASFGALSLYGYTTKRDLSAMGSFLIMGLFGLI 180

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALM 238
           L S+VN+F+ S+A+   +S +G++IF+ LTAYDTQ IKE Y +        R+ V+GAL 
Sbjct: 181 LASVVNIFLGSTALQFAISVIGVLIFAGLTAYDTQSIKEMYYEGDSSDAHGRKVVMGALR 240

Query: 239 LYMDFIQIFVHLLRFLGSR 257
           LY+DFI +F  LL+F+G+R
Sbjct: 241 LYLDFINMFTFLLQFMGNR 259


>gi|114705370|ref|ZP_01438278.1| hypothetical protein FP2506_10536 [Fulvimarina pelagi HTCC2506]
 gi|114540155|gb|EAU43275.1| hypothetical protein FP2506_10536 [Fulvimarina pelagi HTCC2506]
          Length = 252

 Score =  163 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 112/257 (43%), Positives = 176/257 (68%), Gaps = 6/257 (2%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D RN        +G  + IDQGLR+YM++VYNLMA G+ +TG+ ++++ +L+   +  
Sbjct: 1   MADYRNTSARTVPAAGTRADIDQGLRSYMLKVYNLMAGGVALTGVAAYVMYMLSFVTNDA 60

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                  + V LT  G  ++ +PL+W+ + APLG+  FL+ R+H +S  AA+  F +Y+A
Sbjct: 61  ------GQVVGLTQLGNTLFNTPLKWVVMLAPLGMVFFLSFRIHKMSVAAAQTTFWVYAA 114

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           ++G+SL+S F V+T +SI Q FFITAASFG+LSL+GYTTKRD+   GSF+ MG  G+ + 
Sbjct: 115 MVGVSLASIFAVFTGESITQVFFITAASFGALSLWGYTTKRDISGWGSFLFMGVIGIVIA 174

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +VN+F+ S A+   +S +G+++F+ LTAYDTQ+IKE Y +    A   R++++GAL LY
Sbjct: 175 MIVNIFLASPALQFAISVIGVLVFAGLTAYDTQQIKEMYYEGDGSAVMGRKAIMGALRLY 234

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DF+ +F+ LL+  G+R
Sbjct: 235 LDFLNMFLFLLQLFGNR 251


>gi|56697801|ref|YP_168171.1| hypothetical protein SPO2963 [Ruegeria pomeroyi DSS-3]
 gi|56679538|gb|AAV96204.1| membrane protein, putative [Ruegeria pomeroyi DSS-3]
          Length = 269

 Score =  162 bits (410), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 109/257 (42%), Positives = 170/257 (66%), Gaps = 3/257 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  +  + ++     + ID+GLRA+M +VY  M++G+ +T   ++ ++ LA T DP AA 
Sbjct: 12  MAQFDTIRSAAGSRAAQIDEGLRAHMNKVYGTMSVGMLITFAAAWAISGLAVTTDPGAAV 71

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
             ++    LT  G  +Y SPL+W+ IFAPL      +  ++ LSA AA+++F  ++ ++G
Sbjct: 72  AQLSADKYLTQIGYSLYASPLKWVIIFAPLAFVFGFSAAINRLSAAAAQLIFYTFAFVMG 131

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LS+SS FLV+T +SI+Q F ITA +F  LSLYGYTTK+DL  +G+F+IMG  GL +  +V
Sbjct: 132 LSISSIFLVFTGQSIIQVFLITAIAFAGLSLYGYTTKKDLSAMGTFLIMGLIGLIVAMVV 191

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD---RYDVAYAERQSVIGALMLY 240
           N+F+ SSA+   +SA+G++IF+ LTAYDTQ IK  Y       D  +  + +++GAL LY
Sbjct: 192 NIFLASSAMAFAISAIGVLIFAGLTAYDTQNIKNTYLQMAHSGDQEWLGKAAIMGALSLY 251

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DFI +F+ LL+ LG+R
Sbjct: 252 LDFINLFMFLLQLLGNR 268


>gi|239830938|ref|ZP_04679267.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239823205|gb|EEQ94773.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 260

 Score =  162 bits (410), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 138/259 (53%), Positives = 182/259 (70%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNS--GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVD 58
           M+D RN Q       G    + IDQGLR+YM+ VYN+MA+GL VTG+ +F V  LATT D
Sbjct: 1   MADFRNIQAQQRPVGGVRTDAGIDQGLRSYMLGVYNMMAIGLAVTGLAAFAVAALATTTD 60

Query: 59  PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
           P AA   +  G MLT  G  +YTSPLRW+ + APL    FL+ R+  +S   A  +F  Y
Sbjct: 61  PSAAVAQLANGKMLTSLGVALYTSPLRWVVMLAPLAAVFFLSFRIERMSVGTANAVFWGY 120

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
           +AL+GLSLSS FLV+T +SIV+TFF+TAASFG+LSLYGYTTKRDL  +GSF++MG FGL 
Sbjct: 121 AALVGLSLSSIFLVFTGQSIVRTFFVTAASFGALSLYGYTTKRDLSAMGSFLVMGLFGLI 180

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALM 238
           L S+VN+F+ S+A+   +S +G++IF+ LTAYDTQ IKE Y +        R+ V+GAL 
Sbjct: 181 LASVVNIFLGSTALQFAISVIGVLIFAGLTAYDTQSIKEMYYEGDSSDAHGRKVVMGALR 240

Query: 239 LYMDFIQIFVHLLRFLGSR 257
           LY+DFI +F  LL+F+G+R
Sbjct: 241 LYLDFINMFTFLLQFMGNR 259


>gi|13473668|ref|NP_105236.1| hypothetical protein mll4343 [Mesorhizobium loti MAFF303099]
 gi|14024418|dbj|BAB51022.1| mll4343 [Mesorhizobium loti MAFF303099]
          Length = 257

 Score =  162 bits (409), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 139/259 (53%), Positives = 188/259 (72%), Gaps = 3/259 (1%)

Query: 1   MSD-IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D IRNYQ     G      IDQGLRAYMI+VYNLM LGL +TG+ +    +LATT DP
Sbjct: 1   MADPIRNYQTSAVPGVRAD--IDQGLRAYMIKVYNLMGLGLLITGLAAVGTIMLATTTDP 58

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
            +A   +  G MLT FG  ++ SPLRW+ + APL    FL+ R+ S+S  AA+  F +Y+
Sbjct: 59  ASAVATLPSGEMLTSFGYAIFGSPLRWVVMLAPLAAVFFLSFRIQSMSVAAAQTTFWVYA 118

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
            L+GLSLSS FLVYT+ SI QTFF TAA+FG+LSLYGYTTKRDL  +GSF+IMG FG+ +
Sbjct: 119 GLVGLSLSSIFLVYTTASISQTFFATAAAFGALSLYGYTTKRDLTAMGSFLIMGVFGIII 178

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            +++N+F++SSA+   +SA+G+++F+ LTAYDTQKIKE Y +      A R++++GAL L
Sbjct: 179 ATVINIFLQSSALSFAVSAIGVLVFAGLTAYDTQKIKEMYFEGDASDIAGRKAIMGALRL 238

Query: 240 YMDFIQIFVHLLRFLGSRR 258
           Y+DFI +F+ LL+F+G RR
Sbjct: 239 YLDFINLFMFLLQFMGDRR 257


>gi|86359520|ref|YP_471412.1| hypothetical protein RHE_CH03940 [Rhizobium etli CFN 42]
 gi|86283622|gb|ABC92685.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 242

 Score =  161 bits (407), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 142/258 (55%), Positives = 190/258 (73%), Gaps = 16/258 (6%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D+RNYQ  V +G      IDQGLRAYM++VYNLMALGL +TG+ ++L    A      
Sbjct: 1   MADLRNYQSRVQTG----EMIDQGLRAYMLKVYNLMALGLAITGVAAYLGFNFAV----- 51

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                  +   LT FG L++ SPLRW+ I APL V  FL+ R+H +S  AA+  F +Y+A
Sbjct: 52  -------QDGQLTQFGVLLFQSPLRWVVILAPLAVVFFLSFRIHQMSVSAAQTTFWIYAA 104

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS FLVYT +S+VQTFF+TAASFG+LSLYGYTTKRDL  +GSF+IMG FGL + 
Sbjct: 105 LVGLSLSSIFLVYTGQSVVQTFFVTAASFGALSLYGYTTKRDLSAMGSFLIMGLFGLIIA 164

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           SLVN+F+ SSA+   +S +G++IF+ LTAYDTQ+IKE Y +  DVA A R++++GAL LY
Sbjct: 165 SLVNIFLASSALQFAISVIGVLIFAGLTAYDTQRIKELYYEADDVAVAGRKAIMGALTLY 224

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DF+ +F+ LL+F+G+RR
Sbjct: 225 LDFLNLFMFLLQFMGNRR 242


>gi|240849690|ref|YP_002971078.1| hypothetical membrane protein [Bartonella grahamii as4aup]
 gi|240266813|gb|ACS50401.1| hypothetical membrane protein [Bartonella grahamii as4aup]
          Length = 257

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 130/259 (50%), Positives = 182/259 (70%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M++ +N +    S +   ++IDQGLR YM+ VYN MA+GL +T   ++++  LATT D  
Sbjct: 1   MANFKNLRSAPTSHA--DASIDQGLRDYMLGVYNTMAIGLLITAAAAYVIVSLATTTDMS 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A+  IN  V LT FG   YTSP  +I +FAPL   +FL+ ++++LS  AA+ +F  Y+A
Sbjct: 59  QAAAQINSSVYLTSFGVTFYTSPFSYIVMFAPLIAVLFLSFKINTLSTNAARSLFFGYAA 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT++S+VQTF I+AA+FG+LSLYGYTTKRDL  IGSF+ +G  GLFL 
Sbjct: 119 LVGLSLSSIVLRYTTESVVQTFVISAAAFGALSLYGYTTKRDLTAIGSFLFIGLIGLFLS 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +VN+F+ SSA+   +S +G++IF+ LTAYDTQ IK  Y +  +     R+ ++GAL LY
Sbjct: 179 MIVNIFLGSSALQFAISVIGVLIFAGLTAYDTQSIKLMYYEGDESDTRGRKVIMGALNLY 238

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +FV LL+FLGS RD
Sbjct: 239 LDFINMFVFLLQFLGSNRD 257


>gi|262277853|ref|ZP_06055646.1| integral membrane protein [alpha proteobacterium HIMB114]
 gi|262224956|gb|EEY75415.1| integral membrane protein [alpha proteobacterium HIMB114]
          Length = 252

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 107/258 (41%), Positives = 164/258 (63%), Gaps = 6/258 (2%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+      RV +S +    ++ +GLR+YM++VYN MA G+ +TG ++  +   +   D  
Sbjct: 1   MNLKDRMARVQSSATVANDSVHEGLRSYMLKVYNFMASGVLLTGFVALGLFKFSVVTD-- 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                    V LT  G  +Y+S L W+    PLG+  +++  ++ +SA  A+ +F +++A
Sbjct: 59  ----QAGNIVGLTSLGNAIYSSALMWVIALTPLGIVFYMSFGINKMSAQRAQTVFWIFAA 114

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+G SLSS FL YT  SI + FFITA +FG++SLYGYTTK+DL   GSF++MG  G+ + 
Sbjct: 115 LMGASLSSIFLQYTGASISRVFFITAGTFGAMSLYGYTTKKDLTGWGSFLLMGLIGILIA 174

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           SLVN+F++S A+   +S +G++IF  LTAYDTQKIK  Y +      + +++V+GAL LY
Sbjct: 175 SLVNIFLKSPAVYFVVSVLGVLIFVGLTAYDTQKIKNMYFESDSTEVSSKKAVMGALTLY 234

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DFI +F+ LLR  G RR
Sbjct: 235 LDFINLFIMLLRLFGQRR 252


>gi|298293318|ref|YP_003695257.1| hypothetical protein Snov_3364 [Starkeya novella DSM 506]
 gi|296929829|gb|ADH90638.1| protein of unknown function UPF0005 [Starkeya novella DSM 506]
          Length = 260

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 125/262 (47%), Positives = 174/262 (66%), Gaps = 5/262 (1%)

Query: 1   MSDIRNY---QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD        R   + +   + ID GLR+YM+RVYN M LGL +TG  +  + +LA + 
Sbjct: 1   MSDFNRNVSVPRFGATAARTQAEIDLGLRSYMLRVYNYMTLGLAITGAAALGIYMLAVSD 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
            P  A+I    GV LT FG  M+ SPLRW+ + APL    FL+ R+  LS  AA+ +F L
Sbjct: 61  VPTQAAI--APGVYLTQFGVAMFFSPLRWVVMLAPLAAVFFLSFRVDRLSVGAAQGIFWL 118

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           Y+ L+G+SL+S FLVY  +SIV+ FFITAA+FG LSLYGYTT R L  +GSF+IMG  G+
Sbjct: 119 YAGLVGVSLASIFLVYAHESIVRVFFITAATFGGLSLYGYTTTRSLSGMGSFLIMGLIGI 178

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGAL 237
            + SLVN+F+ SS +   +S +G+++F+ LTAYDTQ+IKE Y    D   A R++++GAL
Sbjct: 179 IIASLVNIFLGSSMLQFVISVVGVLVFAGLTAYDTQRIKEMYFAGDDDVVAGRKAIMGAL 238

Query: 238 MLYMDFIQIFVHLLRFLGSRRD 259
            LY+DFI +F+ LL+  G+R +
Sbjct: 239 TLYLDFINLFLMLLQLFGNRNN 260


>gi|254485564|ref|ZP_05098769.1| integral membrane protein [Roseobacter sp. GAI101]
 gi|214042433|gb|EEB83071.1| integral membrane protein [Roseobacter sp. GAI101]
          Length = 258

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 105/257 (40%), Positives = 167/257 (64%), Gaps = 3/257 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + + + + +      + ID+GLRA+M +VY  M++G+ +T   ++ ++ LA T DP AA 
Sbjct: 1   MADVKTIRSRAGTRAAAIDEGLRAHMNKVYGTMSIGMLITFAAAWAISGLAVTNDPAAAV 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
             I     LT  G+ +Y SPL+W+ +FAPL     L   ++ +SA  A+ +F  ++A++G
Sbjct: 61  AQIGADTYLTSLGSALYLSPLKWVVMFAPLAFVFGLGAAMNKISAATAQTLFYAFAAVMG 120

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +S+SS FLV+T  SI+Q F IT+ SF  LSL+GYTTK+D+   GSF+IMG  GL + S+V
Sbjct: 121 VSISSIFLVFTGYSIIQIFLITSISFAGLSLWGYTTKKDISGWGSFLIMGLIGLIVASVV 180

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLY 240
           N+F+ S A+   +SA+G++IF+ LTAYDTQ IK  Y   +   D  + ++  ++GAL LY
Sbjct: 181 NIFLASPALVFAISAIGVLIFAGLTAYDTQNIKNTYLAHAQHGDQEWLQKSGIMGALSLY 240

Query: 241 MDFIQIFVHLLRFLGSR 257
           ++FI +F+ LL+  G+R
Sbjct: 241 LNFINMFMMLLQLFGNR 257


>gi|209551305|ref|YP_002283222.1| hypothetical protein Rleg2_3734 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537061|gb|ACI56996.1| protein of unknown function UPF0005 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 242

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 138/258 (53%), Positives = 188/258 (72%), Gaps = 16/258 (6%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D+RNYQ    +G      IDQGLRAYM++VYNLMALGL +TG+ ++L    A      
Sbjct: 1   MADLRNYQSRAQTG----EMIDQGLRAYMLKVYNLMALGLAITGVAAYLGFNFAV----- 51

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                  +   LT FG L++ SPLRW+ I APL    FL+ R++S+S  AA+  F +Y+ 
Sbjct: 52  -------QDGQLTQFGVLLFQSPLRWVVILAPLAAVFFLSFRINSMSVAAAQTTFWVYAG 104

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS FLVYT +S+VQTFF+TAASFG+LSLYGYTTKRDL  +GSF+IMG FGL + 
Sbjct: 105 LVGLSLSSIFLVYTGQSVVQTFFVTAASFGALSLYGYTTKRDLSAMGSFLIMGLFGLIIA 164

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           S+VN+F+ SSA+   +S +G++IF+ LTAYDTQ+IKE Y +  DVA A R++++GAL LY
Sbjct: 165 SIVNIFLASSAMQFAISVIGVLIFAGLTAYDTQRIKELYLEADDVAVAGRKAIMGALTLY 224

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DFI +F+ LL+F+G+R+
Sbjct: 225 LDFINLFMFLLQFMGNRK 242


>gi|255262200|ref|ZP_05341542.1| inner membrane protein YbhL [Thalassiobium sp. R2A62]
 gi|255104535|gb|EET47209.1| inner membrane protein YbhL [Thalassiobium sp. R2A62]
          Length = 258

 Score =  158 bits (399), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 112/257 (43%), Positives = 173/257 (67%), Gaps = 3/257 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  Y  V + GS   + ID GLRA+M +VY  M++G+ +T + ++ ++ LATT DP  A+
Sbjct: 1   MAQYDTVGSVGSVRTANIDAGLRAHMNKVYGTMSVGMLITALAAWAISGLATTTDPALAA 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
             I++   LT  G  +YTSPLRW+ +FAPL      +  ++ +SA  A+++F  ++A++G
Sbjct: 61  AQISQNTYLTNLGVTLYTSPLRWVIMFAPLVFVFGFSAMINRMSAATAQVVFYAFAAVMG 120

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSLS  F+VYTS SI+Q F +TA +F  LSL+GYTTK+D+   GSF+IMG  GL + S++
Sbjct: 121 LSLSWIFMVYTSFSIIQVFLVTAIAFAGLSLWGYTTKKDISGWGSFLIMGVIGLIVASII 180

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLY 240
           N+++ S AI   +S +G++IF+ LTAYDTQKIK  Y   +   D  +  + +++GAL LY
Sbjct: 181 NIWLASPAILYAISIIGVLIFAGLTAYDTQKIKNDYLAHAAHGDSEWLGKSAIMGALNLY 240

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DFI +F+ LL+ LG+R
Sbjct: 241 LDFINMFMFLLQLLGNR 257


>gi|319407883|emb|CBI81535.1| conserved membrane hypothetical protein [Bartonella schoenbuchensis
           R1]
          Length = 257

 Score =  158 bits (399), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 128/259 (49%), Positives = 181/259 (69%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D +N +    S +   ++IDQGLR+YM+ VYN MA+GL +T   ++++  LATT D +
Sbjct: 1   MADFKNLRSASVSHA--DASIDQGLRSYMLGVYNTMAIGLLITASAAYIIASLATTADIN 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A   IN  V LT FG   YTSPL ++ +F+PL   +FL+ ++++LS  AA+ +F  Y+A
Sbjct: 59  QAVAQINDSVYLTSFGVTFYTSPLSYVIMFSPLVAVLFLSFKINTLSTNAARSLFFGYAA 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT +SIVQTF IT+A+FGSLSLYGYTTKRDL  +GSF+ MG  GL L 
Sbjct: 119 LVGLSLSSIILRYTPESIVQTFVITSAAFGSLSLYGYTTKRDLTAMGSFLFMGLIGLLLA 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +VN+F+ SSA+   +S +G+++F+ LTAY+TQ IK  Y +        R+ ++GAL LY
Sbjct: 179 MVVNIFLGSSALQFAISVIGVLVFAGLTAYNTQTIKLMYYEGDADDTRGRKIIMGALNLY 238

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +FV LL+FLGS R+
Sbjct: 239 LDFINMFVFLLQFLGSNRN 257


>gi|49473696|ref|YP_031738.1| hypothetical protein BQ00080 [Bartonella quintana str. Toulouse]
 gi|49239199|emb|CAF25515.1| hypothetical protein BQ00080 [Bartonella quintana str. Toulouse]
          Length = 257

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 130/259 (50%), Positives = 177/259 (68%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D +N +    S +   ++IDQGLR+YM+ VYN MA+GL VT   ++ +  LATT +  
Sbjct: 1   MADFKNLRSAPISHA--DASIDQGLRSYMVGVYNTMAIGLLVTAATAYAIASLATTTEMS 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A+  IN  V LT FG   YTSP  +I +FAPL   +FL+ ++++LS   A+ +F  Y+A
Sbjct: 59  QAAAQINSSVYLTSFGVTFYTSPFSYIVMFAPLVAVLFLSFKINTLSTSVARSLFFGYAA 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT++SIVQTF ITAA+FG+LSLYGYTTKRDL  +GSF  +G  GL L 
Sbjct: 119 LVGLSLSSIILRYTTESIVQTFVITAATFGALSLYGYTTKRDLTAMGSFFFIGLVGLMLS 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +VN+F+ SSA+   +S +G+ IF+ LTAYDTQ IK  Y +        R+ ++GAL LY
Sbjct: 179 MIVNIFLGSSALQFAISVIGVFIFAGLTAYDTQNIKLMYYEGDGNDTQGRKIIMGALNLY 238

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +FV LL+FLGS RD
Sbjct: 239 LDFINMFVFLLQFLGSNRD 257


>gi|163740849|ref|ZP_02148242.1| hypothetical protein RG210_13451 [Phaeobacter gallaeciensis 2.10]
 gi|161385840|gb|EDQ10216.1| hypothetical protein RG210_13451 [Phaeobacter gallaeciensis 2.10]
          Length = 258

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 104/257 (40%), Positives = 168/257 (65%), Gaps = 3/257 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  +  + ++     + ID GLRA+M +VY  MA+G  +T + ++ ++ LA T DP  A+
Sbjct: 1   MAQFDTIRSTAGARSAEIDAGLRAHMNKVYGTMAVGTFITFLAAWAISGLAVTTDPANAA 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
             ++    LT  G  +Y SPL+W+ +FAPL     ++   + +SA   +++F +++ ++G
Sbjct: 61  AQLSADRYLTSIGYALYASPLKWVIMFAPLAFVFGISAAANRMSAAGVQLLFYVFATVMG 120

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LS+SS FLV+T +SIVQ F IT+ +F  LSL GYTTK+DL  +G+F+IMG  GL + S+V
Sbjct: 121 LSISSIFLVFTGESIVQVFLITSIAFAGLSLVGYTTKKDLSGMGAFLIMGLIGLIVASIV 180

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR---YDVAYAERQSVIGALMLY 240
           N+F+ SSA+   +S +G++IF+ LTAYDTQ+IK  Y       D  +  + +++GAL LY
Sbjct: 181 NMFLASSAMAFAISVIGVLIFAGLTAYDTQRIKNDYLQHAHMGDQEWLAKSAIMGALSLY 240

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DFI +F+ LL+ LG+R
Sbjct: 241 LDFINMFMMLLQLLGNR 257


>gi|163867314|ref|YP_001608508.1| hypothetical protein Btr_0009 [Bartonella tribocorum CIP 105476]
 gi|161016955|emb|CAK00513.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 257

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 130/259 (50%), Positives = 178/259 (68%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M++ +N +    S +   ++IDQGLR YM+ VYN MA+GL +T   ++ +  LATT D  
Sbjct: 1   MANFKNLRSAPASHA--DASIDQGLRDYMLGVYNTMAIGLLITAAAAYAIVSLATTTDMS 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A   IN  V LT FG   YTSP  +I +FAPL   +FL+ ++++LS  AA+ +FL Y+A
Sbjct: 59  QAVAQINSSVYLTSFGVTFYTSPFAYIVMFAPLIAVLFLSFKINTLSTNAARSLFLGYAA 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT++SI QTF I+AA+FG+LSLYGYTTKRDL  IGSF+ +G  GL L 
Sbjct: 119 LVGLSLSSIVLRYTTESIAQTFVISAATFGALSLYGYTTKRDLTAIGSFLFIGLIGLLLS 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +VN+F+ SSA+   +S +G+ IF+ LTAYDTQ IK  Y +  +     R+ ++GAL LY
Sbjct: 179 MVVNIFLGSSALQFAISVIGVFIFAGLTAYDTQNIKLMYYEGDEGDTRGRKVIMGALSLY 238

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +FV LL+FLGS RD
Sbjct: 239 LDFINMFVFLLQFLGSNRD 257


>gi|190893788|ref|YP_001980330.1| hypothetical protein [Rhizobium etli CIAT 652]
 gi|190699067|gb|ACE93152.1| hypothetical conserved membrane protein [Rhizobium etli CIAT 652]
 gi|327190200|gb|EGE57305.1| hypothetical conserved membrane protein [Rhizobium etli CNPAF512]
          Length = 242

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 139/258 (53%), Positives = 190/258 (73%), Gaps = 16/258 (6%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D+RNYQ    +G      IDQGLRAYM++VYNLMALGL +TG+ ++L   LA +    
Sbjct: 1   MADLRNYQSRAQTG----EMIDQGLRAYMLKVYNLMALGLAITGVAAYLSFQLAFSNGE- 55

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                      +T FG  +Y SPL+W+ I APL +  FL+ R+HS++  AA+  F +Y+A
Sbjct: 56  -----------ITAFGQAIYLSPLKWVVILAPLALVFFLSFRIHSMTVSAAQTTFAIYAA 104

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS FL+YT +S+VQTFF+TAASFG+LSLYGYTTKRDL  IGSF+IMG FGL + 
Sbjct: 105 LVGLSLSSIFLIYTGQSVVQTFFVTAASFGALSLYGYTTKRDLSAIGSFLIMGLFGLIIA 164

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           SLVN+F+ SSA+   +S +G++IF+ LTAYDTQ+IKE Y +  DVA A R++++GAL LY
Sbjct: 165 SLVNVFLASSAMQFAISVIGVLIFAGLTAYDTQRIKELYYEADDVAVAGRKAIMGALTLY 224

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DFI +F+ LL+F+G+R+
Sbjct: 225 LDFINLFMFLLQFMGNRK 242


>gi|86140029|ref|ZP_01058593.1| membrane protein, putative [Roseobacter sp. MED193]
 gi|85823279|gb|EAQ43490.1| membrane protein, putative [Roseobacter sp. MED193]
          Length = 258

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 111/257 (43%), Positives = 169/257 (65%), Gaps = 3/257 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  +  + ++       ID GLRA+M +VY  M+ GL +T + ++ ++ LA T DP +A+
Sbjct: 1   MAQFDTMRSAAGARSVEIDAGLRAHMNKVYGTMSAGLFITFLAAWALSNLAVTSDPASAT 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
            +I  G  LT FG  +Y SPL+W+ + APL          + +SA   +++F +++A++G
Sbjct: 61  AMIGEGKYLTSFGNAIYLSPLKWVIMLAPLAFIFGFGAAANRMSAAGVQLLFYVFAAVMG 120

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSLSS FLV+T +SI+Q F ITA SF  LSL GYTTK+DL  +G+F+IMG  GL + S+V
Sbjct: 121 LSLSSIFLVFTGQSIIQVFLITAISFAGLSLVGYTTKKDLSAMGAFLIMGLIGLIVASIV 180

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLY 240
           N+FM+S A+   +S +G++IF+ LTAYDTQKIK  Y   +   D  +  + +++GAL LY
Sbjct: 181 NMFMQSGAMAFAISVIGVLIFAGLTAYDTQKIKTTYLEMAHSGDQEWLGKAAIMGALSLY 240

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DFI +FV LL+ LG+R
Sbjct: 241 LDFINLFVMLLQLLGNR 257


>gi|254466583|ref|ZP_05079994.1| integral membrane protein [Rhodobacterales bacterium Y4I]
 gi|206687491|gb|EDZ47973.1| integral membrane protein [Rhodobacterales bacterium Y4I]
          Length = 258

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 104/257 (40%), Positives = 163/257 (63%), Gaps = 3/257 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  +  + ++     + ID+GLRA+M +VY  MA G  +T + ++ V  LA T DP    
Sbjct: 1   MAQFDTIRSAAGARAAQIDEGLRAHMNKVYATMAAGTFITFLAAWAVAGLAVTTDPANGV 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
             ++    LT  G  +Y SPL+W+ +FAPL     +    + +SA   +++F +++ ++G
Sbjct: 61  AQLSADKYLTNIGYALYASPLKWVIMFAPLAFVFGIGAAANRMSAAGVQLLFYVFATVMG 120

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LS+SS FLV+T +SIVQ F IT+ +F  LSL GYTTK+DL  +G+F+IMG  GL + S+V
Sbjct: 121 LSISSIFLVFTGESIVQVFLITSIAFAGLSLVGYTTKKDLSGMGAFLIMGLIGLIVASIV 180

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD---RYDVAYAERQSVIGALMLY 240
           N+F+ SSA+   +S +G++IF+ LTAYDTQ+IK  Y       D  +  + +++GAL LY
Sbjct: 181 NIFLASSAMAFAISVIGVLIFAGLTAYDTQRIKNDYLQMAHAGDQEWLAKSAIMGALSLY 240

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DFI +F+ LL  LG+R
Sbjct: 241 LDFINMFMMLLNLLGNR 257


>gi|222087505|ref|YP_002546042.1| hypothetical protein Arad_4388 [Agrobacterium radiobacter K84]
 gi|221724953|gb|ACM28109.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 247

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 136/259 (52%), Positives = 191/259 (73%), Gaps = 13/259 (5%)

Query: 1   MSDIRNYQ-RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D RNYQ R   +G+  G+ ID+GLRAYM++VYNLMALGL +TG+ ++    L+ +   
Sbjct: 1   MADFRNYQNRTPQAGAQTGAMIDEGLRAYMLKVYNLMALGLAITGLAAYFAFSLSFS--- 57

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                       +T FG  +Y SPL+W+ IFAPL +  FL+ R++S+S  AA   F +Y+
Sbjct: 58  ---------DGQITAFGQAIYQSPLKWVVIFAPLAMVFFLSFRINSMSVAAATTTFWVYA 108

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           AL+GLSLSS F++YT +S+VQTFF+TAASFG+LSLYGYTTKRDL  +GSF++MG FGL +
Sbjct: 109 ALVGLSLSSIFIIYTGQSVVQTFFVTAASFGALSLYGYTTKRDLSAMGSFLMMGLFGLII 168

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            SLVN+F+ SSA+   +S +G++IF+ LTAYDTQ+IKE Y    DVA A R++++GAL L
Sbjct: 169 ASLVNIFLASSAMQFAISVIGVLIFAGLTAYDTQRIKEMYYQADDVAVAGRKAIMGALSL 228

Query: 240 YMDFIQIFVHLLRFLGSRR 258
           Y+DFI +F+ LL+F+G+R+
Sbjct: 229 YLDFINLFMFLLQFMGNRK 247


>gi|163737467|ref|ZP_02144884.1| hypothetical protein RGBS107_18088 [Phaeobacter gallaeciensis
           BS107]
 gi|161388993|gb|EDQ13345.1| hypothetical protein RGBS107_18088 [Phaeobacter gallaeciensis
           BS107]
          Length = 258

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 102/257 (39%), Positives = 167/257 (64%), Gaps = 3/257 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  +  + ++     + ID GLRA+M +VY  MA+G  +T + ++ ++ LA T DP  A+
Sbjct: 1   MAQFDTIRSTAGARSAEIDAGLRAHMNKVYGTMAVGTFITFLAAWAISGLAVTTDPANAA 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
             ++    LT  G  +Y SPL+W+ +FAPL     ++   + +SA   +++F +++ ++G
Sbjct: 61  AQLSADRYLTSIGYALYASPLKWVIMFAPLAFVFGISAAANRMSAAGVQLLFYVFATVMG 120

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LS+SS FLV+T +SIVQ F IT+ +F  LSL GYTTK+DL  +G+F+IMG  GL +L++ 
Sbjct: 121 LSISSIFLVFTGESIVQVFLITSIAFAGLSLVGYTTKKDLSGMGAFLIMGLIGLIVLAIA 180

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR---YDVAYAERQSVIGALMLY 240
           N+F+ SS +   +S +G++IF+ LTAYDTQ+IK  Y       D  +  + +++GAL LY
Sbjct: 181 NMFIASSVLANVISFVGVLIFAGLTAYDTQRIKNEYLQHAHMGDQEWLGKAAIMGALSLY 240

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DFI +F+ LL+ LG+R
Sbjct: 241 LDFINMFMMLLQLLGNR 257


>gi|15966975|ref|NP_387328.1| hypothetical protein SMc03839 [Sinorhizobium meliloti 1021]
 gi|307302443|ref|ZP_07582200.1| protein of unknown function UPF0005 [Sinorhizobium meliloti BL225C]
 gi|307316227|ref|ZP_07595671.1| protein of unknown function UPF0005 [Sinorhizobium meliloti AK83]
 gi|15076248|emb|CAC47801.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306898067|gb|EFN28809.1| protein of unknown function UPF0005 [Sinorhizobium meliloti AK83]
 gi|306903113|gb|EFN33703.1| protein of unknown function UPF0005 [Sinorhizobium meliloti BL225C]
          Length = 245

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 131/260 (50%), Positives = 190/260 (73%), Gaps = 16/260 (6%)

Query: 1   MSDIRNYQ-RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D+RNYQ R+  +G+  G+ ID+GLRAYM++VYNLMALGL +TG+ ++    LA +   
Sbjct: 1   MADLRNYQTRMSPAGAQAGAVIDEGLRAYMLKVYNLMALGLAITGVAAYGTYALAASN-- 58

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                          F  L+Y SPL+W+ + APL +  FL+ R++S+S  AA+  F +Y+
Sbjct: 59  -------------PAFAQLIYASPLKWVVMLAPLALVFFLSFRINSMSVSAAQTTFWVYA 105

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           AL+GLSLSS FLV+T +SIVQTFF+TAASFG+LSLYGYTTK+DL  +GSF+IMG FG+ +
Sbjct: 106 ALMGLSLSSIFLVFTGQSIVQTFFVTAASFGALSLYGYTTKKDLSGLGSFLIMGLFGVII 165

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            S+VN+F+ SSA+   +S +G++IF+ LTAYDTQK+KE Y +  D   A R++++GAL L
Sbjct: 166 ASVVNIFLASSALGFAISVIGVLIFAGLTAYDTQKLKEMYFEGDDALVAGRKAIMGALTL 225

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y+DFI +F+ +L+FLG++ +
Sbjct: 226 YLDFINLFMFMLQFLGNKNE 245


>gi|254474621|ref|ZP_05088007.1| integral membrane protein [Ruegeria sp. R11]
 gi|214028864|gb|EEB69699.1| integral membrane protein [Ruegeria sp. R11]
          Length = 258

 Score =  156 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 105/257 (40%), Positives = 166/257 (64%), Gaps = 3/257 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  +  + ++     + ID GLRA+M +VY  MA G  +T + ++ +  LA T DP AA+
Sbjct: 1   MAQFDTIRSAAGARTAEIDAGLRAHMNKVYATMAAGTFITFLAAWAIAGLAVTSDPSAAA 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
             +N    LT  G  +Y SPL+W+ +FAPL     +    + +SA   +++F +++ ++G
Sbjct: 61  AQLNADTYLTSLGYALYASPLKWVIMFAPLAFVFGIGAAANRMSAAGVQLLFYVFATVMG 120

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +S+SS FLV+T +SIVQ F IT+ +F  LSL GYTTK+DL  +G+F+IMG  GL + S+V
Sbjct: 121 ISISSIFLVFTGESIVQVFLITSIAFTGLSLVGYTTKKDLSGMGAFLIMGLIGLIVASVV 180

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD---RYDVAYAERQSVIGALMLY 240
           N+F+ SSA+   +S +G++IF+ LTAYDTQ+IK  Y       D  +  + +++GAL LY
Sbjct: 181 NIFLASSALAFAVSVIGVLIFAGLTAYDTQRIKNDYLQMVHMGDQEWLAKSAIMGALSLY 240

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DFI +F+ LL+ LG+R
Sbjct: 241 LDFINMFMMLLQLLGNR 257


>gi|163745936|ref|ZP_02153295.1| hypothetical protein OIHEL45_10128 [Oceanibulbus indolifex HEL-45]
 gi|161380681|gb|EDQ05091.1| hypothetical protein OIHEL45_10128 [Oceanibulbus indolifex HEL-45]
          Length = 258

 Score =  156 bits (393), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 104/257 (40%), Positives = 167/257 (64%), Gaps = 3/257 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + +   +  S     S ID GLRA+M +VY  M++G+ +T   ++ ++ L+ T DP AA 
Sbjct: 1   MADVNTIRTSAGSRASAIDAGLRAHMNKVYGTMSIGMLITFAAAWAISGLSVTTDPSAAV 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
             +++   LT  G  +Y SPL+W+ +FAPL      +  ++ +SA  A+++F  ++A++G
Sbjct: 61  AQLSQDKYLTQLGYALYASPLKWVVMFAPLAFVFGFSAMINKMSAATAQVVFYAFAAVMG 120

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +S+SS FLV+T  SI Q F IT+ +F  LSL+GYTTK+D+   GSF+IMG  GL + S+V
Sbjct: 121 ISISSIFLVFTGYSIAQIFLITSIAFAGLSLWGYTTKKDISGWGSFLIMGVIGLVVASIV 180

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLY 240
           N+F+ SSA+   +SA+G++IF+ LTAYDTQ+IK  Y   +   D  +  + +++GAL LY
Sbjct: 181 NIFLASSALMFAISAIGVLIFAGLTAYDTQRIKTEYLAHAQHGDTEWLGKAAIMGALNLY 240

Query: 241 MDFIQIFVHLLRFLGSR 257
           ++FI +F+ LL   G+R
Sbjct: 241 LNFINMFMMLLSLFGNR 257


>gi|227823755|ref|YP_002827728.1| hypothetical protein NGR_c32420 [Sinorhizobium fredii NGR234]
 gi|227342757|gb|ACP26975.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 245

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 132/260 (50%), Positives = 191/260 (73%), Gaps = 16/260 (6%)

Query: 1   MSDIRNYQ-RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D+RNYQ R+  +G+  G+ ID+GLRAYM++VYNLMALGL +TG+ ++    LA +   
Sbjct: 1   MADLRNYQTRMSPAGAQAGAVIDEGLRAYMLKVYNLMALGLAITGVAAYGTYALAVSN-- 58

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                          F  L+Y SPL+W+ + APL +  F++ R++S+S  AA+  F +Y+
Sbjct: 59  -------------PAFAQLIYASPLKWVVMLAPLALVFFMSFRINSMSVSAAQTTFWIYA 105

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           AL+GLSLSS FLV+T +SIVQTFF+TAASFG+LSLYGYTTK+DL   G+F+IMG FGL +
Sbjct: 106 ALMGLSLSSIFLVFTGQSIVQTFFVTAASFGALSLYGYTTKKDLSGFGTFLIMGLFGLII 165

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            S+VN+F+ SSA+   +S +G+++F+ LTAYDTQKIKE Y +  DVA A R++++GAL L
Sbjct: 166 ASIVNIFLASSALSFAISVIGVLVFAGLTAYDTQKIKEMYFEADDVAVAGRKAIMGALTL 225

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y+DFI +F+ LL+F+G++ +
Sbjct: 226 YLDFINLFMFLLQFMGNKNE 245


>gi|254463314|ref|ZP_05076730.1| integral membrane protein [Rhodobacterales bacterium HTCC2083]
 gi|206679903|gb|EDZ44390.1| integral membrane protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 258

 Score =  155 bits (390), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 103/257 (40%), Positives = 166/257 (64%), Gaps = 3/257 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  Y  + +      + ID GLRA+M +VY  M++G+ +T + ++ +  LA T DP  A 
Sbjct: 1   MAEYGTIRSGVGSAAADIDAGLRAHMNKVYGTMSVGMFITFLAAWAIAGLAVTNDPSQAV 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
             I     LT  G+ +Y SPL+W+ +FAPL     ++  ++ +SA  A+ +F +++A++G
Sbjct: 61  AQIGADKYLTSLGSALYLSPLKWVVMFAPLAFVFGMSAAINRMSAATAQTVFYIFAAVMG 120

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +S+SS FLV+T  SI+Q F IT+ +F  LSL+GYTTK+D+   GSF+IMG  GL + S+V
Sbjct: 121 VSISSIFLVFTGYSIMQIFLITSIAFAGLSLWGYTTKKDISGWGSFLIMGVIGLIVASIV 180

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLY 240
           N+++ S AI   +SA+G++IF+ LTAYDTQ IK  Y   +   D  +  + +++GAL LY
Sbjct: 181 NIWLASPAIMFAISAIGVLIFAGLTAYDTQNIKNTYLAHAHHGDSEWLGKSAIMGALSLY 240

Query: 241 MDFIQIFVHLLRFLGSR 257
           ++FI +F+ LL+  G+R
Sbjct: 241 LNFINMFMMLLQLFGNR 257


>gi|150398270|ref|YP_001328737.1| hypothetical protein Smed_3076 [Sinorhizobium medicae WSM419]
 gi|150029785|gb|ABR61902.1| protein of unknown function UPF0005 [Sinorhizobium medicae WSM419]
          Length = 245

 Score =  155 bits (390), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 132/260 (50%), Positives = 190/260 (73%), Gaps = 16/260 (6%)

Query: 1   MSDIRNYQ-RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D+RNYQ R+  +G+  G+ ID+GLRAYM++VYNLMALGL +TG+ ++    LA +   
Sbjct: 1   MADLRNYQTRMSPAGAQAGAVIDEGLRAYMLKVYNLMALGLAITGVAAYGTYALAASN-- 58

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                          F  L+Y SPL+W+ + APL +  FL+ R++S+S   A+M F +Y+
Sbjct: 59  -------------PAFAQLIYASPLKWVVMLAPLALVFFLSFRINSMSVATAQMTFWVYA 105

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           AL+GLSLSS FLV+T +SIVQTFF+TAASFG+LSLYGYTTK+DL  +GSF+IMG FG+ +
Sbjct: 106 ALMGLSLSSIFLVFTGQSIVQTFFVTAASFGALSLYGYTTKKDLSGLGSFLIMGLFGVII 165

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            S+VN+F+ SSA+   +S +G++IF+ LTAYDTQK+KE Y +  D   A R++++GAL L
Sbjct: 166 ASVVNIFLASSALGFAISVIGVLIFAGLTAYDTQKLKEMYFEGDDALVAGRKAIMGALTL 225

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y+DFI +F+ +L+FLG+R +
Sbjct: 226 YLDFINLFMFMLQFLGNRNE 245


>gi|325294052|ref|YP_004279916.1| hypothetical protein AGROH133_08964 [Agrobacterium sp. H13-3]
 gi|325061905|gb|ADY65596.1| hypothetical protein AGROH133_08964 [Agrobacterium sp. H13-3]
          Length = 245

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 138/258 (53%), Positives = 190/258 (73%), Gaps = 16/258 (6%)

Query: 1   MSDIRNYQ-RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M+D  NYQ R+  + +  G+ ID+GLRAYM++VYNLMAL L +TG+ +F    LATT   
Sbjct: 1   MADFNNYQNRMAQTRAQTGAMIDEGLRAYMLKVYNLMALALVITGVAAFATFTLATTN-- 58

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                          F  L+Y SPLRW+ + APLG+  FL+ R+ ++S  AA+M F +Y+
Sbjct: 59  -------------PAFAQLLYASPLRWVVMLAPLGLVFFLSFRIQNMSVSAAQMTFWVYA 105

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
           AL+G+SLSS FLVYT +S+VQTFF+TAASFG+LSLYGYTTK+DL  +GSF+IMG FGL +
Sbjct: 106 ALMGVSLSSIFLVYTGQSVVQTFFVTAASFGALSLYGYTTKKDLSGMGSFLIMGLFGLII 165

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            S+VN+F+ SSA+   +SA+G++IF+ LTAYDTQKIKE Y D  +VA A R++++GAL L
Sbjct: 166 ASIVNIFLASSALQFAISAIGVLIFAGLTAYDTQKIKEMYFDGDEVAVAGRKAIMGALTL 225

Query: 240 YMDFIQIFVHLLRFLGSR 257
           Y+DFI +F+ LL+F+G+R
Sbjct: 226 YLDFINLFMFLLQFMGNR 243


>gi|241206741|ref|YP_002977837.1| hypothetical protein Rleg_4057 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860631|gb|ACS58298.1| protein of unknown function UPF0005 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 242

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 133/258 (51%), Positives = 188/258 (72%), Gaps = 16/258 (6%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D+RNYQ    +G      IDQGLRAYM++VYNLMALGL +TG+ ++L    A      
Sbjct: 1   MADLRNYQSRAQTG----EMIDQGLRAYMLKVYNLMALGLAITGVAAYLSFQFAFANGE- 55

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                      LT FG  +Y SPL+W+ I APL +  FL+ R+++++  AA+  F +Y+A
Sbjct: 56  -----------LTAFGQAIYVSPLKWVVILAPLALVFFLSFRINTMTVAAAQTTFAVYAA 104

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS FL+YT +S+VQTFF+TAASFG+LSLYGYTTKR+L  +GSF++MG FGL + 
Sbjct: 105 LVGLSLSSIFLIYTGQSVVQTFFVTAASFGALSLYGYTTKRNLSAMGSFLMMGLFGLIIA 164

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           S+VN+F+ SSA+   +S +G++IF+ LTAYDTQ+IKE Y +  DVA A R++++GAL LY
Sbjct: 165 SIVNIFLASSAVQFAISVLGVLIFAGLTAYDTQRIKELYLEADDVAVAGRKAIMGALTLY 224

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DFI +F+ LL+F+G+R+
Sbjct: 225 LDFINLFMFLLQFMGNRK 242


>gi|99081754|ref|YP_613908.1| hypothetical protein TM1040_1913 [Ruegeria sp. TM1040]
 gi|99038034|gb|ABF64646.1| protein of unknown function UPF0005 [Ruegeria sp. TM1040]
          Length = 259

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 104/258 (40%), Positives = 165/258 (63%), Gaps = 4/258 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  +  + ++     + ID GLRA+M +VY  M++G  +T + ++ +  L+ T DP  A 
Sbjct: 1   MAQFDSIRSAAGARSAEIDAGLRAHMNKVYGTMSVGTLITFLAAWAIAGLSVTSDPANAV 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIF-LNVRLHSLSAYAAKMMFLLYSALI 122
             ++    LT FG  +Y SPL+W+ +FAPL    F     ++ LSA   +++F  ++AL+
Sbjct: 61  AQLSSDSYLTNFGYAIYASPLKWVIMFAPLAFVFFGFGAAVNRLSAAGVQVVFYAFAALM 120

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GLS+SS F+ +T +SI Q F +T+ +F  LSL GYTTK+DL  +GSF+IMG  GL + S+
Sbjct: 121 GLSISSIFVTFTGESIAQVFLVTSIAFAGLSLVGYTTKKDLSGMGSFLIMGLIGLIVASV 180

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD---RYDVAYAERQSVIGALML 239
           VN+F+ SSA+   +S +G++IF+ LTAYDTQ+IK  Y       D  +  + +++GAL L
Sbjct: 181 VNIFLASSAMAFAISVIGVLIFAGLTAYDTQRIKNDYLQMAHAGDQEWLGKAAIMGALSL 240

Query: 240 YMDFIQIFVHLLRFLGSR 257
           Y+DFI +F+ LL+ LG+R
Sbjct: 241 YLDFINMFMMLLQLLGNR 258


>gi|116254259|ref|YP_770097.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258907|emb|CAK10016.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 242

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 134/258 (51%), Positives = 188/258 (72%), Gaps = 16/258 (6%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D+RNYQ    +G      IDQGLRAYM++VYNLMALGL +TG+ ++L    A      
Sbjct: 1   MADLRNYQSRAQTG----EMIDQGLRAYMLKVYNLMALGLAITGVAAYLSFQFAFANGE- 55

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                      LT FG  +Y SPL+W+ I APL +  FL+ R+++++  AA+  F +Y+A
Sbjct: 56  -----------LTAFGQAIYVSPLKWVVILAPLALVFFLSFRINTMTVAAAQTTFAVYAA 104

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS FL+YT +S+VQTFF+TAASFG+LSLYGYTTKR+L  +GSF++MG FGL + 
Sbjct: 105 LVGLSLSSIFLIYTGQSVVQTFFVTAASFGALSLYGYTTKRNLSAMGSFLMMGLFGLIIA 164

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           SLVN+F+ SSA+   +S +G++IF+ LTAYDTQ+IKE Y +  DVA A R++++GAL LY
Sbjct: 165 SLVNIFLASSAVQFAISVLGVLIFAGLTAYDTQRIKELYLEADDVAVAGRKAIMGALTLY 224

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DFI +F+ LL+F+G+R+
Sbjct: 225 LDFINLFMFLLQFMGNRK 242


>gi|319404921|emb|CBI78521.1| conserved membrane hypothetical protein [Bartonella sp. AR 15-3]
          Length = 257

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 127/259 (49%), Positives = 178/259 (68%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D +N +    S +   ++IDQGLR YM+ VYN MA+GL VT + ++ +  LATT +  
Sbjct: 1   MADFKNLRSASVSHA--DASIDQGLRNYMLGVYNTMAIGLLVTAVAAYAIASLATTTNMS 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A+  IN  V LT FG   Y SP  ++ +FAPL   +FL+ ++++LS   A+ +F  Y+ 
Sbjct: 59  QAAAQINGSVYLTSFGVTFYMSPFSYVIMFAPLVAVLFLSFKINALSTGVARSLFFAYAT 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YTS+SIVQTF IT+A+FGSLSLYGYTTKRDL  +GSF+ MG  GL L 
Sbjct: 119 LVGLSLSSIILRYTSESIVQTFVITSAAFGSLSLYGYTTKRDLTAVGSFLFMGLVGLMLA 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           ++VN+F+ SSA+   +S +G+++F+ LTAY+TQ IK  Y +        R+ ++GAL LY
Sbjct: 179 AIVNIFLASSALQFAISVIGVLVFAGLTAYNTQNIKLMYYEGDGYDTRGRKIIMGALNLY 238

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +FV LL+FLGS RD
Sbjct: 239 LDFINMFVFLLQFLGSNRD 257


>gi|323138794|ref|ZP_08073858.1| protein of unknown function UPF0005 [Methylocystis sp. ATCC 49242]
 gi|322395942|gb|EFX98479.1| protein of unknown function UPF0005 [Methylocystis sp. ATCC 49242]
          Length = 255

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 115/262 (43%), Positives = 169/262 (64%), Gaps = 13/262 (4%)

Query: 4   IRNYQRVVNSGSGFG------STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           + NY R  + G G G      + ID+GLRAYM+ VYN M +GL VTG+++    +L+   
Sbjct: 1   MSNYDRNTSFGYGRGVARSTTAEIDEGLRAYMLGVYNYMTIGLAVTGLVALGTYMLSVAK 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
                  +    ++LT FG +++TSPLRW+ I +PL   +FL  R  ++SA  A+ +F  
Sbjct: 61  -------VGAGQIILTPFGQMIFTSPLRWVIILSPLAFVMFLGARATTMSAATARNLFFA 113

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           ++A++GLS+SS  LV+T  SI + FFITAA+FG LSLYGY TKRDL   GSF++MG +GL
Sbjct: 114 FAAVMGLSMSSILLVFTGASIARIFFITAAAFGGLSLYGYMTKRDLSAFGSFLVMGVWGL 173

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGAL 237
            +  LVNLF++S+ +   +S + +++F+ LTA+DTQ IK+ Y +      A+++SV GAL
Sbjct: 174 VIAGLVNLFLQSTGLQFALSIIAVLVFAGLTAWDTQNIKDMYYEGDGYEVAQKKSVFGAL 233

Query: 238 MLYMDFIQIFVHLLRFLGSRRD 259
            LY+DFI +F  LL   G R D
Sbjct: 234 SLYLDFINMFQSLLYLFGQRND 255


>gi|328542062|ref|YP_004302171.1| hypothetical protein SL003B_0440 [polymorphum gilvum SL003B-26A1]
 gi|326411812|gb|ADZ68875.1| Hypothetical transmembrane protein [Polymorphum gilvum SL003B-26A1]
          Length = 250

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 123/255 (48%), Positives = 167/255 (65%), Gaps = 10/255 (3%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D  N      +GS   + IDQGLRAYM+ VYN M LGL +TG+++      A        
Sbjct: 5   DRNNQVPYATAGSYADAGIDQGLRAYMLGVYNYMTLGLAITGLVAMATVYFA-------- 56

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
             I      LT FG  +Y SPL+W+ + APL +  FL+ R+ S+SA AA+  F +Y+AL+
Sbjct: 57  --IDTATGGLTTFGLAIYASPLKWVIMLAPLAMVFFLSFRIQSMSASAAQTTFWIYAALM 114

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G SLSS FLVYT  SI + FFITAASFG+LSL+GYTTK+DL   GSF+ MG  G+ L SL
Sbjct: 115 GASLSSIFLVYTGGSIARVFFITAASFGALSLFGYTTKKDLSAWGSFLFMGLIGIVLASL 174

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           VN+F+ SSA+   +S +G+++F+ LTAYDTQ+IKE Y +        ++SV+GAL LY+D
Sbjct: 175 VNIFLASSALQFAVSVIGVLVFAGLTAYDTQQIKEMYYEGDGHEATTKKSVMGALRLYLD 234

Query: 243 FIQIFVHLLRFLGSR 257
           FI +F+ LL+  G+R
Sbjct: 235 FINMFLMLLQLFGNR 249


>gi|254502631|ref|ZP_05114782.1| Uncharacterized protein family UPF0005, putative [Labrenzia
           alexandrii DFL-11]
 gi|222438702|gb|EEE45381.1| Uncharacterized protein family UPF0005, putative [Labrenzia
           alexandrii DFL-11]
          Length = 254

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 117/255 (45%), Positives = 172/255 (67%), Gaps = 6/255 (2%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D ++      +G+   + IDQGLRAYM+ VYN M  GL +TG  +    +++   +    
Sbjct: 5   DRQSQGAYSVAGARAEAGIDQGLRAYMLGVYNYMTFGLALTGFFAIGTYMMSVVTNDA-- 62

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                  V LT  G  ++ SPL+W+ + APLG+ ++L+ R+ S+SA  A+ MFL+YSAL+
Sbjct: 63  ----GSIVGLTPLGNAIFASPLKWVVMLAPLGMVLWLSFRIQSMSASTARTMFLIYSALM 118

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G+SLSS F+VYT  SI + FFITAASFG+LS++GYTTK+DL   GSF+ MG  G+ + SL
Sbjct: 119 GVSLSSIFMVYTGGSIARVFFITAASFGALSIFGYTTKKDLSAWGSFLFMGLIGIVIASL 178

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           VN+F+ SSA+   +S +G+++F+ LTAYDTQ+IKE Y +      A ++SV+GAL LY+D
Sbjct: 179 VNIFLGSSALQFAISVVGVLVFAGLTAYDTQQIKEMYYEGDSGEVATKKSVMGALRLYLD 238

Query: 243 FIQIFVHLLRFLGSR 257
           FI +F+ LL+  G+R
Sbjct: 239 FINMFLMLLQLFGNR 253


>gi|319898200|ref|YP_004158293.1| hypothetical protein BARCL_0009 [Bartonella clarridgeiae 73]
 gi|319402164|emb|CBI75690.1| conserved membrane protein of unknown function [Bartonella
           clarridgeiae 73]
          Length = 257

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 128/259 (49%), Positives = 178/259 (68%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D +N + V  S S   ++IDQGLR+YM+ VYN MA+GL +T   ++ +  L TT D +
Sbjct: 1   MADFKNLRSV--SASHADASIDQGLRSYMLGVYNTMAIGLLITAAAAYAIASLVTTTDMN 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A+  IN  V LT FG   Y SP  ++ +FAPL   +FL  ++++LS   A+ +F  Y+ 
Sbjct: 59  QAAAQINGSVYLTPFGVTFYMSPFSYVIMFAPLVAVLFLTFKINTLSTSVARSLFFAYAT 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT +SIVQTFFIT+A+FGSLSLYGYTTKRDL  +GSF+ MG  GL L 
Sbjct: 119 LVGLSLSSIILRYTPESIVQTFFITSAAFGSLSLYGYTTKRDLTAVGSFLFMGLIGLMLA 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           ++VN+F+ SSA+   +S +G+++F+ LTAY+TQ IK  Y +        R+ ++GAL LY
Sbjct: 179 AIVNIFLGSSALQFAISVIGILVFAGLTAYNTQNIKLMYYEGDGDDTRGRKIIMGALNLY 238

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +FV LL+FLGS RD
Sbjct: 239 LDFINMFVFLLQFLGSNRD 257


>gi|163757367|ref|ZP_02164456.1| hypothetical protein HPDFL43_18192 [Hoeflea phototrophica DFL-43]
 gi|162284869|gb|EDQ35151.1| hypothetical protein HPDFL43_18192 [Hoeflea phototrophica DFL-43]
          Length = 243

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 127/257 (49%), Positives = 185/257 (71%), Gaps = 15/257 (5%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D RN    V SG+   + ID+GLRAYM+RVYN+MA+GLG+TG+ ++   +LA+T    
Sbjct: 1   MADFRNSNVRVASGAHADAAIDEGLRAYMLRVYNIMAMGLGITGVAAYGTYMLASTN--- 57

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                         F  L+Y SPL+W+ + APL +  FL+ R+  +S  AA+  F +Y+A
Sbjct: 58  ------------PAFAQLLYASPLKWVIMLAPLAMVFFLSFRIEKMSVSAAQTTFWVYAA 105

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           ++GLSLSS F+V+T  SI QTFF+TAASFG+LSLYGYTTK+DL  +GSF+IMG FG+ + 
Sbjct: 106 MMGLSLSSIFIVFTGASITQTFFVTAASFGALSLYGYTTKKDLSGMGSFLIMGVFGIIIA 165

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +VN+F++SSA++  +SA+G+++F+ LTAYDTQ+IKE Y +    A A R++++GAL LY
Sbjct: 166 MVVNIFLQSSALEFAISAIGVLVFAGLTAYDTQQIKEMYYEGDGAATAGRKAIMGALRLY 225

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DFI +F+ LL+FLG+R
Sbjct: 226 LDFINLFMFLLQFLGNR 242


>gi|259415915|ref|ZP_05739835.1| inner membrane protein YbhL [Silicibacter sp. TrichCH4B]
 gi|259347354|gb|EEW59131.1| inner membrane protein YbhL [Silicibacter sp. TrichCH4B]
          Length = 259

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 105/258 (40%), Positives = 165/258 (63%), Gaps = 4/258 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  +  + ++     + ID GLRA+M +VY  M++G  +T + ++ +  L+ T DP  A 
Sbjct: 1   MAQFDSIRSAVGARSAEIDAGLRAHMNKVYGTMSVGTLITFLAAWAIAGLSVTSDPANAV 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIF-LNVRLHSLSAYAAKMMFLLYSALI 122
             ++    LT FG  +Y SPL+W+ +FAPL    F     ++ LSA   +++F  ++AL+
Sbjct: 61  AQLSSDSYLTNFGYAIYASPLKWVIMFAPLAFVFFGFGAAVNRLSAAGVQVVFYAFAALM 120

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GLS+SS F+ +T +SI Q F +T+ +F  LSL GYTTK+DL  +GSF+IMG  GL + S+
Sbjct: 121 GLSISSIFVTFTGESIAQVFLVTSIAFAGLSLVGYTTKKDLSGMGSFLIMGLIGLIVASV 180

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD---RYDVAYAERQSVIGALML 239
           VN+F+ SSA+   +S +G++IF+ LTAYDTQ+IK  Y       D  +  + +V+GAL L
Sbjct: 181 VNIFLASSAMAFAISVIGVLIFAGLTAYDTQRIKNDYLQMAHAGDQEWLGKAAVMGALSL 240

Query: 240 YMDFIQIFVHLLRFLGSR 257
           Y+DFI +F+ LL+ LG+R
Sbjct: 241 YLDFINMFMMLLQLLGNR 258


>gi|254455452|ref|ZP_05068881.1| integral membrane protein [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082454|gb|EDZ59880.1| integral membrane protein [Candidatus Pelagibacter sp. HTCC7211]
          Length = 253

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 106/256 (41%), Positives = 163/256 (63%), Gaps = 6/256 (2%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D         +       +D+GLRAYM++VYN MA G+ +TGI++ L   ++   +    
Sbjct: 4   DKNGILNRAKAAQQTAVVMDEGLRAYMLKVYNYMATGILLTGIVALLTFKMSVVTNDA-- 61

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                  V LT  G  +Y S L+W+ + APLG+  +++  ++ +SA  A+  F +++AL+
Sbjct: 62  ----GSIVGLTSVGNAIYMSGLKWLVMLAPLGIVFYMSFGINKMSASKAQTTFWVFAALM 117

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GLSLSS  L+YT  S+ + FFI +A+FG++S+YGYTTKRDL  +GSF++MG  G+ + S+
Sbjct: 118 GLSLSSILLIYTGMSVTRVFFICSATFGAMSIYGYTTKRDLTKLGSFLMMGLIGIIIASI 177

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           VN+FM+SS +   +S +G++IF  LTAYDTQKIK  Y+         +++V+GAL LY+D
Sbjct: 178 VNIFMKSSMMYFVISILGVLIFVGLTAYDTQKIKNMYAVSDTGEIMGKKAVMGALTLYLD 237

Query: 243 FIQIFVHLLRFLGSRR 258
           FI +F+ LLR  G RR
Sbjct: 238 FINLFIMLLRLFGQRR 253


>gi|330813411|ref|YP_004357650.1| membrane protein [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486506|gb|AEA80911.1| membrane protein [Candidatus Pelagibacter sp. IMCC9063]
          Length = 251

 Score =  152 bits (383), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 107/256 (41%), Positives = 166/256 (64%), Gaps = 6/256 (2%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           ++ +    + S +    ++++GLR YM+ VYN M  G+ +TG+++ +   LA   D    
Sbjct: 2   NLNDRINAIKSTTTRSESVNEGLRTYMLSVYNFMGSGVLLTGVIAMIFFKLAVVTDGS-- 59

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                  V LTG G  MY S L W+   APLG+ ++++  + ++SA  A+ +F +++AL+
Sbjct: 60  ----GNIVGLTGLGNAMYNSALMWVVALAPLGIVMYMSFGIKNMSASRAQTVFWIFAALM 115

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G SLSS F+ YT  SI + FFITA +FG++SLYGYTTK+DL  +GSF++MG FG+ + S+
Sbjct: 116 GASLSSIFVQYTGTSIARVFFITAGTFGAMSLYGYTTKKDLTGLGSFLMMGLFGIIIASI 175

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           VN+F++SSA+   +S +G++IF  LTAYDTQKIK  Y          +++++GAL LY+D
Sbjct: 176 VNIFLKSSAMHFVISILGVLIFVGLTAYDTQKIKNMYLASDGNEVMSKKAIMGALTLYLD 235

Query: 243 FIQIFVHLLRFLGSRR 258
           FI +F+ LLR  G RR
Sbjct: 236 FINLFIMLLRLFGQRR 251


>gi|217978072|ref|YP_002362219.1| protein of unknown function UPF0005 [Methylocella silvestris BL2]
 gi|217503448|gb|ACK50857.1| protein of unknown function UPF0005 [Methylocella silvestris BL2]
          Length = 261

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 126/262 (48%), Positives = 173/262 (66%), Gaps = 4/262 (1%)

Query: 1   MSDI-RNYQRVVNSGSGFG--STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD  RN       G      + IDQGLR YM+ VYN M +GL +TG+++  VN+LA   
Sbjct: 1   MSDFDRNAGARWGQGVARAGRAEIDQGLRTYMLGVYNNMMVGLALTGLVALGVNMLAVAG 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           D   A   + R + LT FGA +Y SPLR++ + APL   +F + R++ +SA +A++MF  
Sbjct: 61  DSSQAVAQMGR-IPLTAFGAAIYGSPLRYVVMLAPLAFVLFFSFRINQMSASSARIMFFA 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           ++A +GLSLSS  L+YT  SI + FFITAA+FG LSLYGYTTKRDL  +GSF++MG  GL
Sbjct: 120 FAATMGLSLSSILLIYTGASITRAFFITAAAFGGLSLYGYTTKRDLSAMGSFLVMGLIGL 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGAL 237
            + S+VNLF++S+A    +S + ++IFS LTA+DTQ IKE Y +      A ++S+ GAL
Sbjct: 180 VIASVVNLFVQSTAFQFGLSILSVLIFSGLTAWDTQSIKEMYYESDGYEVATKKSINGAL 239

Query: 238 MLYMDFIQIFVHLLRFLGSRRD 259
           MLY+DFI IF  LL   G R +
Sbjct: 240 MLYLDFINIFQSLLFLSGDRNN 261


>gi|91762582|ref|ZP_01264547.1| integral membrane protein [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718384|gb|EAS85034.1| integral membrane protein [Candidatus Pelagibacter ubique HTCC1002]
          Length = 256

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 109/254 (42%), Positives = 167/254 (65%), Gaps = 3/254 (1%)

Query: 5   RNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASI 64
           +N    V         +D+GLRA+M++VYN MA  + +TG+ S L   L+       +S 
Sbjct: 6   QNILNKVKEAQQSTVVMDEGLRAHMLKVYNYMASAILLTGVFSILFYNLSGGSSIQISSA 65

Query: 65  IINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGL 124
            I+    L+  G  +Y SPL+W+ + APLG+  +++ R++ +SA +A+ +F +++AL+G+
Sbjct: 66  GISG---LSPVGYAIYGSPLKWLVMLAPLGIVFYMSARMNRMSASSAQTVFWVFAALMGI 122

Query: 125 SLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN 184
           SLSS FL YT  SI + FFIT+ +FG++S+YGYTTKRDL  +GSF++MG FG+ + S+VN
Sbjct: 123 SLSSIFLRYTGFSIARVFFITSGTFGAMSIYGYTTKRDLTKLGSFLMMGLFGIIIASVVN 182

Query: 185 LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
           +FM S  ++  +S +G++IF  LTAYDTQKIK  Y          +++V+GAL LY+DFI
Sbjct: 183 MFMGSERMEFIISILGVLIFVGLTAYDTQKIKNMYVSSDTGELMGKKAVMGALTLYLDFI 242

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G RR
Sbjct: 243 NLFIMLLRLFGQRR 256


>gi|154251848|ref|YP_001412672.1| hypothetical protein Plav_1395 [Parvibaculum lavamentivorans DS-1]
 gi|154155798|gb|ABS63015.1| protein of unknown function UPF0005 [Parvibaculum lavamentivorans
           DS-1]
          Length = 252

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 112/245 (45%), Positives = 166/245 (67%), Gaps = 8/245 (3%)

Query: 14  GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
           G+     +D+GLR+YM+RVYN MA  L +TG++++     A              G +LT
Sbjct: 15  GARANMAVDEGLRSYMLRVYNYMAGALALTGLVAYFAYTAAVQETA--------GGPVLT 66

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
             G  +Y SPL+W+ + APL   + L+  +  LS  A +++F  ++ ++GLSLSS FLV+
Sbjct: 67  SLGETLYASPLKWVVMLAPLAFVMVLSFGIQRLSLSATQLLFWAFAGVMGLSLSSIFLVF 126

Query: 134 TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAID 193
           T +SI  TFF+TAA+FGSLSLYGYTTKRDL  +GSF+ MG  G+ +  +VN+F+ SSA+ 
Sbjct: 127 TGESITTTFFVTAAAFGSLSLYGYTTKRDLTGMGSFLFMGLIGIIIAMVVNIFLASSALQ 186

Query: 194 LTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
             +S +G++IF+ LTAYDTQ+IK  Y +   VA A +++V+GAL LY+DFI +F+ LL+F
Sbjct: 187 FAISVLGVLIFAGLTAYDTQRIKGMYYEGDSVAAAGKKAVMGALSLYLDFINMFMFLLQF 246

Query: 254 LGSRR 258
           +GS+R
Sbjct: 247 MGSQR 251


>gi|83944524|ref|ZP_00956976.1| membrane protein, putative [Sulfitobacter sp. EE-36]
 gi|83955344|ref|ZP_00963999.1| membrane protein, putative [Sulfitobacter sp. NAS-14.1]
 gi|83840337|gb|EAP79511.1| membrane protein, putative [Sulfitobacter sp. NAS-14.1]
 gi|83844630|gb|EAP82515.1| membrane protein, putative [Sulfitobacter sp. EE-36]
          Length = 258

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 103/257 (40%), Positives = 167/257 (64%), Gaps = 3/257 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + +   + ++     + ID+GLR +M +VY  M++G+ +T   ++ ++ LA T DP  A 
Sbjct: 1   MADVNTIRSAAGSRAAAIDEGLRTHMNKVYGTMSIGMLITFAAAWAISGLAVTTDPSGAV 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
             I     LT FG+ +Y SPL+W+ +FAPL     L   ++ +SA  A+ +F +++A++G
Sbjct: 61  AQIGTDKYLTSFGSALYMSPLKWVVMFAPLAFVFGLGAAMNKISAATAQTLFYVFAAVMG 120

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +S+SS FLV+T  SI+Q F IT+ +F  LSL+GYTTK+D+   GSF+IMG  GL + S+V
Sbjct: 121 VSISSIFLVFTGYSIIQIFLITSIAFAGLSLWGYTTKKDISGWGSFLIMGVIGLVVASIV 180

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLY 240
           N+F+ S A+   +SA+G++IF+ LTAYDTQ IK  Y   +   D  + ++  ++GAL LY
Sbjct: 181 NIFLASPALVFAISAIGVLIFAGLTAYDTQNIKNTYLAHAHHGDQEWLQKSGIMGALSLY 240

Query: 241 MDFIQIFVHLLRFLGSR 257
           ++FI +F+ LL+  G+R
Sbjct: 241 LNFINMFMMLLQLFGNR 257


>gi|254472425|ref|ZP_05085825.1| integral membrane protein [Pseudovibrio sp. JE062]
 gi|211958708|gb|EEA93908.1| integral membrane protein [Pseudovibrio sp. JE062]
          Length = 249

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 122/256 (47%), Positives = 172/256 (67%), Gaps = 13/256 (5%)

Query: 3   DIRNYQRVVNSGS-GFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA 61
           D  N  R   +GS    +  D GLRAYM+RVYN MA+G+ +TG++++    +A +     
Sbjct: 5   DRNNSTRYGMAGSHANAAAFDAGLRAYMLRVYNYMAIGIAITGVVAYAAFQMAVSN---- 60

Query: 62  ASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
                     LT FG L++TSPLRW+ + APLG   FL+ R+H +SA  A++ F L++  
Sbjct: 61  --------GALTEFGVLLFTSPLRWVVMLAPLGFVFFLSARIHKMSASGAQLAFWLFAGA 112

Query: 122 IGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS 181
           +GLSLSS FLVYT  SI + FFITAASFG+LSL+GYTTK+DL   GSF+ MG  G+ + S
Sbjct: 113 MGLSLSSIFLVYTGNSIARVFFITAASFGALSLFGYTTKKDLSAWGSFLFMGLIGIIIAS 172

Query: 182 LVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYM 241
           LVNLF+ SSA+   +S +G+++F+ LTAYDTQ+IKE Y+   D   A +++++GAL LY+
Sbjct: 173 LVNLFLASSALQFAISVVGVLVFAGLTAYDTQQIKEMYAAVDDSEVAGKKAIMGALRLYL 232

Query: 242 DFIQIFVHLLRFLGSR 257
           DFI +F+ LL   G+R
Sbjct: 233 DFINLFIMLLSLFGNR 248


>gi|121602380|ref|YP_988340.1| hypothetical protein BARBAKC583_0001 [Bartonella bacilliformis
           KC583]
 gi|120614557|gb|ABM45158.1| putative membrane protein [Bartonella bacilliformis KC583]
          Length = 257

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 127/259 (49%), Positives = 179/259 (69%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D +N +    S +   ++IDQGLR+YM+ VYN MA+GL VT   ++ +  L TT D +
Sbjct: 1   MADFKNLRSASVSHA--DASIDQGLRSYMLSVYNTMAIGLLVTAAAAYAIASLTTTTDMN 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A+  IN  V LT FG   YTSPL ++ +F+PL   +FL+ ++++LS  AA+ +F  Y+ 
Sbjct: 59  LAAAQINSSVYLTSFGVAFYTSPLSYVIMFSPLIAVLFLSFKINTLSTSAARSLFYGYAM 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT +SIVQTF ITAA+FGSLSLYGYTTKRDL  +GSF+ +G  GL L 
Sbjct: 119 LVGLSLSSIILRYTPESIVQTFVITAAAFGSLSLYGYTTKRDLTAMGSFLFIGMIGLMLS 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            ++N+F+ S A+   +S +G++IF+ LTAY+TQ IK  Y +  +     R+ ++GAL LY
Sbjct: 179 MIINIFLGSDALQFAISVIGVLIFAGLTAYNTQTIKTMYYEGDEDDTRGRKIIMGALNLY 238

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +FV LL+FLGS RD
Sbjct: 239 LDFINMFVFLLQFLGSNRD 257


>gi|182677821|ref|YP_001831967.1| hypothetical protein Bind_0828 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633704|gb|ACB94478.1| protein of unknown function UPF0005 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 256

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 123/262 (46%), Positives = 167/262 (63%), Gaps = 9/262 (3%)

Query: 1   MSDIRNYQRVV---NSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD                  +TIDQGLRAYM+ VYN M +GL +TG+++   N+LA   
Sbjct: 1   MSDFDRNVSARWGQGLAGAGRTTIDQGLRAYMLGVYNHMVIGLAITGLVALGTNMLAVVH 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           D +           LT FG  +Y SPL+W+ + APLG  +F+++R+  ++A  A+ +F  
Sbjct: 61  DANGHIA------GLTAFGQALYLSPLKWVAMLAPLGFVLFISLRIEQMAASTARTLFFA 114

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           ++A +GLSLS+  LVYT  S+ + FFITAA+F  LSLYGYTTKRDL PIGSF++MG  GL
Sbjct: 115 FAATMGLSLSTLLLVYTGTSVARAFFITAAAFAGLSLYGYTTKRDLSPIGSFLVMGLIGL 174

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGAL 237
            + SLVNLF++S+A    +S + ++IFS LTA+DTQ IK  Y +      A ++SV GAL
Sbjct: 175 VIASLVNLFVQSTAFQFGLSILSVLIFSGLTAWDTQAIKAMYYESDGYEVATKKSVNGAL 234

Query: 238 MLYMDFIQIFVHLLRFLGSRRD 259
           MLY+DFI IF  LL   GSR D
Sbjct: 235 MLYLDFINIFQSLLMLTGSRND 256


>gi|319403496|emb|CBI77075.1| conserved membrane hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 257

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 126/259 (48%), Positives = 176/259 (67%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D +N +    S +   ++IDQGLR+YM+ VYN MA+GL +T   ++ +  LATT D  
Sbjct: 1   MADFKNLRSASISHA--DASIDQGLRSYMLGVYNTMAIGLLITAAAAYAIASLATTTDMS 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A   IN  V LT FG   Y SP  ++ +FAPL   +FL+ ++++LS   A+ +F  Y+ 
Sbjct: 59  QAVAQINGSVYLTSFGVTFYMSPFSYVIMFAPLVAVLFLSFKINTLSTSVARSLFFGYAT 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT +SIVQTF IT+A+FGSLSLYGYTTKRDL  +GSF+ MG  GL L 
Sbjct: 119 LVGLSLSSIILRYTPESIVQTFVITSAAFGSLSLYGYTTKRDLTAVGSFLFMGLIGLMLA 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           ++VN+F+ SSA+   +S +G+++F+ LTAY+TQ IK  Y +        R+ ++GAL LY
Sbjct: 179 TIVNIFLGSSALQFAISVIGVLVFAGLTAYNTQNIKLMYYEGDGYDTRSRKIIMGALNLY 238

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +FV LL+FLGS RD
Sbjct: 239 LDFINMFVFLLQFLGSNRD 257


>gi|119384131|ref|YP_915187.1| hypothetical protein Pden_1390 [Paracoccus denitrificans PD1222]
 gi|119373898|gb|ABL69491.1| protein of unknown function UPF0005 [Paracoccus denitrificans
           PD1222]
          Length = 256

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 110/257 (42%), Positives = 169/257 (65%), Gaps = 5/257 (1%)

Query: 4   IRNYQRVVNSGSGF-GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           +++Y  +  +G+    + +D+GLRAYM +VY LMA+G+ VT   ++ +  LA +  P   
Sbjct: 1   MQDYNSIRTAGTATRSAAVDEGLRAYMNKVYGLMAVGMLVTAGAAWGMAGLALSDTPTQW 60

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
           +  +  G  LT FG  +Y SPL+W+ +FAPL +       L+ LS   A  +F  ++A++
Sbjct: 61  A--LGNGHYLTEFGKTLYLSPLKWVVMFAPLVMVFAFGAALNRLSVQGATTLFYAFAAVM 118

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G+S+S  F  YTS SI+QTF ITA +F  LSLYGYTTKRDL  +G+F++MG  GL +  +
Sbjct: 119 GISISWIFAAYTSFSIIQTFLITAIAFSGLSLYGYTTKRDLSGMGTFLMMGLIGLIVAMI 178

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLY 240
           VN+F++SSA+   +SA+G++IF+ LTAYDTQ IK  Y      D  +  + +++GAL LY
Sbjct: 179 VNIFLQSSAMQFAISAIGVLIFAGLTAYDTQNIKNTYLQLANSDRDFLGKAAIMGALQLY 238

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DF+ +F+ LL+FLG+R
Sbjct: 239 LDFLNLFMFLLQFLGNR 255


>gi|319406410|emb|CBI80050.1| conserved membrane hypothetical protein [Bartonella sp. 1-1C]
          Length = 257

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 126/259 (48%), Positives = 176/259 (67%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D +N +    S +   ++IDQGLR+YM+ VYN MA+GL  T   ++ +  LATT D  
Sbjct: 1   MADFKNLRSASVSHA--DASIDQGLRSYMLGVYNTMAIGLLTTAAAAYAIASLATTTDMS 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A+  IN  V LT FG   Y SP  ++ +FAPL   +FL+ ++++LS   A+ +F  Y+ 
Sbjct: 59  QAAAQINGSVYLTSFGVTFYMSPFSYVIMFAPLVAVLFLSFKINTLSTSVARSLFFGYAT 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT +SIVQTF IT+A+FGSLSLYGYTTKRDL  +GSF+ MG  GL L 
Sbjct: 119 LVGLSLSSIILRYTPESIVQTFVITSAAFGSLSLYGYTTKRDLTAVGSFLFMGLIGLMLA 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           ++VN+F+ SSA+   +S +G+++F+ LTAY+TQ IK  Y +        R+ ++GAL LY
Sbjct: 179 TIVNIFLGSSALQFAISVIGVLVFAGLTAYNTQHIKLMYYEGDGYDTRSRKIIMGALNLY 238

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +FV LL+FLGS RD
Sbjct: 239 LDFINMFVFLLQFLGSNRD 257


>gi|220921771|ref|YP_002497072.1| hypothetical protein Mnod_1779 [Methylobacterium nodulans ORS 2060]
 gi|219946377|gb|ACL56769.1| protein of unknown function UPF0005 [Methylobacterium nodulans ORS
           2060]
          Length = 274

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 119/252 (47%), Positives = 162/252 (64%), Gaps = 7/252 (2%)

Query: 15  SGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD------AASIIINR 68
           +     +DQGLRA+M+ VYN M LGL V+ +++  VN LATT  P       A  ++   
Sbjct: 23  ARGQVEVDQGLRAFMLGVYNNMVLGLAVSALVALGVNKLATTAVPAEAARNGAGQMVRIG 82

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
           G  LT FG  +YT+PL W+   APL      + R+  +SA +A+  FL ++A++G SLS+
Sbjct: 83  GQYLTQFGLTLYTTPLMWVVALAPLAFIFLFSFRMDRMSAASARTTFLAFAAVMGASLST 142

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
             L YT  S+VQ FFITAA+FG LSLYGY+T R L  IGSF++MG  GL + SLVN+F+ 
Sbjct: 143 LLLRYTGASVVQVFFITAAAFGGLSLYGYSTSRSLSGIGSFLVMGLIGLLIASLVNIFLA 202

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY-DVAYAERQSVIGALMLYMDFIQIF 247
           SSA+   +S +G+VIF+ LTAYDTQK+KE Y     D   A + SV GAL LY+DFI +F
Sbjct: 203 SSALQFAISVIGVVIFAGLTAYDTQKLKEMYLYGNFDQEAAAKVSVFGALTLYLDFINMF 262

Query: 248 VHLLRFLGSRRD 259
             LL  +G+R +
Sbjct: 263 QFLLSLIGNRNE 274


>gi|170743563|ref|YP_001772218.1| hypothetical protein M446_5468 [Methylobacterium sp. 4-46]
 gi|168197837|gb|ACA19784.1| protein of unknown function UPF0005 [Methylobacterium sp. 4-46]
          Length = 274

 Score =  150 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 121/252 (48%), Positives = 163/252 (64%), Gaps = 7/252 (2%)

Query: 15  SGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD------AASIIINR 68
           +     +DQGLRA+M+ VYN M LGL V+ +++  VN LATT  P       A  ++   
Sbjct: 23  ARGQVEVDQGLRAFMLGVYNNMVLGLAVSALVALGVNKLATTAVPAEAARNGAGQMVRIG 82

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
           G  LT FG  +YT+PL W+   APL    F + R+  +SA +A+  FL ++A++G SLS+
Sbjct: 83  GQYLTQFGITLYTTPLMWVVALAPLAFIFFFSFRMDRMSAASARTTFLAFAAVMGASLST 142

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
             L YT  S+VQ FFITAA+FG LSLYGYTT R L  IGSF++MG  GL + SLVN+F+ 
Sbjct: 143 LLLRYTGASVVQVFFITAAAFGGLSLYGYTTARSLSGIGSFLVMGLIGLVIASLVNIFLA 202

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY-DVAYAERQSVIGALMLYMDFIQIF 247
           SSA+   +S +GL+IF+ LTAYDTQK+KE Y     D   A + SV GAL LY+DFI +F
Sbjct: 203 SSALQFAISVIGLLIFAGLTAYDTQKLKEMYLYGNFDQEAAAKVSVFGALTLYLDFINMF 262

Query: 248 VHLLRFLGSRRD 259
             LL  +G+R +
Sbjct: 263 QFLLALMGNRNE 274


>gi|89071170|ref|ZP_01158363.1| membrane protein, putative [Oceanicola granulosus HTCC2516]
 gi|89043296|gb|EAR49521.1| membrane protein, putative [Oceanicola granulosus HTCC2516]
          Length = 256

 Score =  150 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 108/257 (42%), Positives = 166/257 (64%), Gaps = 5/257 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  YQ V  +     + ID+GL+A+M +VY  M++G+ +T + ++ +N LA T    A +
Sbjct: 1   MAQYQTVRTADGVRSAAIDEGLKAHMNKVYGTMSVGMLITALAAWAINGLAVT--DVANA 58

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
             I     LT FG  +Y SPL+W+ +F PL +       ++ LSA +A++ F  ++AL+G
Sbjct: 59  YQIGADKYLTDFGYAIYASPLKWVIMFLPLVMVFAFGAMINRLSAASAQLFFYTFAALMG 118

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSLS  F+ +TS SIVQ F +TA +F  LSL+GYTTK+D+   GSF+IMG  GL + SLV
Sbjct: 119 LSLSWIFIAFTSYSIVQVFLVTAIAFAGLSLWGYTTKKDISGWGSFLIMGVIGLIVASLV 178

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLY 240
           N+F++S AI   +S +G++IF+ LTAYDTQ IK  Y   +   D  +  + +++GAL LY
Sbjct: 179 NIFLQSPAIMYAISIIGVLIFAGLTAYDTQNIKNTYIAHAAHGDQEWLGKAAIMGALNLY 238

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DFI +F+ LL+ +G+R
Sbjct: 239 LDFINMFMFLLQLMGNR 255


>gi|167045735|gb|ABZ10382.1| putative uncharacterized protein family UPF0005 [uncultured marine
           bacterium HF4000_APKG2098]
          Length = 259

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 111/256 (43%), Positives = 162/256 (63%), Gaps = 6/256 (2%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           +                 ID+GLRA+M++VYN M  G+ +TGI+S  +  L+  + PD  
Sbjct: 10  EFNKQNIQSKVTVAETHVIDEGLRAHMLKVYNYMTSGIFLTGIISLFLFKLSVVMSPD-- 67

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                    LT  G  +Y S L W+ + APLGV  +++  +  +SA  A+M F +++AL+
Sbjct: 68  ----GSIAGLTSVGNALYNSALMWVVMLAPLGVVFYMSFGIRKMSAAKAQMTFWIFAALM 123

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G SLSS FLVYT +SI + FFITA +FG++S+YGYTTKRDL  +GSF++MG  G+ + S+
Sbjct: 124 GASLSSIFLVYTGESITRVFFITAGTFGAMSIYGYTTKRDLTKLGSFLMMGLIGIIIASI 183

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           VN+FM+S+ +   +S +G++IF  LTAYDTQKIK  YS         +++V+GAL LY+D
Sbjct: 184 VNIFMKSTMMYFVISILGVLIFVGLTAYDTQKIKNMYSVSDSGEIMGKKAVMGALTLYLD 243

Query: 243 FIQIFVHLLRFLGSRR 258
           FI +F+ LLR  G RR
Sbjct: 244 FINLFIMLLRLFGQRR 259


>gi|49474839|ref|YP_032880.1| hypothetical protein BH00080 [Bartonella henselae str. Houston-1]
 gi|49237644|emb|CAF26824.1| hypothetical protein BH00080 [Bartonella henselae str. Houston-1]
          Length = 257

 Score =  148 bits (373), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 128/259 (49%), Positives = 175/259 (67%), Gaps = 2/259 (0%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D +N      S     ++IDQGLR+YM+ VYN MA+GL +T   ++ V  LATT +  
Sbjct: 1   MADFKN--SRPASLFHADASIDQGLRSYMLGVYNTMAIGLLITAAAAYAVASLATTTEMS 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A+  I+  V LT FG   YTSP  +I +FAPL   +FL+ ++++LS   A+ +F  Y+A
Sbjct: 59  QAAAQISSSVYLTSFGVTFYTSPFSYIIMFAPLVAVLFLSFKINTLSTSTARSLFFGYAA 118

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLSS  L YT++SIVQTF I+AA+FG+LSLYGYTTKRDL  +GSF  +G  GL L 
Sbjct: 119 LVGLSLSSIILRYTTESIVQTFVISAATFGALSLYGYTTKRDLTAMGSFFFIGLVGLMLS 178

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +VN+F+ SSA+   +S +G+ IF+ LTAYDTQ IK  Y +        R+ ++GAL LY
Sbjct: 179 MIVNIFLGSSALQFAISVIGVFIFAGLTAYDTQNIKLMYYEGDANDTQGRKIIMGALNLY 238

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +FV LL+FLGS RD
Sbjct: 239 LDFINMFVFLLQFLGSNRD 257


>gi|17988142|ref|NP_540776.1| integral membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|23501002|ref|NP_697129.1| hypothetical protein BR0088 [Brucella suis 1330]
 gi|62289071|ref|YP_220864.1| hypothetical protein BruAb1_0086 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699008|ref|YP_413582.1| hypothetical protein BAB1_0084 [Brucella melitensis biovar Abortus
           2308]
 gi|161618075|ref|YP_001591962.1| hypothetical protein BCAN_A0090 [Brucella canis ATCC 23365]
 gi|163842362|ref|YP_001626766.1| hypothetical protein BSUIS_A0092 [Brucella suis ATCC 23445]
 gi|189023345|ref|YP_001934113.1| hypothetical protein BAbS19_I00790 [Brucella abortus S19]
 gi|225626630|ref|ZP_03784669.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225851627|ref|YP_002731860.1| hypothetical protein BMEA_A0093 [Brucella melitensis ATCC 23457]
 gi|237814560|ref|ZP_04593558.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254690399|ref|ZP_05153653.1| hypothetical protein Babob68_09549 [Brucella abortus bv. 6 str.
           870]
 gi|254694887|ref|ZP_05156715.1| hypothetical protein Babob3T_09537 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696516|ref|ZP_05158344.1| hypothetical protein Babob28_02055 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254705264|ref|ZP_05167092.1| hypothetical protein Bsuib36_15368 [Brucella suis bv. 3 str. 686]
 gi|254707212|ref|ZP_05169040.1| hypothetical protein BpinM_09628 [Brucella pinnipedialis
           M163/99/10]
 gi|254709242|ref|ZP_05171053.1| hypothetical protein BpinB_03041 [Brucella pinnipedialis B2/94]
 gi|254713335|ref|ZP_05175146.1| hypothetical protein BcetM6_08282 [Brucella ceti M644/93/1]
 gi|254716311|ref|ZP_05178122.1| hypothetical protein BcetM_07725 [Brucella ceti M13/05/1]
 gi|254718307|ref|ZP_05180118.1| hypothetical protein Bru83_01963 [Brucella sp. 83/13]
 gi|254731429|ref|ZP_05190007.1| hypothetical protein Babob42_09574 [Brucella abortus bv. 4 str.
           292]
 gi|256030765|ref|ZP_05444379.1| hypothetical protein BpinM2_08952 [Brucella pinnipedialis
           M292/94/1]
 gi|256045879|ref|ZP_05448753.1| hypothetical protein Bmelb1R_15329 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256060229|ref|ZP_05450405.1| hypothetical protein Bneo5_07700 [Brucella neotomae 5K33]
 gi|256112592|ref|ZP_05453513.1| hypothetical protein Bmelb3E_07915 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158785|ref|ZP_05456646.1| hypothetical protein BcetM4_07868 [Brucella ceti M490/95/1]
 gi|256254169|ref|ZP_05459705.1| hypothetical protein BcetB_07720 [Brucella ceti B1/94]
 gi|256258653|ref|ZP_05464189.1| hypothetical protein Babob9C_15161 [Brucella abortus bv. 9 str.
           C68]
 gi|256264861|ref|ZP_05467393.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|256368554|ref|YP_003106060.1| hypothetical protein BMI_I91 [Brucella microti CCM 4915]
 gi|260169668|ref|ZP_05756479.1| hypothetical protein BruF5_15173 [Brucella sp. F5/99]
 gi|260546366|ref|ZP_05822106.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260563165|ref|ZP_05833651.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260567268|ref|ZP_05837738.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260755944|ref|ZP_05868292.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260759169|ref|ZP_05871517.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260760893|ref|ZP_05873236.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884968|ref|ZP_05896582.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261215220|ref|ZP_05929501.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261218091|ref|ZP_05932372.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261221319|ref|ZP_05935600.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261314694|ref|ZP_05953891.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316747|ref|ZP_05955944.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321062|ref|ZP_05960259.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261324206|ref|ZP_05963403.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261755977|ref|ZP_05999686.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261759204|ref|ZP_06002913.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265983267|ref|ZP_06096002.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265987819|ref|ZP_06100376.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265992293|ref|ZP_06104850.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994034|ref|ZP_06106591.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265997279|ref|ZP_06109836.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|294851493|ref|ZP_06792166.1| hypothetical protein BAZG_00398 [Brucella sp. NVSL 07-0026]
 gi|297247486|ref|ZP_06931204.1| hypothetical protein BAYG_00392 [Brucella abortus bv. 5 str. B3196]
 gi|306837239|ref|ZP_07470129.1| integral membrane protein [Brucella sp. NF 2653]
 gi|306842632|ref|ZP_07475280.1| integral membrane protein [Brucella sp. BO2]
 gi|306846354|ref|ZP_07478905.1| integral membrane protein [Brucella sp. BO1]
 gi|17983899|gb|AAL53040.1| integral membrane protein [Brucella melitensis bv. 1 str. 16M]
 gi|23346863|gb|AAN29044.1| membrane protein, putative [Brucella suis 1330]
 gi|62195203|gb|AAX73503.1| hypothetical membrane protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615109|emb|CAJ10040.1| Protein of unknown function UPF0005 [Brucella melitensis biovar
           Abortus 2308]
 gi|161334886|gb|ABX61191.1| hypothetical protein BCAN_A0090 [Brucella canis ATCC 23365]
 gi|163673085|gb|ABY37196.1| hypothetical protein BSUIS_A0092 [Brucella suis ATCC 23445]
 gi|189018917|gb|ACD71639.1| hypothetical protein BAbS19_I00790 [Brucella abortus S19]
 gi|225618287|gb|EEH15330.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225639992|gb|ACN99905.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|237789397|gb|EEP63607.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|255998712|gb|ACU47111.1| hypothetical protein BMI_I91 [Brucella microti CCM 4915]
 gi|260096473|gb|EEW80349.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260153181|gb|EEW88273.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260156786|gb|EEW91866.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260669487|gb|EEX56427.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260671325|gb|EEX58146.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676052|gb|EEX62873.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260874496|gb|EEX81565.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260916827|gb|EEX83688.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260919903|gb|EEX86556.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260923180|gb|EEX89748.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261293752|gb|EEX97248.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261295970|gb|EEX99466.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261300186|gb|EEY03683.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261303720|gb|EEY07217.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261739188|gb|EEY27184.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261745730|gb|EEY33656.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262551747|gb|EEZ07737.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262765015|gb|EEZ10936.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003359|gb|EEZ15652.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263095316|gb|EEZ18943.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264660016|gb|EEZ30277.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|264661859|gb|EEZ32120.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294820082|gb|EFG37081.1| hypothetical protein BAZG_00398 [Brucella sp. NVSL 07-0026]
 gi|297174655|gb|EFH34002.1| hypothetical protein BAYG_00392 [Brucella abortus bv. 5 str. B3196]
 gi|306273197|gb|EFM55088.1| integral membrane protein [Brucella sp. BO1]
 gi|306287224|gb|EFM58715.1| integral membrane protein [Brucella sp. BO2]
 gi|306407698|gb|EFM63887.1| integral membrane protein [Brucella sp. NF 2653]
 gi|326408101|gb|ADZ65166.1| integral membrane protein [Brucella melitensis M28]
 gi|326537815|gb|ADZ86030.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 245

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 126/259 (48%), Positives = 177/259 (68%), Gaps = 17/259 (6%)

Query: 1   MSDIRNYQRVVNS--GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVD 58
           M+D RN Q       G+   + IDQGLR+YM+ VYN+MA+GL VTG+ +F   +LA +  
Sbjct: 1   MADFRNIQAQQRPVGGARADAGIDQGLRSYMLGVYNMMAIGLAVTGLAAFGTAVLAQSN- 59

Query: 59  PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
                           F  L++ SPLRW+ + APL    FL+ R+ SLS   A+ +F  Y
Sbjct: 60  --------------PAFQQLLFASPLRWVIMLAPLAAVFFLSFRIQSLSVGTAQAIFWGY 105

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
           +AL+GLSLSS F+V+T +SIV+TFF+TAASFG+LSLYGYTTKR+L  +GSF++MG FGL 
Sbjct: 106 AALVGLSLSSIFIVFTGQSIVRTFFVTAASFGALSLYGYTTKRNLSAMGSFLMMGLFGLI 165

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALM 238
           L S+VN+F+ S+A+   +S +G++IF+ LTAYDTQ+IKE Y +        R+ V+GAL 
Sbjct: 166 LASVVNIFLGSTALQFAISVIGVLIFAGLTAYDTQEIKEMYYEGDAADTQGRKIVMGALR 225

Query: 239 LYMDFIQIFVHLLRFLGSR 257
           LY+DFI +F+ LL+F+G+R
Sbjct: 226 LYLDFINMFMFLLQFMGNR 244


>gi|163851691|ref|YP_001639734.1| hypothetical protein Mext_2268 [Methylobacterium extorquens PA1]
 gi|163663296|gb|ABY30663.1| protein of unknown function UPF0005 [Methylobacterium extorquens
           PA1]
          Length = 294

 Score =  146 bits (368), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 110/245 (44%), Positives = 156/245 (63%), Gaps = 5/245 (2%)

Query: 15  SGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           +G    +DQGLR++M+ VYN M +GLG++G+++  +N+   T    A      +GV L  
Sbjct: 54  AGSQVEVDQGLRSFMLGVYNNMVVGLGISGLVALALNMAVQTGTIVAN----YKGVPLNQ 109

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
            G  +Y S  ++I + APL        R+  +SA +A+  F  ++A++G SLSS  L +T
Sbjct: 110 LGVFIYGSWFKYILMLAPLAFIFVFTFRMDRMSAASARTAFWAFAAVMGASLSSMLLAFT 169

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             S+V+ FFITAA+F  LSLYGYTTKR L  +GSF+IMG  G+ + SLVN+F+ SSA+  
Sbjct: 170 GASVVRVFFITAATFAGLSLYGYTTKRSLSGMGSFLIMGLIGIIIASLVNIFLASSALQF 229

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRY-DVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
            +S +G++IF+ LTAYDTQK+KE Y     D   A + SV GAL LY+DFI +F  LL  
Sbjct: 230 AISVIGVLIFAGLTAYDTQKLKEMYLYSGFDAEGAAKMSVNGALTLYLDFINMFQFLLSL 289

Query: 254 LGSRR 258
           LG RR
Sbjct: 290 LGDRR 294


>gi|254700900|ref|ZP_05162728.1| hypothetical protein Bsuib55_08584 [Brucella suis bv. 5 str. 513]
 gi|261751415|ref|ZP_05995124.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261741168|gb|EEY29094.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
          Length = 245

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 126/259 (48%), Positives = 177/259 (68%), Gaps = 17/259 (6%)

Query: 1   MSDIRNYQRVVNS--GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVD 58
           M+D RN Q       G+   + IDQGLR+YM+ VYN+MA+GL VTG+ +F   +LA +  
Sbjct: 1   MADFRNIQAQQRPVGGAHADAGIDQGLRSYMLGVYNMMAIGLAVTGLAAFGTAVLAQSN- 59

Query: 59  PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
                           F  L++ SPLRW+ + APL    FL+ R+ SLS   A+ +F  Y
Sbjct: 60  --------------PAFQQLLFASPLRWVIMLAPLAAVFFLSFRIQSLSVGTAQAIFWGY 105

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
           +AL+GLSLSS F+V+T +SIV+TFF+TAASFG+LSLYGYTTKR+L  +GSF++MG FGL 
Sbjct: 106 AALVGLSLSSIFIVFTGQSIVRTFFVTAASFGALSLYGYTTKRNLSAMGSFLMMGLFGLI 165

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALM 238
           L S+VN+F+ S+A+   +S +G++IF+ LTAYDTQ+IKE Y +        R+ V+GAL 
Sbjct: 166 LASVVNIFLGSTALQFAISVIGVLIFAGLTAYDTQEIKEMYYEGDAADTQGRKIVMGALR 225

Query: 239 LYMDFIQIFVHLLRFLGSR 257
           LY+DFI +F+ LL+F+G+R
Sbjct: 226 LYLDFINMFMFLLQFMGNR 244


>gi|148559281|ref|YP_001258129.1| hypothetical protein BOV_0086 [Brucella ovis ATCC 25840]
 gi|148370538|gb|ABQ60517.1| putative membrane protein [Brucella ovis ATCC 25840]
          Length = 245

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 126/259 (48%), Positives = 177/259 (68%), Gaps = 17/259 (6%)

Query: 1   MSDIRNYQRVVNS--GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVD 58
           M+D RN Q       G+   + IDQGLR+YM+ VYN+MA+GL VTG+ +F   +LA +  
Sbjct: 1   MADFRNIQAQQRPVGGARADAGIDQGLRSYMLGVYNMMAIGLAVTGLAAFGTAVLAQSN- 59

Query: 59  PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
                           F  L++ SPLRW+ + APL    FL+ R+ SLS   A+ +F  Y
Sbjct: 60  --------------PAFQQLLFASPLRWVIMLAPLAAVFFLSFRIQSLSVGTAQAIFWGY 105

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
           +AL+GLSLSS F+V+T +SIV+TFF+TAASFG+LSLYGYTTKR+L  +GSF++MG FGL 
Sbjct: 106 AALVGLSLSSIFIVFTGQSIVRTFFVTAASFGALSLYGYTTKRNLSAMGSFLMMGLFGLT 165

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALM 238
           L S+VN+F+ S+A+   +S +G++IF+ LTAYDTQ+IKE Y +        R+ V+GAL 
Sbjct: 166 LASVVNIFLGSTALQFAISVIGVLIFAGLTAYDTQEIKEMYYEGDAADTQGRKIVMGALR 225

Query: 239 LYMDFIQIFVHLLRFLGSR 257
           LY+DFI +F+ LL+F+G+R
Sbjct: 226 LYLDFINMFMFLLQFMGNR 244


>gi|71082996|ref|YP_265715.1| integral membrane protein [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062109|gb|AAZ21112.1| integral membrane protein [Candidatus Pelagibacter ubique HTCC1062]
          Length = 232

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 108/238 (45%), Positives = 162/238 (68%), Gaps = 6/238 (2%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           +D+GLRAYM++VYN MA G+ +TG++S +   L+   D +           LT  G  ++
Sbjct: 1   MDEGLRAYMLKVYNYMASGILLTGLISLIFFKLSVVTDAN------GSITALTSLGNTIF 54

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S  +WI + APLGV  +++ R++ ++A  A+  F ++++L+GLSLSS FLVYT  SI +
Sbjct: 55  LSGFKWIVMLAPLGVVFYMSARINKMTASTAQTTFWVFASLMGLSLSSIFLVYTGASITR 114

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
            FFIT+ +FG++SLYGYTTKRDL  +GSF++MG  G+ + S+VN+F++SS +D  +S +G
Sbjct: 115 VFFITSITFGAMSLYGYTTKRDLTKLGSFLMMGLIGIIVASVVNMFLKSSMMDFVISILG 174

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           ++IF  LTAYDTQKIK  Y          +++V+GAL LY+DFI +F+ LLR  G RR
Sbjct: 175 VLIFVGLTAYDTQKIKNMYVSSDTGELMGKKAVMGALTLYLDFINLFIMLLRLFGQRR 232


>gi|75674611|ref|YP_317032.1| hypothetical protein Nwi_0413 [Nitrobacter winogradskyi Nb-255]
 gi|74419481|gb|ABA03680.1| Protein of unknown function UPF0005 [Nitrobacter winogradskyi
           Nb-255]
          Length = 263

 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 118/251 (47%), Positives = 167/251 (66%), Gaps = 7/251 (2%)

Query: 1   MSDI-RNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY   +    G    + +D GLRAYM+++YN M++GL +TG+ +  V + A T 
Sbjct: 1   MSDLDRNYATPLGRADGRVDAAAVDAGLRAYMLKIYNYMSIGLAITGLAALGVYMAAVTG 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           DP  A+  +     LT FG  M+ SPL+W+FI APL +   ++  ++ L    A+M+F  
Sbjct: 61  DPSGAAAKLGNA-YLTPFGYAMFVSPLKWVFILAPLAMVFVISFGINRLKPATAQMLFWA 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           +SAL+GLSLSS FLVYT  SIV+ FFITAASFG+LSL+GYTTKRD+  +GSF+ MG  G+
Sbjct: 120 FSALMGLSLSSIFLVYTHTSIVRVFFITAASFGALSLFGYTTKRDMTGMGSFLFMGLIGV 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVI 234
            + SLVNLF+ SSA+   +S  G+++F+ LTA+DTQ++K  Y   Y       AER ++ 
Sbjct: 180 IIASLVNLFIASSALQFVVSVAGVLVFAGLTAWDTQRLKNDYIYGYASQGGEIAERAAIT 239

Query: 235 GALMLYMDFIQ 245
           GAL LY++FI 
Sbjct: 240 GALSLYLNFIN 250


>gi|254449846|ref|ZP_05063283.1| integral membrane protein [Octadecabacter antarcticus 238]
 gi|198264252|gb|EDY88522.1| integral membrane protein [Octadecabacter antarcticus 238]
          Length = 260

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 101/260 (38%), Positives = 166/260 (63%), Gaps = 6/260 (2%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D R  Q     G    + ID+GLRA+M +VY LM+ GL +T + ++ +  +  +  P 
Sbjct: 3   MADYRTPQMGATVGVHT-AEIDEGLRAHMNKVYGLMSFGLLMTFLAAWAIGTMTVSAVPT 61

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
             +I  N+   LT  GA +Y SPL+W+ +F PL +    +  ++ +SA AA+  F +++ 
Sbjct: 62  QYAIGSNQ--YLTDLGATLYLSPLKWVVMFLPLVLVFVFSAMINRMSAAAAQTFFYVFAT 119

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
            +G+S+S  F+ +T  SI Q F IT+ +FG LSL+GYTTKRD+   G F+IMG  GL + 
Sbjct: 120 AMGVSISWIFVAFTGASIAQVFLITSIAFGGLSLWGYTTKRDISGWGGFLIMGVIGLIVA 179

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGAL 237
           S+VN++++S  I   +S +GL+IF+ LTAYDTQ+IK  Y   ++  D  + ++ +++G+L
Sbjct: 180 SVVNIWLQSDVIGWAVSIIGLLIFAGLTAYDTQRIKTDYIAHAEHGDQEWMDKSAIMGSL 239

Query: 238 MLYMDFIQIFVHLLRFLGSR 257
            LY++FI +F+ LL+ +G+R
Sbjct: 240 SLYINFINMFMFLLQLMGNR 259


>gi|163793901|ref|ZP_02187875.1| hypothetical protein BAL199_12751 [alpha proteobacterium BAL199]
 gi|159181012|gb|EDP65529.1| hypothetical protein BAL199_12751 [alpha proteobacterium BAL199]
          Length = 243

 Score =  145 bits (365), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 110/254 (43%), Positives = 172/254 (67%), Gaps = 12/254 (4%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + + ++ ++      +  D GLR YM+ VYN M   L  TGI+++   +LA         
Sbjct: 1   MDSNRKYMSRADADVAQYDVGLRQYMLGVYNHMVSALVFTGIVAYATTVLAV-------- 52

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
               +   +TGFG  +Y SPL+W+ + APLG+   L+ R+ S+S  +A++ F +++AL+G
Sbjct: 53  ----QDGAMTGFGQAIYASPLKWVVMLAPLGMVFLLSARIRSMSLGSARISFYVFAALMG 108

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSLSS FLV+T +S+V+ FFITAA+FG LSLYGYTTK+DL   GSF+IMG FG+ + S+V
Sbjct: 109 LSLSSIFLVFTGESVVRVFFITAAAFGGLSLYGYTTKKDLSGFGSFLIMGLFGIIIASIV 168

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F+ SSA+   +S +G+++F+ LTAYDTQ+IKE Y++      A +++++GAL LY++F
Sbjct: 169 NIFLASSALQFAISVIGVLVFAGLTAYDTQRIKEMYNEIDASDIAGKKAIMGALSLYLNF 228

Query: 244 IQIFVHLLRFLGSR 257
           I +F+ LL+  G+R
Sbjct: 229 INMFMLLLQLFGNR 242


>gi|312115039|ref|YP_004012635.1| hypothetical protein Rvan_2312 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220168|gb|ADP71536.1| protein of unknown function UPF0005 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 257

 Score =  144 bits (364), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 109/263 (41%), Positives = 164/263 (62%), Gaps = 10/263 (3%)

Query: 1   MSDIRNYQRVVNSGSGFGST--IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVD 58
           M+D    +    +         ID+GLRA+MIRVY+ M +GL VTGIM++ +   A   +
Sbjct: 1   MADYDTSRAYNANARARTDAFAIDEGLRAHMIRVYSYMGIGLLVTGIMAYTIYSQAVITN 60

Query: 59  PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
                    + V LT  G +++ S ++W+ +FAPL V    +  ++ +S   A+ +F L+
Sbjct: 61  DA------GKIVGLTSLGTVIFKSWVKWLVMFAPLIVVFAFSATINRMSTATAQGVFWLF 114

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
           +AL+GLSLSS F+ YT  SI + FFITAA+FG++S+YGYTTK DL   GSF+IMG  GL 
Sbjct: 115 AALMGLSLSSIFIAYTGTSIARIFFITAATFGAVSIYGYTTKADLTKFGSFLIMGVIGLV 174

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGA 236
           + S+VN F+ S+ +   +S + ++IF+ LTAYDTQ+IK+ Y    +Y        +++GA
Sbjct: 175 IASIVNAFLGSTGLQFAISVLAVLIFTGLTAYDTQQIKDNYLAQAQYGGQSLGHAAILGA 234

Query: 237 LMLYMDFIQIFVHLLRFLGSRRD 259
           L LY+DFI IFV L++  G RR+
Sbjct: 235 LSLYLDFINIFVALMQLFGERRE 257


>gi|288956871|ref|YP_003447212.1| hypothetical protein AZL_000300 [Azospirillum sp. B510]
 gi|288909179|dbj|BAI70668.1| hypothetical protein AZL_000300 [Azospirillum sp. B510]
          Length = 256

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 105/259 (40%), Positives = 159/259 (61%), Gaps = 19/259 (7%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D    +      +     +D+GLR +M+RVYN M  GL +TG+++ LV+         
Sbjct: 16  MADPTYNRFATVGRATDRGYLDEGLRQHMLRVYNYMGAGLILTGLVAALVSSSPA----- 70

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                             ++ SPL+W+ + APL   + L+  +  LS  +A+M+F  Y  
Sbjct: 71  --------------IMMAIFGSPLKWVVMLAPLAFVMVLSFGIQRLSFASAQMIFWAYCG 116

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
            +GLS+S+ FLV+T  SI  TFF+TAA+F ++SLYGYTTK DL  +GSF++MG  GL + 
Sbjct: 117 AMGLSMSAIFLVFTGASIALTFFVTAATFLAMSLYGYTTKADLSKMGSFLMMGVIGLVIA 176

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            L N+F +S A+   +SA+G++IF+ LTAYDTQ IKE+Y++ YD   A + +++GAL LY
Sbjct: 177 GLANIFFQSPALHFAISAIGVLIFTGLTAYDTQAIKESYAESYDHESAGKLALMGALTLY 236

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +DFI +F  LL+FLG R +
Sbjct: 237 LDFINLFQFLLQFLGQRNN 255


>gi|46202998|ref|ZP_00052253.2| COG0670: Integral membrane protein, interacts with FtsH
           [Magnetospirillum magnetotacticum MS-1]
          Length = 255

 Score =  144 bits (362), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 114/253 (45%), Positives = 162/253 (64%), Gaps = 8/253 (3%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y       +G    +DQGLR++M+ VYN M +GLG++G+++  +N+ A            
Sbjct: 10  YGAQPQGYAGSQVEVDQGLRSFMLGVYNNMVVGLGISGLVALGLNMAAVAQTGAGR---- 65

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
              + LT FG  +YTSP +W+ + APL      + R+  +SA +A+ MF  ++A++G S+
Sbjct: 66  ---LALTPFGQFLYTSPFKWVLMLAPLAFIFVFSFRMDRMSAASARTMFWAFAAVMGASM 122

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           S+  LV+T  S+V+ FFITAA+FG LSLYGYTTKR L  +GSF+IMG  GL + SLVN+F
Sbjct: 123 STLLLVFTGASVVRVFFITAATFGGLSLYGYTTKRSLSGMGSFLIMGLIGLIIASLVNIF 182

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY-DVAYAERQSVIGALMLYMDFIQ 245
           + SSA+   +S +G++IF+ LTAYDTQK+KE Y     D   A + SV GAL LY+DFI 
Sbjct: 183 LASSALQFAISVIGVLIFAGLTAYDTQKLKEMYLYSGLDAEGAAKMSVNGALTLYLDFIN 242

Query: 246 IFVHLLRFLGSRR 258
           +F  LL  LG RR
Sbjct: 243 MFQFLLSLLGDRR 255


>gi|296445157|ref|ZP_06887117.1| protein of unknown function UPF0005 [Methylosinus trichosporium
           OB3b]
 gi|296257331|gb|EFH04398.1| protein of unknown function UPF0005 [Methylosinus trichosporium
           OB3b]
          Length = 258

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 115/247 (46%), Positives = 156/247 (63%), Gaps = 9/247 (3%)

Query: 14  GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
                + ID+GLRAYMI VYN M LGLGVTG ++   +++A             R + LT
Sbjct: 17  SRAGAAQIDEGLRAYMIGVYNHMVLGLGVTGFVALATHMMAVAS-------QSGRQIELT 69

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
            FG L+Y +PL+W+ + APL    FL  R   +SA  A+ +FL +SA++GLS+S+  LV+
Sbjct: 70  SFGHLLYATPLKWVVMLAPLAFVFFLGFRADRISAATARNVFLAFSAVMGLSMSTIMLVF 129

Query: 134 TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAID 193
           T  S+ + FFITAA+FG LSLYGY TKRDL   GSF++MG +GL +  LVNLF +SSA+ 
Sbjct: 130 TGASVAKVFFITAAAFGGLSLYGYLTKRDLSAFGSFLVMGLWGLVIAGLVNLFFQSSALQ 189

Query: 194 LTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLL 251
             +S + + IF+ LTA+DTQ+IK+ Y     Y    A + SV GAL LY+DFI +F  LL
Sbjct: 190 FGLSILSVFIFAGLTAWDTQQIKDGYYQSAGYGQEVAAKASVFGALSLYLDFINMFQSLL 249

Query: 252 RFLGSRR 258
              G R 
Sbjct: 250 FLFGDRN 256


>gi|83313423|ref|YP_423687.1| integral membrane protein, interacts with FtsH [Magnetospirillum
           magneticum AMB-1]
 gi|82948264|dbj|BAE53128.1| Integral membrane protein, interacts with FtsH [Magnetospirillum
           magneticum AMB-1]
          Length = 246

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 107/256 (41%), Positives = 162/256 (63%), Gaps = 19/256 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
             + +R +++     + ID GLR YM+ VYN MA  L +TGI+++++  +          
Sbjct: 9   FGSDRRYMSAAQAEAAQIDVGLRQYMLSVYNYMASALALTGIVAWVIASVPA-------- 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                        A+   SPL+W+F+ APLG+  F+  ++ S+ A  A  +F +Y+ L+G
Sbjct: 61  -----------LTAIAVYSPLKWVFMLAPLGLVFFMGAKIDSMRASTASTLFWVYAGLMG 109

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
            SL+S FLV+T  S+ + FF+TAA+F  LSLYGYTTK+DL   GSF+IMG +GL +  +V
Sbjct: 110 ASLASVFLVFTGASVARVFFVTAAAFAGLSLYGYTTKKDLSGFGSFLIMGVWGLMIAGIV 169

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F++S  +   MSA G++IF+ LTAYDTQ IK+ Y +      A++++V GAL LYMDF
Sbjct: 170 NIFLQSPMMHFVMSAAGVLIFAGLTAYDTQNIKQMYWEGDHSEVAQKKAVFGALQLYMDF 229

Query: 244 IQIFVHLLRFLGSRRD 259
           I +F+ LL+F+G RRD
Sbjct: 230 INLFMFLLQFMGVRRD 245


>gi|209965747|ref|YP_002298662.1| integral membrane protein, putative [Rhodospirillum centenum SW]
 gi|209959213|gb|ACI99849.1| integral membrane protein, putative [Rhodospirillum centenum SW]
          Length = 240

 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 100/254 (39%), Positives = 152/254 (59%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFG-STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           Y R   +G     +  D+GLR +M+RVYN M +GL +TG+++FL       V        
Sbjct: 6   YNRYATAGRALDQAQFDEGLRQHMLRVYNYMTVGLVITGLVAFLGASTPAVVG------- 58

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                        +Y +PL+W+ + APL     L+   H +SA   + +F ++S L+GLS
Sbjct: 59  ------------AVYGTPLQWVVMLAPLAFIFILSWNFHKMSAATLQTLFYVFSGLMGLS 106

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L   FLVYT  S+ + FFITA  F + SLYGYTTK+DL  +G FM+MG  G+ +  LVN+
Sbjct: 107 LMYIFLVYTGASVARVFFITAGMFAATSLYGYTTKKDLSSMGGFMVMGLIGIVIAGLVNI 166

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F+ SSA+   +S +G+++F+ LTA+DTQ+IKE Y++ +      + +V+GAL LY++FI 
Sbjct: 167 FLASSALQFAISVIGVIVFTGLTAWDTQRIKEQYAEGWGAEANGKLAVMGALSLYLNFIN 226

Query: 246 IFVHLLRFLGSRRD 259
           +F  LL+ LG R +
Sbjct: 227 LFTMLLQLLGQRDE 240


>gi|86360280|ref|YP_472168.1| hypothetical protein RHE_PE00002 [Rhizobium etli CFN 42]
 gi|86284382|gb|ABC93441.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 236

 Score =  143 bits (360), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 113/254 (44%), Positives = 160/254 (62%), Gaps = 19/254 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +       N+  G  +  D+GLR +M+RVYN M+LGL +TGI++F+V        P    
Sbjct: 1   MNPINPRYNAVPGSQALFDEGLRQHMLRVYNYMSLGLVITGIVAFIVGSTPALYVP---- 56

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                          ++ SPL+W+ + APL    F + R+ ++SA  A++ F  + A++G
Sbjct: 57  ---------------IFGSPLKWVVMLAPLAFVFFFSFRIQTMSASTAQITFWAFCAVMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSL+S FLV+T  SI QTFFITAA FGS SLYGYTTKRDL  +GSF++MG FG+ +  +V
Sbjct: 102 LSLASVFLVFTKTSIAQTFFITAAMFGSTSLYGYTTKRDLSKMGSFLMMGLFGIIIAGIV 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F+ SSA+   +S +G+V+F  LTAYDTQ IKE YS+ YD    ++ +V GAL LY++F
Sbjct: 162 NIFLGSSALQFAISVIGIVVFVGLTAYDTQNIKEQYSENYDQESNQKLAVFGALSLYLNF 221

Query: 244 IQIFVHLLRFLGSR 257
           + IF  LL F G R
Sbjct: 222 VNIFQLLLNFTGER 235


>gi|84686232|ref|ZP_01014127.1| hypothetical protein 1099457000256_RB2654_08512 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665759|gb|EAQ12234.1| hypothetical protein RB2654_08512 [Rhodobacterales bacterium
           HTCC2654]
          Length = 245

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 96/257 (37%), Positives = 152/257 (59%), Gaps = 16/257 (6%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +   + V        + ID+GLRA+M ++Y LM++GL VT  +++               
Sbjct: 1   MAEQRTVRAGVGARAAQIDEGLRAHMNKIYGLMSVGLLVTAGVAWAFGTAEPLQALLRDP 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
           + ++  ++              WI +F PL +       ++ LSA  A++ F +++A++G
Sbjct: 61  VTLSPNIL-------------GWIVMFLPLVMVFAFGAAINRLSAAGAQLFFYVFAAVMG 107

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +S+S  F+ +T  SI QTF ITA +F  LSL+GYTTK+D+   GSF+IMG  GL L S+V
Sbjct: 108 MSISWIFMAFTGVSIAQTFLITAIAFAGLSLWGYTTKKDISGWGSFLIMGLIGLILASIV 167

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLY 240
           N+F+ S AI   +SA+G++IF+ LTAYDTQK+K  Y       D  +  + +++GAL LY
Sbjct: 168 NIFLGSPAIHFAISALGVLIFAGLTAYDTQKLKNDYIQHAHAMDSEWLAKSAIMGALNLY 227

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DFI +F+ LL+FLG+R
Sbjct: 228 LDFINLFMFLLQFLGNR 244


>gi|27375573|ref|NP_767102.1| ABC transporter permease [Bradyrhizobium japonicum USDA 110]
 gi|27348710|dbj|BAC45727.1| blr0462 [Bradyrhizobium japonicum USDA 110]
          Length = 278

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 114/251 (45%), Positives = 171/251 (68%), Gaps = 7/251 (2%)

Query: 1   MSDI-RNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY       +G    +T+D GLRAYM+R+YN M++GL +TG+ +  V + A T 
Sbjct: 16  MSDLDRNYASPFGRAAGRVDAATVDAGLRAYMLRIYNYMSIGLAITGLAALGVYMAAVTD 75

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
            P   ++ + + + LT FG  M+ SPL+W+F+ APL +   ++  ++ L+   A+++F +
Sbjct: 76  VPTPEAVRVGK-LFLTPFGYAMFVSPLKWLFMLAPLAMVFVISAGINRLAPSTAQILFWV 134

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           +SAL+G+SLSS FLV+T  SIV+ FFITAA+FG+LSLYGYTTKRDL  +GSF+ MG  G+
Sbjct: 135 FSALMGISLSSIFLVFTHTSIVRVFFITAATFGALSLYGYTTKRDLTGMGSFLFMGLIGI 194

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVI 234
            + SLVNLF+ SS +   +S +G+++F+ LTA+DTQ++K  Y   Y       AER ++ 
Sbjct: 195 IIASLVNLFLASSMLQFIVSVVGVLVFAGLTAWDTQRLKNDYIYGYAAAGGDIAERAAIT 254

Query: 235 GALMLYMDFIQ 245
           GAL LY++FI 
Sbjct: 255 GALSLYLNFIN 265


>gi|254440667|ref|ZP_05054160.1| Uncharacterized protein family UPF0005, putative [Octadecabacter
           antarcticus 307]
 gi|198250745|gb|EDY75060.1| Uncharacterized protein family UPF0005, putative [Octadecabacter
           antarcticus 307]
          Length = 260

 Score =  142 bits (358), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 101/260 (38%), Positives = 164/260 (63%), Gaps = 6/260 (2%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D R  Q     G    + ID+GLRA+M +VY LM+ GL +T + ++ +  +  +  P 
Sbjct: 3   MADYRTPQMGATIGV-RAAEIDEGLRAHMNKVYGLMSFGLLMTFLAAWAIGTMTVSDVPT 61

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
             +I  N+   LT  GA +Y SPL+W+ +F PL +    +  ++ +SA AA+  F +++ 
Sbjct: 62  QYAIGSNQ--YLTDLGATLYLSPLKWVIMFLPLVLVFVFSAMINRMSAAAAQTFFYVFAT 119

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
            +G+S+S  F+ +T  SI Q F IT+ +F  LSL+GYTTKRD+   G F+IMG  GL + 
Sbjct: 120 AMGVSISWIFVAFTGASIAQVFLITSIAFAGLSLWGYTTKRDISGWGGFLIMGIIGLIVA 179

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGAL 237
           S+VN++++S  I   +S +GL+IF+ LTAYDTQ+IK  Y   +   D  + ++ +++G+L
Sbjct: 180 SIVNIWLQSDVIGWAVSIIGLLIFAGLTAYDTQRIKTDYIAHAAHGDQEWMDKSAIMGSL 239

Query: 238 MLYMDFIQIFVHLLRFLGSR 257
            LY++FI +F+ LL+ +GSR
Sbjct: 240 SLYINFINMFMFLLQLMGSR 259


>gi|222107123|ref|YP_002547914.1| hypothetical protein Avi_6220 [Agrobacterium vitis S4]
 gi|221738302|gb|ACM39198.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 238

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 107/252 (42%), Positives = 157/252 (62%), Gaps = 19/252 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N      + +  G+  DQGLR +M+RVYN M LGL +TG+++F+V        P      
Sbjct: 5   NKHYPFGAQAQAGALFDQGLRQHMLRVYNYMGLGLVITGLVAFIVGSTPALYVP------ 58

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                        ++ SPL+W+ + APL    F + R+ ++SA AA+M F  + A++GLS
Sbjct: 59  -------------IFQSPLKWVVMLAPLAFVFFFSFRIQTMSASAAQMAFWAFCAVMGLS 105

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           ++S FLV+T  SI +TFFI A  FGS+SLYGYTTKRDL   GSF++MG  G+ + S+VN+
Sbjct: 106 MASVFLVFTGTSIARTFFIAATMFGSMSLYGYTTKRDLSKFGSFLMMGLIGVVIASIVNI 165

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F+ SSA+   +S +G+++F  LTA+DTQ IKE Y++  D    ++ +V GAL LY++F+ 
Sbjct: 166 FLGSSALQFAISVIGILVFVGLTAWDTQNIKEQYAENIDQESRQKLAVFGALSLYLNFVN 225

Query: 246 IFVHLLRFLGSR 257
           IF  LL F G R
Sbjct: 226 IFQLLLNFTGER 237


>gi|91975009|ref|YP_567668.1| hypothetical protein RPD_0529 [Rhodopseudomonas palustris BisB5]
 gi|91681465|gb|ABE37767.1| protein of unknown function UPF0005 [Rhodopseudomonas palustris
           BisB5]
          Length = 263

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 115/251 (45%), Positives = 166/251 (66%), Gaps = 7/251 (2%)

Query: 1   MSDI-RNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY       +G    + +D GLRAYM+R+YN M +GL +TG+ +  V + A T 
Sbjct: 1   MSDLDRNYASPFGRAAGRVDSAAVDAGLRAYMLRIYNYMTIGLAITGLAALGVYMGAVTP 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           +   A+  I     LT FG  M+ SPL+W+FI APL +   ++  ++ L    A+++F  
Sbjct: 61  NDVGAAGRIGN-TYLTTFGVAMFASPLKWVFILAPLAMVFAISFGINRLKPATAQLLFWA 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           ++AL+G+SLSS FLVYT  SIV+ FFITAASFG+LSLYGYTTKRD+  +GSF+IMG FG+
Sbjct: 120 FAALMGISLSSIFLVYTHTSIVRVFFITAASFGALSLYGYTTKRDMTGMGSFLIMGLFGV 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYA---ERQSVI 234
            + S+VNLF+ SS +   +S +G+++F+ LTA+DTQ++K  Y   Y        ER ++ 
Sbjct: 180 VIASVVNLFVASSMLQFIVSVVGVLVFAGLTAWDTQRLKNDYIYGYASEGGEVAERAAIT 239

Query: 235 GALMLYMDFIQ 245
           GAL LY++FI 
Sbjct: 240 GALSLYLNFIN 250


>gi|190895319|ref|YP_001985611.1| hypothetical protein RHECIAT_PA0000002 [Rhizobium etli CIAT 652]
 gi|218515855|ref|ZP_03512695.1| hypothetical protein Retl8_20301 [Rhizobium etli 8C-3]
 gi|190699264|gb|ACE93348.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 236

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 111/254 (43%), Positives = 158/254 (62%), Gaps = 19/254 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +        +  G  +  D+GLR +M+RVYN M LGL +TGI++F+V        P    
Sbjct: 1   MNPINPRYGAVPGSQALFDEGLRQHMLRVYNYMGLGLVITGIVAFIVGSTPALYVP---- 56

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                          ++ SPL+W+ + APL    F + R+ ++SA  A++ F  + A++G
Sbjct: 57  ---------------IFGSPLKWVVMLAPLAFVFFFSFRIQTMSASTAQITFWAFCAVMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSL+S FLV+T  SI QTFFITAA FG+ SLYGYTTKRDL  +GSF++MG FG+ +  +V
Sbjct: 102 LSLASVFLVFTKTSIAQTFFITAAMFGTTSLYGYTTKRDLSRMGSFLMMGLFGIIIAGIV 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F+ SSA+   +S +G+V+F  LTAYDTQ IKE YS+ YD    ++ +V GAL LY++F
Sbjct: 162 NIFLGSSALQFAISVIGIVVFVGLTAYDTQNIKEQYSENYDQESNQKLAVFGALSLYLNF 221

Query: 244 IQIFVHLLRFLGSR 257
           + IF  LL F G R
Sbjct: 222 VNIFQLLLNFTGER 235


>gi|241667047|ref|YP_002985131.1| protein of unknown function UPF0005 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240862504|gb|ACS60169.1| protein of unknown function UPF0005 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 236

 Score =  142 bits (357), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 107/254 (42%), Positives = 159/254 (62%), Gaps = 19/254 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +        + +G  +  D+GLR +M+RVYN MALGL +TG+++F+V        P    
Sbjct: 1   MNPINPRYGAVAGSQALFDEGLRQHMLRVYNYMALGLVITGLVAFVVGSTPALYVP---- 56

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                          ++ SPL+W+ + APL    F + ++ ++SA  A++ F  + A++G
Sbjct: 57  ---------------IFGSPLKWVVMLAPLAFVFFFSFKIQTMSAGTAQITFWAFCAVMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSL+S FLV+T  SI +TFFITA  FG+ SLYGY TKRDL  +GSF++MG FG+ + S+V
Sbjct: 102 LSLASVFLVFTGASIARTFFITATMFGATSLYGYATKRDLSRMGSFLMMGLFGVIIASVV 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F+ SSA+   +S +G+V+F  LTAYDTQ IKE YS+ +D    ++ +V GAL LY++F
Sbjct: 162 NIFLGSSALQFAISVIGIVVFVGLTAYDTQNIKEQYSENFDQESNQKLAVFGALSLYLNF 221

Query: 244 IQIFVHLLRFLGSR 257
           + IF  LL F G R
Sbjct: 222 VNIFQLLLNFTGER 235


>gi|222087253|ref|YP_002545788.1| hypothetical protein Arad_4062 [Agrobacterium radiobacter K84]
 gi|221724701|gb|ACM27857.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 238

 Score =  141 bits (356), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 109/252 (43%), Positives = 161/252 (63%), Gaps = 19/252 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N +    + +G  +  D+GLR +M+RVYN M +GL VTGI++ +V        P      
Sbjct: 5   NPRFGYGAAAGSQALFDEGLRKHMLRVYNYMGIGLVVTGIVAMIVGTTPALYVP------ 58

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                        ++ SPL+W+ + APL   +F + R+ ++SA AA+ MF  + A++GLS
Sbjct: 59  -------------IFQSPLKWVVMLAPLAFVLFFSFRIQTMSASAAQTMFWAFCAVMGLS 105

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L+S FLV+T  SI +TFFI A  FG+ SLYGYTTKRDL  IGSF++MG FG+ + S+VN+
Sbjct: 106 LASVFLVFTGTSIARTFFIAATMFGATSLYGYTTKRDLANIGSFLMMGLFGVIIASVVNI 165

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F+ SSA+   +S +G+V+F  LTA+DTQ IKE Y++ +D   +++ +V GAL LY++F+ 
Sbjct: 166 FLGSSALQFAISIIGIVVFVGLTAWDTQNIKEQYAENHDQETSQKLAVFGALSLYLNFVN 225

Query: 246 IFVHLLRFLGSR 257
           IF  LL F G R
Sbjct: 226 IFQLLLNFTGER 237


>gi|297180302|gb|ADI16520.1| integral membrane protein, interacts with ftsh [uncultured
           bacterium HF4000_009C18]
          Length = 251

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 109/256 (42%), Positives = 159/256 (62%), Gaps = 6/256 (2%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           +         +       ID+GLRAYM++VYN MA G+ +TG++S  +  L+     D  
Sbjct: 2   EFNRQNIRSKATIAETHVIDEGLRAYMLKVYNYMASGVLLTGVISLFLFKLSVVTAAD-- 59

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                  + LT  G  +Y S L WI + APLGV  +++  +  +SA  A+  F +++AL+
Sbjct: 60  ----GSIIGLTDLGNALYNSALMWIVMLAPLGVVFYISFGIRKMSAAKAQGAFWIFAALM 115

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G SLSS FLVYT  SI + FFITA +FG++S+YGYTTKRDL  +GSF++MG  G+ + S+
Sbjct: 116 GASLSSIFLVYTGASITRVFFITAGTFGAMSIYGYTTKRDLTRLGSFLMMGLIGIIIASI 175

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           VN+FM+SS +   +S +G+++F  LTAYDTQKIK  Y          +++V+GAL LY+D
Sbjct: 176 VNIFMKSSMMYFVISIIGVLVFVGLTAYDTQKIKNMYLVSDTGEVMGKKAVMGALTLYLD 235

Query: 243 FIQIFVHLLRFLGSRR 258
           FI +F+ LL   G RR
Sbjct: 236 FINLFLMLLMLFGQRR 251


>gi|46201126|ref|ZP_00055766.2| COG0670: Integral membrane protein, interacts with FtsH
           [Magnetospirillum magnetotacticum MS-1]
          Length = 231

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 109/249 (43%), Positives = 159/249 (63%), Gaps = 19/249 (7%)

Query: 11  VNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGV 70
           +++     S ID GLR YM+ VYN MA  L +TGI+++++  +                 
Sbjct: 1   MSAAQAEASQIDVGLRQYMLSVYNYMASALALTGIVAWVIASVPA--------------- 45

Query: 71  MLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFF 130
                 A+   SPL+W+F+ APLG+  F++ ++ S+ A  A  +F +Y+ L+G SL+S F
Sbjct: 46  ----LTAIAVYSPLKWVFMLAPLGLVFFMSAKIDSMRASTASTLFWVYAGLMGASLASVF 101

Query: 131 LVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSS 190
           LV+T  S+ + FFITAA+F  LSLYGYTTK+DL   GSF+IMG +GL +  +VN+F+ S 
Sbjct: 102 LVFTGASVARVFFITAAAFAGLSLYGYTTKKDLSGFGSFLIMGVWGLMIAGIVNIFLASP 161

Query: 191 AIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHL 250
            +   MSA G++IF+ LTAYDTQ IK+ Y +  D   A +++V GAL LYMDFI +F+ L
Sbjct: 162 MLHFVMSAAGVLIFAGLTAYDTQNIKQMYWEGDDSEVASKKAVFGALQLYMDFINLFMFL 221

Query: 251 LRFLGSRRD 259
           L+F+G RRD
Sbjct: 222 LQFMGVRRD 230


>gi|327189278|gb|EGE56454.1| hypothetical protein RHECNPAF_68008 [Rhizobium etli CNPAF512]
          Length = 236

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 109/254 (42%), Positives = 157/254 (61%), Gaps = 19/254 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +        +     +  D+GLR +M+RVYN M LGL +TGI++F+V        P    
Sbjct: 1   MNPINPRYGAVPSSQALFDEGLRQHMLRVYNYMGLGLVITGIVAFIVGSTPALYVP---- 56

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                          ++ SPL+W+ + APL    F + R+ ++SA  A++ F  + A++G
Sbjct: 57  ---------------IFGSPLKWVVMLAPLAFVFFFSFRIQTMSASTAQITFWAFCAVMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSL+S FLV+T  SI QTFFITAA FG+ SLYGYTTKRDL  +GSF++MG FG+ +  +V
Sbjct: 102 LSLASVFLVFTKTSIAQTFFITAAMFGTTSLYGYTTKRDLSRMGSFLMMGLFGIIIAGIV 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F+ SSA+   +S +G+++F  LTAYDTQ IKE YS+ YD    ++ +V GAL LY++F
Sbjct: 162 NIFLGSSALQFAISVIGIIVFVGLTAYDTQNIKEQYSENYDQESNQKLAVFGALSLYLNF 221

Query: 244 IQIFVHLLRFLGSR 257
           + IF  LL F G R
Sbjct: 222 VNIFQLLLNFTGER 235


>gi|16127893|ref|NP_422457.1| hypothetical protein CC_3663 [Caulobacter crescentus CB15]
 gi|13425421|gb|AAK25625.1| conserved hypothetical protein [Caulobacter crescentus CB15]
          Length = 281

 Score =  141 bits (356), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 92/260 (35%), Positives = 143/260 (55%), Gaps = 11/260 (4%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D                ++D GLR +M+ VYN +ALGL V+G +++  + +    D  
Sbjct: 32  MNDFNRGYARSIPADRADMSVDAGLRKFMLGVYNKVALGLVVSGALAYATSSVPAVRD-- 89

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                    + +   G L   +PL  +  FAPL + +     + +     A  ++    +
Sbjct: 90  --------LLFVVQGGRLAGVTPLYMVVAFAPLVLMLIAGFAMRNPKPETAGALYWTIVS 141

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           LIG SL S  L YT +S+  TFF+TA +FG LSL+GYTTK+DL   GSF++MG  GL + 
Sbjct: 142 LIGASLGSVMLRYTGESVAATFFVTATAFGGLSLFGYTTKKDLTGFGSFLMMGVIGLIVA 201

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALML 239
           S+V++F++S A+   ++ +G++IFS L AYDTQ++K  Y +   D A     +  GAL L
Sbjct: 202 SIVSIFLKSPALLFAINVLGVLIFSGLIAYDTQRLKMTYYEMGGDRASMAVATNFGALSL 261

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y++FI +F  LL F G  R+
Sbjct: 262 YINFINLFQFLLSFFGGNRE 281


>gi|209546393|ref|YP_002278283.1| hypothetical protein Rleg2_6013 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209539250|gb|ACI59183.1| protein of unknown function UPF0005 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 236

 Score =  141 bits (356), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 107/254 (42%), Positives = 158/254 (62%), Gaps = 19/254 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +        + +G  +  D+GLR +M+RVYN MALGL +TG+++F+V        P    
Sbjct: 1   MNPINSRYGAVAGTQAAFDEGLRQHMLRVYNYMALGLVITGLVAFVVGSTPALYVP---- 56

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                          ++ SPL+W+ + APL    F + R+ ++SA  A++ F  + A++G
Sbjct: 57  ---------------IFGSPLKWVVMLAPLAFVFFFSFRIQTMSASTAQITFWAFCAVMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSL+S FLV+T  SI +TFFITA  FG+ SLYGY TKRDL  +GSF++MG  G+ + S+V
Sbjct: 102 LSLASVFLVFTGMSIARTFFITATMFGATSLYGYVTKRDLSRMGSFLMMGLIGVIIASIV 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F+ SSA+   +S +G+V+F  LTAYDTQ IKE YS+ +D    ++ +V GAL LY++F
Sbjct: 162 NIFLGSSALQFAISVIGIVVFVGLTAYDTQNIKEQYSENFDQESNQKLAVFGALSLYLNF 221

Query: 244 IQIFVHLLRFLGSR 257
           + IF  LL F G R
Sbjct: 222 VNIFQLLLNFTGER 235


>gi|116255205|ref|YP_771038.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115259853|emb|CAK02947.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 236

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 109/254 (42%), Positives = 159/254 (62%), Gaps = 19/254 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +        + +G  +  D+GLR +M+RVYN MALGL +TG+++F+V        P    
Sbjct: 1   MNPINPRYGAVAGSQALFDEGLRQHMLRVYNYMALGLVITGLVAFVVGSTPALYVP---- 56

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                          ++ SPL+W+ + APL    F + ++ ++SA  A++ F  + A++G
Sbjct: 57  ---------------IFGSPLKWVVMLAPLAFVFFFSFKIQTMSASTAQITFWAFCAVMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSL+S FLV+T  SI +TFFITA  FG+ SLYGY TKRDL  +GSF++MG FG+ + S+V
Sbjct: 102 LSLASVFLVFTGMSIARTFFITATMFGATSLYGYATKRDLSRMGSFLMMGLFGVIIASVV 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+FM SSA+   +S +G+V+F  LTAYDTQ IKE YS+ YD    ++ +V GAL LY++F
Sbjct: 162 NIFMGSSALQFAISVIGIVVFVGLTAYDTQNIKEQYSENYDQESNQKLAVFGALSLYLNF 221

Query: 244 IQIFVHLLRFLGSR 257
           + IF  LL F G R
Sbjct: 222 VNIFQLLLNFTGER 235


>gi|86747413|ref|YP_483909.1| hypothetical protein RPB_0287 [Rhodopseudomonas palustris HaA2]
 gi|86570441|gb|ABD04998.1| Protein of unknown function UPF0005 [Rhodopseudomonas palustris
           HaA2]
          Length = 263

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 116/251 (46%), Positives = 166/251 (66%), Gaps = 7/251 (2%)

Query: 1   MSDI-RNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY       +G    + +D GLR+YM+R+YN M +GL +TG+ +  V + A T 
Sbjct: 1   MSDLDRNYASPFGRAAGRVDSAAVDAGLRSYMLRIYNYMTIGLAITGLAALGVYMGAVTP 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           D   A+  I     LT FG  M+ SPL+W+FI APL +   ++  ++ L    A+++F  
Sbjct: 61  DAAGAAGKIGN-TYLTTFGVAMFASPLKWVFILAPLAMVFAISFGINRLKPATAQLLFWA 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           ++AL+G+SLSS FLVYT  SIV+ FFITAASFG+LSLYGYTTKRD+  +GSF+IMG FG+
Sbjct: 120 FAALMGISLSSIFLVYTHTSIVRVFFITAASFGALSLYGYTTKRDMTGMGSFLIMGLFGV 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYA---ERQSVI 234
            + S+VNLF+ SS +   +S +G+++F+ LTAYDTQ++K  Y   Y        ER ++ 
Sbjct: 180 IIASVVNLFVASSMLQFIVSVVGVLVFAGLTAYDTQRLKNDYMYGYASEGGDVAERAAIT 239

Query: 235 GALMLYMDFIQ 245
           GAL LY++FI 
Sbjct: 240 GALSLYLNFIN 250


>gi|188581477|ref|YP_001924922.1| hypothetical protein Mpop_2225 [Methylobacterium populi BJ001]
 gi|179344975|gb|ACB80387.1| protein of unknown function UPF0005 [Methylobacterium populi BJ001]
          Length = 255

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 113/245 (46%), Positives = 162/245 (66%), Gaps = 8/245 (3%)

Query: 15  SGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           +G    +DQGLR++M+ VYN M +GLG++G+++  +N+ A               + LT 
Sbjct: 18  AGSQVEVDQGLRSFMLGVYNNMVVGLGISGLVALALNMAAVAQTGAGR-------LALTP 70

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           FG  +YTSP +W+ + APL      + R+  +SA +A+MMF  ++A++G S+S+  LV+T
Sbjct: 71  FGQFLYTSPFKWVLMLAPLAFIFVFSFRMDRMSASSARMMFWAFAAVMGASMSTLLLVFT 130

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             S+V+ FFITAA+FG LSLYGYTTKR L  +GSF+IMG  GL + SLVN+F+ SSA+  
Sbjct: 131 GASVVRVFFITAATFGGLSLYGYTTKRSLSGMGSFLIMGLIGLIIASLVNIFLASSALQF 190

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRY-DVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
            +S +G++IF+ LTAYDTQK+KE Y     D   A + SV GAL LY+DFI +F  LL  
Sbjct: 191 AISVIGVLIFAGLTAYDTQKLKEMYLYSGLDAEGAAKMSVNGALTLYLDFINMFQFLLSL 250

Query: 254 LGSRR 258
           +G RR
Sbjct: 251 MGDRR 255


>gi|170742670|ref|YP_001771325.1| hypothetical protein M446_4550 [Methylobacterium sp. 4-46]
 gi|168196944|gb|ACA18891.1| protein of unknown function UPF0005 [Methylobacterium sp. 4-46]
          Length = 236

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 107/254 (42%), Positives = 161/254 (63%), Gaps = 19/254 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +       ++ +   +  D+GLR +M+RVYN M LGL +TG+++F V+   +   P    
Sbjct: 1   MNTPYAWQSTAAPSAALFDEGLRQHMLRVYNRMGLGLALTGLVAFAVSATPSIAQP---- 56

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                          ++ +PL+++ + APL   +FL+ R+  +SA  A+ +F  + A++G
Sbjct: 57  ---------------LFGTPLKYVVMLAPLAFILFLSFRIEQISAATAQTLFWSFCAVMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSL+S FLV+T  SI +TFFITAA FG+ SLYGYTTKRDL  +GSF++MG  G+ + SLV
Sbjct: 102 LSLASVFLVFTGTSIARTFFITAAMFGATSLYGYTTKRDLSRMGSFLMMGLIGVVIASLV 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F+ SSA+   +S +G+VIF  LTAYDTQ IKE Y++ +D   + + +V GAL LY++F
Sbjct: 162 NIFLASSALHFAISLIGVVIFVGLTAYDTQSIKEQYAEHWDQETSGKLAVFGALSLYLNF 221

Query: 244 IQIFVHLLRFLGSR 257
           I +F  LL F G R
Sbjct: 222 INLFQLLLNFTGER 235


>gi|116687298|ref|YP_840544.1| hypothetical protein Bcen2424_6925 [Burkholderia cenocepacia
           HI2424]
 gi|116653013|gb|ABK13651.1| protein of unknown function UPF0005 [Burkholderia cenocepacia
           HI2424]
          Length = 239

 Score =  140 bits (353), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 105/257 (40%), Positives = 154/257 (59%), Gaps = 21/257 (8%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA 61
           +D R   R   S    G   D GLR YM  +YN MA GL +TG +++             
Sbjct: 3   NDFRQGARAEESQRVLGGD-DVGLRQYMRHIYNYMAGGLALTGAVAYFGAS--------- 52

Query: 62  ASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
                      TGF   +  +PL W+ + APL + +FL+ R+  +S  AA++ F  Y+AL
Sbjct: 53  -----------TGFYRSIAGTPLFWVVLLAPLALVMFLSFRIEHISFGAAQISFWAYAAL 101

Query: 122 IGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS 181
           +GLSLS  FLVYT +SI + FFI+AA+FG+ SLYGY+T+ DL   GSF+ MG  G+ +  
Sbjct: 102 VGLSLSGIFLVYTGESIARVFFISAATFGATSLYGYSTRADLSRFGSFLFMGLIGIIIAG 161

Query: 182 LVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYM 241
            VNLF+ SSA+   +S +G+++F+ L AYDTQ+IK  Y    +   A +++++GAL LY+
Sbjct: 162 FVNLFLVSSALQFVVSVIGVLVFTGLIAYDTQRIKRIYIAGEEGKIAGKKAIMGALALYL 221

Query: 242 DFIQIFVHLLRFLGSRR 258
           DF+ +F+ L+R  GSRR
Sbjct: 222 DFLNLFLMLMRLFGSRR 238


>gi|218461564|ref|ZP_03501655.1| hypothetical protein RetlK5_19577 [Rhizobium etli Kim 5]
          Length = 236

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 109/254 (42%), Positives = 159/254 (62%), Gaps = 19/254 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +        + +G  +  D+GLR +M+RVYN MALGL +TG+++F+V        P    
Sbjct: 1   MNPINSRYGTVAGSQAVFDEGLRQHMLRVYNYMALGLVITGLVAFVVGSTPALYVP---- 56

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                          ++ SPL+W+ + APL    F + R+ ++SA  A++ F  + A++G
Sbjct: 57  ---------------IFGSPLKWVVMLAPLAFVFFFSFRIQAMSASTAQITFWAFCAVMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSL+S FLV+T  SI +TFFITA  FG+ SLYGY TKRDL  +GSF++MG FG+ + S+V
Sbjct: 102 LSLASVFLVFTGMSIARTFFITATMFGATSLYGYVTKRDLSRMGSFLMMGLFGVIIASIV 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F+ SSA+   +S +G+V+F  LTAYDTQ IKE YS+ YD    ++ +V GAL LY++F
Sbjct: 162 NIFLGSSALQFAISVIGIVVFVGLTAYDTQNIKEQYSENYDQESNQKLAVFGALSLYLNF 221

Query: 244 IQIFVHLLRFLGSR 257
           + IF  LL F G R
Sbjct: 222 VNIFTLLLNFTGER 235


>gi|149186193|ref|ZP_01864507.1| integral membrane protein [Erythrobacter sp. SD-21]
 gi|148830224|gb|EDL48661.1| integral membrane protein [Erythrobacter sp. SD-21]
          Length = 260

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 97/267 (36%), Positives = 151/267 (56%), Gaps = 18/267 (6%)

Query: 1   MSDIRNYQRV--------VNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNI 52
           M+D     R             +  G+T D+GLR +M+ +YN+MA G+ +TGI++ L   
Sbjct: 1   MADWNETNRRPDMTSVPRAGDAATRGTTFDEGLRKHMLSIYNMMASGVLLTGIVALLFVN 60

Query: 53  LATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVR-LHSLSAYAA 111
                            V+ T +G  + T+ L W+   APL   + ++   +   S    
Sbjct: 61  TPLFESA--------FNVVQTPYGRSLQTTGLGWVIKLAPLAFILVISFGGVQRFSKTTL 112

Query: 112 KMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMI 171
           + MF  ++ L+GLSLS+ F VYT +S+   FF  AA+F  LSLYGYTTK++L   GSF++
Sbjct: 113 QAMFWGFATLMGLSLSTIFAVYTGESVASAFFAAAAAFAGLSLYGYTTKKNLSGWGSFLM 172

Query: 172 MGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAER 230
           MG  G+ +  L+N    +S A+ L +S +G++IF+  TAYDTQ++KE Y       +A +
Sbjct: 173 MGLIGIIVAMLLNAFIFQSGAMGLVISILGVLIFAGFTAYDTQRLKEEYQYLRGTEFAGK 232

Query: 231 QSVIGALMLYMDFIQIFVHLLRFLGSR 257
             V+GAL LY+DFI +F+ +L+FLG+R
Sbjct: 233 AVVMGALSLYLDFINLFLFILQFLGNR 259


>gi|149203700|ref|ZP_01880669.1| hypothetical protein RTM1035_06528 [Roseovarius sp. TM1035]
 gi|149142817|gb|EDM30859.1| hypothetical protein RTM1035_06528 [Roseovarius sp. TM1035]
          Length = 259

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 105/257 (40%), Positives = 162/257 (63%), Gaps = 4/257 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +     +  +     + ID GLRA+M +VY  M++G+ +T + ++ +  LA T DP AA+
Sbjct: 1   MAELNTIRTATGTRTAQIDAGLRAHMNKVYGTMSVGMLITALAAWAIAGLAVTTDPSAAA 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLN-VRLHSLSAYAAKMMFLLYSALI 122
             +  G MLTG GA +Y SPL+W+ + APL          +   SA A ++ F  ++ALI
Sbjct: 61  AQLPNGKMLTGLGAALYLSPLKWVVMLAPLAFIFLGWGALVRRASAAAVQLGFFAFAALI 120

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G+S+SS FL++TS SIVQTF +TA +F  LSL+GYTTK+D+   GSF+IMG  GL +  +
Sbjct: 121 GISMSSIFLMFTSFSIVQTFIVTAIAFAGLSLFGYTTKKDISGWGSFLIMGVIGLVVAMV 180

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALML 239
           +N+F++S A+   +SA+GL+IF+ LTA+ TQ+IK  Y   +   D  + ++ +  GAL L
Sbjct: 181 INIFLQSPAMMFAISAIGLLIFAGLTAFHTQEIKNTYVAHAAHGDQEWLDKSAYDGALSL 240

Query: 240 YMDFIQIFVHLLRFLGS 256
           Y+ F+ +F  LL F+G 
Sbjct: 241 YISFLNMFQFLLMFMGQ 257


>gi|316931832|ref|YP_004106814.1| hypothetical protein Rpdx1_0440 [Rhodopseudomonas palustris DX-1]
 gi|315599546|gb|ADU42081.1| protein of unknown function UPF0005 [Rhodopseudomonas palustris
           DX-1]
          Length = 263

 Score =  139 bits (351), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 118/251 (47%), Positives = 168/251 (66%), Gaps = 7/251 (2%)

Query: 1   MSDI-RNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY       +G    +T+D GLRAYM+R+YN M +GL +TG+ +  V + A T 
Sbjct: 1   MSDLDRNYASPFGRAAGRVETATVDAGLRAYMLRIYNYMTIGLAITGLAALGVYMGAVTT 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           D  AA+  +    MLT FG  M+ SPL+W+FI APL +   ++  ++ L    A+++F  
Sbjct: 61  DAGAAAARVGN-TMLTSFGVAMFVSPLKWVFILAPLAMVFVISFGINRLKPATAQLLFWA 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           +SAL+G+SLSS FLVYT  SIV+ FFITAA+FG+LSLYGYTTKRD+  +GSF+IMG  G+
Sbjct: 120 FSALMGISLSSIFLVYTHTSIVRVFFITAAAFGALSLYGYTTKRDMTGMGSFLIMGLIGV 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVI 234
            + SLVNLF+ SS +   +S +G+++F+ LTA+DTQ++K  Y           AER ++ 
Sbjct: 180 VIASLVNLFVASSMLQFIVSVVGVLVFAGLTAWDTQRLKNDYIYGAGSMGGEVAERAAIT 239

Query: 235 GALMLYMDFIQ 245
           GAL LY++FI 
Sbjct: 240 GALSLYLNFIN 250


>gi|260432960|ref|ZP_05786931.1| integral membrane protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416788|gb|EEX10047.1| integral membrane protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 245

 Score =  139 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 88/257 (34%), Positives = 150/257 (58%), Gaps = 16/257 (6%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  +  V  +     + ID+GLRA+M +VY  M++G+ +T  +++ V      +      
Sbjct: 1   MAQFDTVRTAAGVRSAEIDEGLRAHMNKVYGTMSVGMLITFAVAWAVGTSPQLLSVFRDP 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
           + ++  ++              WI +FAPL +       ++ LSA  A++ F  ++A++G
Sbjct: 61  VTLSPNIL-------------GWIVMFAPLAMVFGFGAAINRLSAAGAQLFFYAFAAVMG 107

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LS+S  F+ +T  SI Q F +T+ +F  LSLYGY TK+DL  +G+F++MG  GL +  ++
Sbjct: 108 LSMSWIFVAFTGISIAQVFLVTSIAFAGLSLYGYVTKKDLSGMGTFLMMGVIGLIVAMVI 167

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD---RYDVAYAERQSVIGALMLY 240
           N+F++S AI   +S +G++IF+ LTAYDTQ IK  Y       D  +  + +++GAL LY
Sbjct: 168 NIFLQSPAIMFAVSIIGVLIFAGLTAYDTQNIKTTYIQHAAHGDQEWLGKSAIMGALNLY 227

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DFI +F+ LL+ LG+R
Sbjct: 228 LDFINMFMFLLQLLGNR 244


>gi|85713697|ref|ZP_01044687.1| hypothetical protein NB311A_04134 [Nitrobacter sp. Nb-311A]
 gi|85699601|gb|EAQ37468.1| hypothetical protein NB311A_04134 [Nitrobacter sp. Nb-311A]
          Length = 263

 Score =  139 bits (350), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 117/246 (47%), Positives = 166/246 (67%), Gaps = 6/246 (2%)

Query: 5   RNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           RNY       +G    + +D GLR+YM+++YN M++GL +TG+ +  V + A T DP  A
Sbjct: 6   RNYASPFGRTAGRVDTAAVDAGLRSYMLKIYNYMSIGLAITGLAALGVYMAAVTGDPSGA 65

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
           +  I     LT FG  ++ SPL+W+FI APL +   ++  ++ L    A+M+F  +SAL+
Sbjct: 66  AAQIGNA-YLTPFGYALFVSPLKWVFILAPLAMVFVISFGINRLKPATAQMLFWAFSALM 124

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GLSLSS FLVYT  SIV+ FFITAASFG+LSL+GYTTKRD+  +GSF+IMG FG+ + SL
Sbjct: 125 GLSLSSIFLVYTHTSIVRVFFITAASFGALSLFGYTTKRDMSGMGSFLIMGLFGVIIASL 184

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALML 239
           VNLF+ SSA+   +S +G+++F+ LTAYDTQ++K  Y   Y       AER ++ GAL L
Sbjct: 185 VNLFIASSALQFVVSVVGVLVFAGLTAYDTQRLKNDYIYGYASQGGEIAERAAITGALSL 244

Query: 240 YMDFIQ 245
           Y++FI 
Sbjct: 245 YLNFIN 250


>gi|197103181|ref|YP_002128559.1| hypothetical protein PHZ_p0041 [Phenylobacterium zucineum HLK1]
 gi|196480457|gb|ACG79984.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 251

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 101/260 (38%), Positives = 146/260 (56%), Gaps = 10/260 (3%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MSD +  +      +     ID GLR++MI VYN +ALGL V+  +++L + +    D  
Sbjct: 1   MSDFQRARHATILSTRADMAIDAGLRSFMIGVYNKVALGLLVSAALAYLTSSVPPVRD-- 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                     + +  G L   +P+ WI   APLG+ +     + + ++ AA  ++    A
Sbjct: 59  -------LMFVTSADGHLAGMTPIGWIVAIAPLGILLVSGFAMRNPTSGAASALYWTIVA 111

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           LIG SL    LVYT  SIV  F ITA +FG+LSL+GY TK+DL   GSF+I+G  GL + 
Sbjct: 112 LIGASLGVVGLVYTGASIVSMFLITATAFGALSLFGYVTKKDLTGFGSFLIVGVVGLVIA 171

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSV-IGALML 239
           SLVNLF+RS  +   +S +G+ +F+ L AYDTQ++K AY +      A   +   GAL L
Sbjct: 172 SLVNLFLRSELMQFMISVIGVFVFAGLIAYDTQRLKIAYYELGGAEAARSVATSYGALNL 231

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y++FI +F  LL   G RRD
Sbjct: 232 YINFINLFQFLLSLFGQRRD 251


>gi|218530497|ref|YP_002421313.1| hypothetical protein Mchl_2543 [Methylobacterium chloromethanicum
           CM4]
 gi|240138856|ref|YP_002963331.1| hypothetical protein MexAM1_META1p2268 [Methylobacterium extorquens
           AM1]
 gi|218522800|gb|ACK83385.1| protein of unknown function UPF0005 [Methylobacterium
           chloromethanicum CM4]
 gi|240008828|gb|ACS40054.1| conserved hypothetical protein; putative inner membrane protein
           [Methylobacterium extorquens AM1]
          Length = 255

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 111/245 (45%), Positives = 161/245 (65%), Gaps = 8/245 (3%)

Query: 15  SGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           +G    +DQGLR++M+ VYN M +GLG++G+++  +N+ A               + LT 
Sbjct: 18  AGSQVEVDQGLRSFMLGVYNNMVVGLGISGLVALALNMAAVAQTGAGR-------LALTP 70

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           FG  +YTSP +W+ + APL      + R+  +SA +A+MMF  ++A++G S+S+  LV+T
Sbjct: 71  FGQFLYTSPFKWVLMLAPLAFIFVFSFRMDRMSASSARMMFWAFAAVMGASMSTLLLVFT 130

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             S+V+ FFITAA+F  LSLYGYTTKR L  +GSF++MG  G+ + SLVNLF+ SSA+  
Sbjct: 131 GASVVRVFFITAATFAGLSLYGYTTKRSLSGMGSFLMMGLIGIIIASLVNLFLASSALQF 190

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRY-DVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
            +S +G++IF+ LTA+DTQK+KE Y     D   A + SV GAL LY+DFI +F  LL  
Sbjct: 191 AISVLGVLIFAGLTAFDTQKLKEMYLYSGLDAEGAAKMSVNGALTLYLDFINMFQFLLSL 250

Query: 254 LGSRR 258
           LG RR
Sbjct: 251 LGDRR 255


>gi|115522334|ref|YP_779245.1| hypothetical protein RPE_0306 [Rhodopseudomonas palustris BisA53]
 gi|115516281|gb|ABJ04265.1| protein of unknown function UPF0005 [Rhodopseudomonas palustris
           BisA53]
          Length = 271

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 114/258 (44%), Positives = 168/258 (65%), Gaps = 13/258 (5%)

Query: 1   MSDI-RNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD  RNY       +     + +D GLRAYM+R+YN M++GL +TG+ +  V + A T 
Sbjct: 1   MSDFDRNYASPFGRAATRVDAAAVDAGLRAYMLRIYNYMSIGLAITGLAALGVYMFAVTT 60

Query: 58  DPDAA-------SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYA 110
           D   A       ++ ++RG  LT FG  M+ SPL+W+F+ APL +   ++  ++ L    
Sbjct: 61  DASQAVQSATGAAVAMSRGQYLTPFGYAMFASPLKWVFMLAPLAMVFAISFGINRLKPAT 120

Query: 111 AKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFM 170
           A+++F  ++AL+G+SLSS FLVYT  SIV+ FFITAASFG+LSLYGYTTKRD+  +GSF+
Sbjct: 121 AQLLFWAFAALMGISLSSIFLVYTHTSIVRVFFITAASFGALSLYGYTTKRDMTAMGSFL 180

Query: 171 IMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYA-- 228
           +MG  G+ + SLVNLF+ SS +   +S +G+++F+ LTA+DTQ++K  Y   Y       
Sbjct: 181 MMGLIGIIIASLVNLFVASSMLQFIVSVVGVLVFAGLTAWDTQRLKNEYIYGYASEGGEV 240

Query: 229 -ERQSVIGALMLYMDFIQ 245
            ER ++ GAL LY++FI 
Sbjct: 241 AERAAITGALSLYLNFIN 258


>gi|126735097|ref|ZP_01750843.1| hypothetical protein RCCS2_14509 [Roseobacter sp. CCS2]
 gi|126715652|gb|EBA12517.1| hypothetical protein RCCS2_14509 [Roseobacter sp. CCS2]
          Length = 245

 Score =  138 bits (348), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 91/257 (35%), Positives = 149/257 (57%), Gaps = 16/257 (6%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +   Q +   G    + ID+GLRA+M +VY  M++G+ +T  +++ V      +      
Sbjct: 1   MAQEQLIRTVGGVRAAEIDEGLRAHMNKVYGTMSVGMLITFAVAWAVGTSPALLGVFRDP 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
           + ++  ++              WI +FAPL +       ++  SA AA+  F  ++A++G
Sbjct: 61  VTLSPNIL-------------GWIVMFAPLAMVFGFGAMINRFSAAAAQTFFYAFAAVMG 107

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LS++  F+ +T  SI   F IT+ +F  LSLYGYTTK+D+   G+F+IMG  GL +  +V
Sbjct: 108 LSMAWIFVAFTGLSIANVFLITSIAFAGLSLYGYTTKKDISGWGTFLIMGVIGLIVAMVV 167

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLY 240
           N+F++S AI   +S +G++IF+ LTAYDTQKIK  Y   +   D  +  + +++GAL LY
Sbjct: 168 NIFLQSPAIMFAISILGVLIFAGLTAYDTQKIKNDYIAHAAHGDQEWLAKSAIMGALNLY 227

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DFI +F+ LL+  GSR
Sbjct: 228 LDFINMFMFLLQLFGSR 244


>gi|221638296|ref|YP_002524558.1| hypothetical protein RSKD131_0197 [Rhodobacter sphaeroides KD131]
 gi|221159077|gb|ACM00057.1| Hypothetical Protein RSKD131_0197 [Rhodobacter sphaeroides KD131]
          Length = 246

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 101/258 (39%), Positives = 157/258 (60%), Gaps = 17/258 (6%)

Query: 4   IRNYQRVVNSGS-GFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           + +YQ V + G+    + ID+GLRA+M +VY LM++G+ +TG +++              
Sbjct: 1   MADYQTVRSVGAGARAARIDEGLRAHMNKVYGLMSVGMLLTGGVAWAFGTSEQLFSLLRD 60

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
            + ++  ++              WI +FAPL +       L+ LS  AA++ F  Y+A++
Sbjct: 61  PVTMSPNIL-------------GWIVMFAPLIMVFAFGAVLNRLSQAAAQLFFYAYAAVM 107

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GLSLS  F+ +T  SI QTF ITA +F SLSL+GYTTK+DL   G+F+IMG  GL +  +
Sbjct: 108 GLSLSWIFVAFTGVSIAQTFLITAIAFASLSLFGYTTKKDLSGFGTFLIMGVVGLLVAMV 167

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR---YDVAYAERQSVIGALML 239
           VN+F+ SSA+   +S +G++IF+ LTAYDTQ IK  Y       D  +  + +++GAL L
Sbjct: 168 VNIFLASSALAFAISVIGVLIFAGLTAYDTQNIKNTYLQHAHTGDEEWLGKAAIMGALQL 227

Query: 240 YMDFIQIFVHLLRFLGSR 257
           Y+DFI +F+ LL+F+G+R
Sbjct: 228 YLDFINLFMFLLQFMGNR 245


>gi|220924351|ref|YP_002499653.1| hypothetical protein Mnod_4482 [Methylobacterium nodulans ORS 2060]
 gi|219948958|gb|ACL59350.1| protein of unknown function UPF0005 [Methylobacterium nodulans ORS
           2060]
          Length = 236

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 104/254 (40%), Positives = 150/254 (59%), Gaps = 19/254 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +          +      D  LR +M+RVYN M LGL +TG+++F V        P    
Sbjct: 1   MNTPYAWQTGAASSAVAFDASLRQHMLRVYNYMGLGLALTGLVAFAVASTPAIAQP---- 56

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                          ++ +PL+++ + APL   +FL+ R+  +SA  A+ +F  +  ++G
Sbjct: 57  ---------------LFGTPLKYVVMLAPLAFILFLSFRIEHISAATAQTLFWSFCGVMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSL+S FLV+T  SI +TFFITAA FG+ SLYGYTTKRDL  +GSF++MG  GL + SLV
Sbjct: 102 LSLASIFLVFTGTSIARTFFITAAMFGATSLYGYTTKRDLSQMGSFLMMGLIGLIIASLV 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F+ SSA+   +S +G+VIF  LTAYDTQ IKE Y++ +      + +V GAL LY++F
Sbjct: 162 NIFLASSALQFAISLIGVVIFVGLTAYDTQSIKEQYAEHWGQEANNKLAVFGALSLYLNF 221

Query: 244 IQIFVHLLRFLGSR 257
           I +F  LL   G R
Sbjct: 222 INLFQMLLNLTGER 235


>gi|85706841|ref|ZP_01037932.1| membrane protein, putative [Roseovarius sp. 217]
 gi|85668634|gb|EAQ23504.1| membrane protein, putative [Roseovarius sp. 217]
          Length = 259

 Score =  138 bits (347), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 106/257 (41%), Positives = 162/257 (63%), Gaps = 4/257 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  +  +  +     + ID GLRA+M +VY  M++G+ +T + ++ +  LA T DP AA+
Sbjct: 1   MAEFNTIRTATGTRTAQIDAGLRAHMNKVYGTMSVGMLITALAAWAIAGLAVTTDPSAAA 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSL-SAYAAKMMFLLYSALI 122
             +  G ML+G GA +Y SPL+W+ + APL         L    SA A ++ F  ++ALI
Sbjct: 61  AQLPNGTMLSGLGAALYLSPLKWVVMLAPLAFIFLGWGALLRRGSAAAVQLGFFAFAALI 120

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G+S+SS FLV+TS SI QTF +TA +F  LSLYGYTTK+D+   GSF+IMG  GL ++ +
Sbjct: 121 GISMSSIFLVFTSFSIAQTFIVTAIAFAGLSLYGYTTKKDISGWGSFLIMGVIGLIVVMV 180

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR---YDVAYAERQSVIGALML 239
           +N+F++S A+   +SA+GL+IF+ LTA+ TQ+IK  Y       D  + ++ +  GAL L
Sbjct: 181 INIFLQSPAVMFAISAIGLLIFAGLTAFYTQEIKSTYVAHAAQGDQEWLDKAAYDGALNL 240

Query: 240 YMDFIQIFVHLLRFLGS 256
           Y+ F+ +F  LL F+G 
Sbjct: 241 YISFLNMFQFLLMFMGQ 257


>gi|170747451|ref|YP_001753711.1| hypothetical protein Mrad2831_1019 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653973|gb|ACB23028.1| protein of unknown function UPF0005 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 256

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 114/258 (44%), Positives = 165/258 (63%), Gaps = 8/258 (3%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA 61
           S  R   +     +G    +DQGLR +M+ VYN M +GLG++G+++  +N+ +       
Sbjct: 6   SPFRYGAQQPTGYAGTQVEVDQGLRTFMLGVYNNMVVGLGISGLVALGLNMASV------ 59

Query: 62  ASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
            +       +LT FG  +Y SPL+W+ + APL      ++R+  +SA +A+ MF  ++A+
Sbjct: 60  -AAYQGTRPILTPFGQTLYLSPLKWVLMLAPLAFIFVFSMRMDRMSASSARTMFWAFAAV 118

Query: 122 IGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS 181
           +G SLSS  LV+T  S+VQ FFITAA+FGSLSL+GYTT+R L  +GSF++MG  G+ L S
Sbjct: 119 MGASLSSLLLVFTGGSVVQVFFITAAAFGSLSLWGYTTRRSLSGMGSFLMMGLIGIILAS 178

Query: 182 LVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY-DVAYAERQSVIGALMLY 240
           LVN+F  SSA+   +S +G++IF+ LTAYDTQK+KE Y     D   A + SV GAL LY
Sbjct: 179 LVNIFFASSALQFAISVLGVLIFAGLTAYDTQKLKEMYLYGGFDGEMAAKMSVNGALTLY 238

Query: 241 MDFIQIFVHLLRFLGSRR 258
           +DFI +F  LL  +G RR
Sbjct: 239 LDFINMFQFLLSLIGDRR 256


>gi|146337543|ref|YP_001202591.1| putative transport protein membrane protein [Bradyrhizobium sp.
           ORS278]
 gi|146190349|emb|CAL74345.1| putative transport protein; putative membrane protein
           [Bradyrhizobium sp. ORS278]
          Length = 263

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 118/251 (47%), Positives = 166/251 (66%), Gaps = 7/251 (2%)

Query: 1   MSDI-RNYQRVVN--SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY       +G    +T+D GLRAYM+R+YN M++GL +TG+ +  V + A T 
Sbjct: 1   MSDLNRNYASPFGRVAGRADAATVDAGLRAYMLRIYNYMSIGLAITGLAALGVYMAAVTG 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           DP A          LT FG  M+ SPL+W+FI APL +   ++  ++ L+   A+++F +
Sbjct: 61  DPAAGVFKFGNA-YLTQFGYAMFVSPLKWLFILAPLVMVFAISAGINRLAPSTAQLLFWV 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           +SAL+G+SLSS FLVYT  SIV+ FFITAA+FG+LSLYGYTTKRD+   GSF+ MG  G+
Sbjct: 120 FSALMGVSLSSIFLVYTHTSIVRVFFITAATFGALSLYGYTTKRDMTGFGSFLFMGLIGI 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVI 234
            L SLVNLF+ SS +   +S +G+ +F+ LTA+DTQ++K  Y   Y       AER ++ 
Sbjct: 180 VLASLVNLFLASSMLQFIVSVIGVFVFAGLTAWDTQRLKNEYIYGYASAGGDIAERAAIT 239

Query: 235 GALMLYMDFIQ 245
           GAL LY++FI 
Sbjct: 240 GALSLYLNFIN 250


>gi|39933275|ref|NP_945551.1| acetate transporter [Rhodopseudomonas palustris CGA009]
 gi|39652900|emb|CAE25642.1| possible acetate transporter, stationary-phase anti-death (SAD)
           family [Rhodopseudomonas palustris CGA009]
          Length = 263

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 120/251 (47%), Positives = 170/251 (67%), Gaps = 7/251 (2%)

Query: 1   MSDI-RNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY       +G    +T+D GLRAYM+R+YN M +GL +TG+ +  V + A T 
Sbjct: 1   MSDLDRNYTSPFGRAAGRVETATVDAGLRAYMLRIYNYMTIGLAITGLAALGVYMGAVTT 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           D  AA+  +    MLT FG  M+ SPL+W+FI APL +   ++  ++ L    A+++F  
Sbjct: 61  DAGAAAARVGN-TMLTSFGVAMFVSPLKWVFILAPLAMVFVISFGINRLKPATAQLLFWA 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           +SAL+G+SLSS FLVYT  SIV+ FFITAA+FG+LSLYGYTTKRD+  +GSF+IMG FG+
Sbjct: 120 FSALMGISLSSIFLVYTHTSIVRVFFITAAAFGALSLYGYTTKRDMTGMGSFLIMGLFGV 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVI 234
            + SLVNLF+ SS +   +S +G+++F+ LTA+DTQ++K  Y   Y       AER ++ 
Sbjct: 180 VIASLVNLFVASSMLQFIVSVVGVLVFAGLTAWDTQRLKNDYIYGYGSMGGDVAERAAIT 239

Query: 235 GALMLYMDFIQ 245
           GAL LY++FI 
Sbjct: 240 GALSLYLNFIN 250


>gi|146276723|ref|YP_001166882.1| hypothetical protein Rsph17025_0671 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554964|gb|ABP69577.1| protein of unknown function UPF0005 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 246

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 102/258 (39%), Positives = 157/258 (60%), Gaps = 17/258 (6%)

Query: 4   IRNYQRVVNSGS-GFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           +  YQ V + G+    + ID+GLRA+M +VY LM++G+ +TG +++ V            
Sbjct: 1   MAEYQTVRSVGAGARAARIDEGLRAHMNKVYGLMSVGMLLTGGVAWAVGTSEQLFSLLRD 60

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
            + ++  ++              WI +FAPL +       L+ LS  AA++ F  Y+A++
Sbjct: 61  PVTMSPNIL-------------GWIVMFAPLVMVFAFGAVLNRLSQAAAQLFFYAYAAVM 107

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GLSLS  F+ +T  SI QTF ITA +F SLSL+GYTTK+DL   G+F+IMG  GL +  +
Sbjct: 108 GLSLSWIFVAFTGVSIAQTFLITAIAFASLSLFGYTTKKDLSGFGTFLIMGVVGLIVAMI 167

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR---YDVAYAERQSVIGALML 239
           VN+F+ SSA+   +S +G++IF+ LTAYDTQ IK  Y       D  +  + +++GAL L
Sbjct: 168 VNIFLASSALAFAISVIGVLIFAGLTAYDTQNIKNTYLQHAHSGDAEWLGKAAIMGALQL 227

Query: 240 YMDFIQIFVHLLRFLGSR 257
           Y+DFI +F+ LL+F+G+R
Sbjct: 228 YLDFINLFMFLLQFMGNR 245


>gi|148251994|ref|YP_001236579.1| putative transport protein [Bradyrhizobium sp. BTAi1]
 gi|146404167|gb|ABQ32673.1| putative transport protein [Bradyrhizobium sp. BTAi1]
          Length = 263

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 117/251 (46%), Positives = 167/251 (66%), Gaps = 7/251 (2%)

Query: 1   MSDI-RNYQRVVN--SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD+ RNY       +G    +T+D GLRAYM+R+YN M++GL +TG+ +  V + + T 
Sbjct: 1   MSDLDRNYASPFGRVAGRADAATVDAGLRAYMLRIYNYMSIGLAITGLAALGVYMASVTG 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           DP A          LT FG  M+ SPL+W+FI APL +   ++  ++ L+   A+++F +
Sbjct: 61  DPAAGVFKFGNA-YLTQFGYAMFVSPLKWLFILAPLVMVFAISAGINRLAPSTAQILFWV 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           +SAL+G+SLSS FLVYT  SIV+ FFITAA+FG+LSLYGYTTKRD+  +GSF+ MG  G+
Sbjct: 120 FSALMGISLSSIFLVYTHTSIVRVFFITAATFGALSLYGYTTKRDMTGMGSFLFMGLIGI 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVI 234
            L SLVNLF+ SS +   +S +G+ +F+ LTA+DTQ++K  Y   Y       AER ++ 
Sbjct: 180 VLASLVNLFLASSMLQFIVSVVGVFVFAGLTAWDTQRLKNEYIYGYASAGGDIAERAAIT 239

Query: 235 GALMLYMDFIQ 245
           GAL LY++FI 
Sbjct: 240 GALSLYLNFIN 250


>gi|197103611|ref|YP_002128988.1| hypothetical protein PHZ_c0145 [Phenylobacterium zucineum HLK1]
 gi|196477031|gb|ACG76559.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 275

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 95/259 (36%), Positives = 142/259 (54%), Gaps = 10/259 (3%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MSD                ++D GLR++M+ VYN +ALGL V+  ++FL        D  
Sbjct: 26  MSDFNRGYARTIPADRADMSVDAGLRSFMLGVYNKVALGLVVSAALAFLTGQYPPVRDLM 85

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A     R   +T  G          I  FAPL V +F    L + +  ++ +++    A
Sbjct: 86  YAVTPDGRLAGMTMLGT---------IVAFAPLAVMLFGMFALRNATPRSSGILYWTIVA 136

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           LIG  L  + L+YT  SI  TF ITA +FG LSL+GYTTK+DL   GSF+++G  GL + 
Sbjct: 137 LIGAGLGVWTLIYTGGSIATTFLITATAFGGLSLFGYTTKKDLTGFGSFLLVGLIGLVIA 196

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALML 239
           S+VN+F+++S ++  +S +G+ IF+ L AYDTQ++K  Y +   + A     +  GAL L
Sbjct: 197 SIVNIFLQNSMMNFLISVLGVFIFAGLIAYDTQRLKMTYYELGGNQAAMGVATNYGALSL 256

Query: 240 YMDFIQIFVHLLRFLGSRR 258
           Y++FI +F  LL+  G RR
Sbjct: 257 YINFINLFQFLLQLFGQRR 275


>gi|144897621|emb|CAM74485.1| Protein of unknown function UPF0005 [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 240

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 111/256 (43%), Positives = 165/256 (64%), Gaps = 19/256 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
             + ++ +       + ID GLR YM+RVYN+MALGL +TG ++ LV      +      
Sbjct: 3   FGSDRKYMTPAQADAAQIDVGLRQYMLRVYNMMALGLALTGGVALLVASSPAAL------ 56

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                         +++ +PL+W+ + AP+G+  FL++R+H++ A  A+ +F LY+AL+G
Sbjct: 57  -------------QMIFGTPLKWVVMLAPVGLAFFLSMRIHAMKASTAQGVFWLYAALMG 103

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
            SL+S F+V+T  SI +TFF+TAA+F  LSL+GYTTKR L  +G+F+ MG  GL + S+V
Sbjct: 104 ASLASVFIVFTGASIARTFFVTAAAFAGLSLWGYTTKRSLSGMGTFLFMGTIGLLIASVV 163

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F+ SS +   +SA G++IF+ LTAYDTQKIKE Y +  D   A +++V GAL LYMDF
Sbjct: 164 NIFLASSMLQFVISAAGVLIFAGLTAYDTQKIKEMYFELDDSETASKKAVFGALSLYMDF 223

Query: 244 IQIFVHLLRFLGSRRD 259
           I +F  LL F+G R D
Sbjct: 224 IMLFQFLLHFMGVRND 239


>gi|83594887|ref|YP_428639.1| hypothetical protein Rru_A3558 [Rhodospirillum rubrum ATCC 11170]
 gi|83577801|gb|ABC24352.1| Protein of unknown function UPF0005 [Rhodospirillum rubrum ATCC
           11170]
          Length = 250

 Score =  137 bits (345), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 103/253 (40%), Positives = 147/253 (58%), Gaps = 10/253 (3%)

Query: 5   RNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASI 64
           R +     +G    + +D GLR YM+RVYN +A GL ++G+++  V     +      S 
Sbjct: 7   REHLSRGQAGVATDAQVDAGLRTYMLRVYNYLASGLALSGVIAMSVVYTPLSAAFYQVSP 66

Query: 65  IINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGL 124
                      G LM  + L  I +FAPLG+          +SA A++M +  + AL G+
Sbjct: 67  ----------EGQLMGLNMLGMIAVFAPLGLLFLAMFAAQKMSAAASQMFYWAFVALQGV 116

Query: 125 SLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN 184
           SLS+  LVYT +SIV+ FFITA +F +LSLYGYTTKRDL   G F+ MG  G+ L ++VN
Sbjct: 117 SLSTLLLVYTGESIVRVFFITAGTFAALSLYGYTTKRDLAGFGKFLFMGLIGMLLAAVVN 176

Query: 185 LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
           +F+ SS +   +SA+G+++FS L AYDTQ IKE Y D        + +V  AL LY++FI
Sbjct: 177 IFLGSSMLQFVVSAVGVLVFSGLIAYDTQAIKERYYDGLGRDSETKMAVFSALALYLNFI 236

Query: 245 QIFVHLLRFLGSR 257
            +   LL FLG+R
Sbjct: 237 NLLQFLLYFLGNR 249


>gi|77462433|ref|YP_351937.1| hypothetical protein RSP_1889 [Rhodobacter sphaeroides 2.4.1]
 gi|126461310|ref|YP_001042424.1| hypothetical protein Rsph17029_0536 [Rhodobacter sphaeroides ATCC
           17029]
 gi|332560317|ref|ZP_08414639.1| hypothetical protein RSWS8N_14690 [Rhodobacter sphaeroides WS8N]
 gi|77386851|gb|ABA78036.1| conserved hypothetical membrane protein [Rhodobacter sphaeroides
           2.4.1]
 gi|126102974|gb|ABN75652.1| protein of unknown function UPF0005 [Rhodobacter sphaeroides ATCC
           17029]
 gi|332278029|gb|EGJ23344.1| hypothetical protein RSWS8N_14690 [Rhodobacter sphaeroides WS8N]
          Length = 246

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 101/258 (39%), Positives = 157/258 (60%), Gaps = 17/258 (6%)

Query: 4   IRNYQRVVNSGS-GFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           + +YQ V + G+    + ID+GLRA+M +VY LM++G+ +TG +++              
Sbjct: 1   MADYQTVRSVGAGARAARIDEGLRAHMNKVYGLMSVGMLLTGGVAWAFGTSEQLFSLLRD 60

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
            + ++  ++              WI +FAPL +       L+ LS  AA++ F  Y+A++
Sbjct: 61  PVTMSPNIL-------------GWIVMFAPLIMVFAFGAVLNRLSQAAAQLFFYAYAAVM 107

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GLSLS  F+ +T  SI QTF ITA +F SLSL+GYTTK+DL   G+F+IMG  GL +  +
Sbjct: 108 GLSLSWIFVAFTGVSIAQTFLITAIAFASLSLFGYTTKKDLSGFGTFLIMGVVGLLVAMV 167

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR---YDVAYAERQSVIGALML 239
           VN+F+ SSA+   +S +G++IF+ LTAYDTQ IK  Y       D  +  + +++GAL L
Sbjct: 168 VNIFLASSALAFAISVIGVLIFAGLTAYDTQNIKNTYLQHAHTGDAEWLGKAAIMGALQL 227

Query: 240 YMDFIQIFVHLLRFLGSR 257
           Y+DFI +F+ LL+F+G+R
Sbjct: 228 YLDFINLFMFLLQFMGNR 245


>gi|90421724|ref|YP_530094.1| hypothetical protein RPC_0200 [Rhodopseudomonas palustris BisB18]
 gi|90103738|gb|ABD85775.1| protein of unknown function UPF0005 [Rhodopseudomonas palustris
           BisB18]
          Length = 271

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 118/258 (45%), Positives = 166/258 (64%), Gaps = 13/258 (5%)

Query: 1   MSDI-RNYQRVVNSGSGF--GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD  RNY       +G    + +D GLRAYM+R+YN M +GL +TG  +  V   A T 
Sbjct: 1   MSDFDRNYASPFGRAAGRVDAAAVDAGLRAYMLRIYNYMTIGLAITGAAALGVYKFAVTS 60

Query: 58  D-------PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYA 110
           D          A+I +  G  LT FG +M+ SPL+W+FI APL +   ++  ++ L    
Sbjct: 61  DMAEAVRSASGAAIRVAEGQFLTSFGYMMFASPLKWVFILAPLVMVFAISFGINRLKPAT 120

Query: 111 AKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFM 170
           A+M+F  ++AL+G+SLSS FLVYT  SIV+ FFITAASFG+LSLYGYTTKRDL  +GSF+
Sbjct: 121 AQMLFWAFAALMGISLSSIFLVYTHTSIVRVFFITAASFGALSLYGYTTKRDLTGMGSFL 180

Query: 171 IMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYA-- 228
           +MG FG+ L SLVNLF+ S+ +   +S +G+++F+ LTA+DTQ++K  Y   Y       
Sbjct: 181 MMGLFGVILASLVNLFVASTMLQFIVSVVGVLVFAGLTAWDTQRLKNDYIYGYASQGGDV 240

Query: 229 -ERQSVIGALMLYMDFIQ 245
            +R ++ GAL LY++FI 
Sbjct: 241 ADRAAITGALSLYLNFIN 258


>gi|294084981|ref|YP_003551741.1| integral membrane protein, interacts with FtsH [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664556|gb|ADE39657.1| Integral membrane protein, interacts with FtsH [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 239

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 107/250 (42%), Positives = 159/250 (63%), Gaps = 15/250 (6%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
            R +N+ +   + ID GLR+YM+ VYN M   L +TG  +F +     TV          
Sbjct: 4   NRFMNTAAAQSAQIDTGLRSYMLGVYNHMTTALLLTGFFAFAMKWAVMTVPAV------- 56

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
                   G L+Y +PL+W+ + APLG+  +L+ R++++SA  A+ MF +Y AL+GLSL+
Sbjct: 57  --------GQLVYGTPLKWVVMLAPLGMVFWLSARMNAMSATKARNMFYIYGALMGLSLA 108

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
           S   VYT  S+ + FFITA +F  LSLYGY+TKR L  +GSFM++G FGL + S+VN+FM
Sbjct: 109 SILFVYTGASVARAFFITAGAFAGLSLYGYSTKRSLSAMGSFMVIGLFGLIIASVVNIFM 168

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIF 247
            SS ++  +S  G++IF+ LTA+DTQ+IK  Y        + ++S+ GALMLY+DFI +F
Sbjct: 169 ASSQLEFVISVAGVLIFAGLTAWDTQRIKAMYMAGDSSEESNKKSIFGALMLYLDFINMF 228

Query: 248 VHLLRFLGSR 257
           + +LR  G+R
Sbjct: 229 LFILRLFGNR 238


>gi|254561463|ref|YP_003068558.1| hypothetical protein METDI3050 [Methylobacterium extorquens DM4]
 gi|254268741|emb|CAX24702.1| conserved hypothetical protein; putative inner membrane protein
           [Methylobacterium extorquens DM4]
          Length = 255

 Score =  136 bits (343), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 112/245 (45%), Positives = 161/245 (65%), Gaps = 8/245 (3%)

Query: 15  SGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           +G    +DQGLR++M+ VYN M +GLG++G+++  +N+ A               + LT 
Sbjct: 18  AGSQVEVDQGLRSFMLGVYNNMVVGLGISGLVALALNMAAVAQTGAGR-------LALTP 70

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
           FG  +YTSP +W+ + APL      + R+  +SA +A+MMF  ++A++G S+S+  LV+T
Sbjct: 71  FGQFLYTSPFKWVLMLAPLAFIFVFSFRMDRMSASSARMMFWAFAAVMGASMSTLLLVFT 130

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             S+V+ FFITAA+F  LSLYGYTTKR L  +GSF+IMG  G+ + SLVNLF+ SSA+  
Sbjct: 131 GASVVRVFFITAATFAGLSLYGYTTKRSLSGMGSFLIMGLIGIIIASLVNLFLASSALQF 190

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRY-DVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
            +S +G++IF+ LTA+DTQK+KE Y     D   A + SV GAL LY+DFI +F  LL  
Sbjct: 191 AISVLGVLIFAGLTAFDTQKLKEMYLYSGLDAEGAAKMSVNGALTLYLDFINMFQFLLSL 250

Query: 254 LGSRR 258
           LG RR
Sbjct: 251 LGDRR 255


>gi|84515297|ref|ZP_01002659.1| hypothetical protein SKA53_01526 [Loktanella vestfoldensis SKA53]
 gi|84510580|gb|EAQ07035.1| hypothetical protein SKA53_01526 [Loktanella vestfoldensis SKA53]
          Length = 263

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 91/259 (35%), Positives = 153/259 (59%), Gaps = 16/259 (6%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA 61
            ++  Y  +  +G    + ID+GLRA+M +VY  M++G+ +T  +++ V      +    
Sbjct: 17  GNMAQYDTIRTAGGVRTAAIDEGLRAHMSKVYGTMSVGMLITFAVAWAVGTAPALLGVFR 76

Query: 62  ASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
             I +   ++              WI +FAPLG+       ++  SA AA+  F  ++A+
Sbjct: 77  DPITLQPNIL-------------GWIVMFAPLGMIFGFGAMINRFSAAAAQTFFYAFAAV 123

Query: 122 IGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS 181
           +GLS++  F+ +T  SI Q F IT+ +F SLSLYGYTTK+DL   G+F++MG  G+ +  
Sbjct: 124 MGLSIAWIFVAFTGMSIAQIFLITSIAFASLSLYGYTTKKDLSAWGTFLMMGVIGIVVAM 183

Query: 182 LVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALM 238
           ++NLF++S AI   +S +G++IF+ LTAYDTQ+IK  Y   +   D  +  + +++GAL 
Sbjct: 184 IINLFLQSPAIMFAISILGVLIFAGLTAYDTQRIKTEYVAHAAHGDAEWLGKSAIMGALS 243

Query: 239 LYMDFIQIFVHLLRFLGSR 257
           LY++FI +F+ LL+  G+R
Sbjct: 244 LYLNFINMFMFLLQLFGNR 262


>gi|197103249|ref|YP_002128627.1| integral membrane protein, interacts with FtsH [Phenylobacterium
           zucineum HLK1]
 gi|196480525|gb|ACG80052.1| integral membrane protein, interacts with FtsH [Phenylobacterium
           zucineum HLK1]
          Length = 251

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 103/260 (39%), Positives = 144/260 (55%), Gaps = 10/260 (3%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MSD                 +D GLR++MI VYN +ALGL V+  ++FL + +    D  
Sbjct: 1   MSDFYRSHYGSIPAQRGDMAVDAGLRSFMIGVYNKVALGLVVSAALAFLTSSVPPIRD-- 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                     M+   G L   +PL WI  FAPLG+ +     + + ++ AA  ++    A
Sbjct: 59  -------LMFMVNADGRLAGMTPLGWIVAFAPLGIMLVSGFAMKNPTSGAASALYWTIVA 111

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           LIG S     L+YT  SI  TF ITA +FG LSL+GYTTK+DL   GSF+I+G  GL + 
Sbjct: 112 LIGASFGVVGLMYTGTSIASTFLITATAFGGLSLFGYTTKKDLSGFGSFLIVGVIGLVIA 171

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSV-IGALML 239
           SLVN+F+RS A+   +S +G+ +F+ L AYDTQ++K  Y +    A A   +   GAL L
Sbjct: 172 SLVNIFLRSEAVQFAVSVIGVFVFAGLIAYDTQRLKLTYYELGGDASARGVATSYGALSL 231

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y++FI +F  LL   G RRD
Sbjct: 232 YINFINLFQFLLSLFGQRRD 251


>gi|148284516|ref|YP_001248606.1| hypothetical protein OTBS_0921 [Orientia tsutsugamushi str.
           Boryong]
 gi|146739955|emb|CAM79987.1| hypothetical protein OTBS_0921 [Orientia tsutsugamushi str.
           Boryong]
          Length = 246

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 89/249 (35%), Positives = 148/249 (59%), Gaps = 9/249 (3%)

Query: 10  VVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRG 69
                 G   +ID+GLRAYM+R+YNLMA+ L +T +       L                
Sbjct: 5   TRAYSGGVHKSIDEGLRAYMLRIYNLMAMALFITAVAGTATFSLEPLAR---------LM 55

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
              +  G ++  +P+  +   AP+G+ ++    +  L    A+ +F +Y+ L+G+SLS+ 
Sbjct: 56  FNFSPNGYVIGQTPIGLLVNVAPIGIALYFFWGIGRLDISTAQTLFWVYAVLVGMSLSAL 115

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
             +YT +S+V +FFITA++F ++S+YG+TT+RDL  +G+ ++MG +G+ + SLVN+F+ S
Sbjct: 116 GYIYTGESLVSSFFITASAFAAMSIYGHTTQRDLTSLGALLLMGLWGIIISSLVNIFLGS 175

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
            AI    S +G+ IF  L A+DTQK+K  Y         ++ +V+GA  LY+DFI +F++
Sbjct: 176 PAIHFATSVLGVGIFMGLIAWDTQKLKHIYYSSGGGELGQKLAVVGAFTLYLDFINLFLY 235

Query: 250 LLRFLGSRR 258
           +LRF G+RR
Sbjct: 236 VLRFFGNRR 244


>gi|254510914|ref|ZP_05122981.1| integral membrane protein [Rhodobacteraceae bacterium KLH11]
 gi|221534625|gb|EEE37613.1| integral membrane protein [Rhodobacteraceae bacterium KLH11]
          Length = 259

 Score =  135 bits (339), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 101/257 (39%), Positives = 161/257 (62%), Gaps = 4/257 (1%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  +  +        + ID+GLRA+M +VY  M++G+ +T + ++ ++ LA T DP  A 
Sbjct: 1   MAQFDTIRTVSGARAAEIDEGLRAHMNKVYGTMSVGMLITALAAWAISGLAVTSDPANAV 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSL-SAYAAKMMFLLYSALI 122
             I     LT  G  ++ SPL+W+ +FAPLG   F    L    SA A ++ F +++A++
Sbjct: 61  AQIGVDRYLTSLGGALFLSPLKWVIMFAPLGFLFFGWGALMRRGSAAAVQLGFFIFAAVM 120

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G+S+SS F++YT  SI QTF +T+ +F  LSLYGYTTKR+L  +G+F++MG  GL +  +
Sbjct: 121 GVSMSSIFMIYTPYSIAQTFLVTSIAFAGLSLYGYTTKRNLSGMGTFLMMGVIGLLVAMI 180

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALML 239
           VNLF++SSA+ + +S +GL+IF+ LTA+ TQ IK  Y   +   D  + ++ +  GAL L
Sbjct: 181 VNLFLQSSAMMMAISVIGLLIFAGLTAFYTQDIKNTYVAHAAHGDQEWLDKAAFDGALSL 240

Query: 240 YMDFIQIFVHLLRFLGS 256
           Y+ F+ +F  LL F+G 
Sbjct: 241 YISFLNMFQFLLMFMGQ 257


>gi|189183170|ref|YP_001936955.1| hypothetical protein OTT_0263 [Orientia tsutsugamushi str. Ikeda]
 gi|189179941|dbj|BAG39721.1| hypothetical protein OTT_0263 [Orientia tsutsugamushi str. Ikeda]
          Length = 246

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 90/249 (36%), Positives = 148/249 (59%), Gaps = 9/249 (3%)

Query: 10  VVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRG 69
                 G   +ID+GLRAYM+R+YNLMA+ L +T +       L                
Sbjct: 5   TRAYSGGVHKSIDEGLRAYMLRIYNLMAMALFITAVAGTATFSLEPLAR---------LM 55

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
              +  G ++  +P+  +   AP+G+ ++    +  L    A+ +F +Y+ L+G+SLS+ 
Sbjct: 56  FNFSPNGYVIGQTPIGLLVNVAPIGIALYFFWGIGRLDISTAQTLFWVYAVLVGMSLSAL 115

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
             +YT +S+V +FFITA++F ++S+YG+TT+RDL  +GS +IMG +G+ + SLVN+F+ S
Sbjct: 116 GYIYTGESLVSSFFITASAFAAMSIYGHTTQRDLTSLGSLLIMGLWGIIISSLVNIFLGS 175

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
            AI    S +G+ IF  L A+DTQK+K  Y         ++ +V+GA  LY+DF+ +F++
Sbjct: 176 PAIHFATSVLGVGIFMGLIAWDTQKLKHIYYSSGGGELGQKLAVVGAFTLYLDFLNLFLY 235

Query: 250 LLRFLGSRR 258
           +LRF G+RR
Sbjct: 236 VLRFFGNRR 244


>gi|238763836|ref|ZP_04624794.1| Inner membrane protein YbhL [Yersinia kristensenii ATCC 33638]
 gi|238697966|gb|EEP90725.1| Inner membrane protein YbhL [Yersinia kristensenii ATCC 33638]
          Length = 254

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 92/260 (35%), Positives = 144/260 (55%), Gaps = 20/260 (7%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M  +    R   S        + G++AYM +VY  M  GL +T ++++      + +   
Sbjct: 13  MHKVTTMDRYPRSNGSIVERANSGIQAYMAQVYGWMTCGLLLTAVVAWYAANTPSIIFAL 72

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            ++ I+  G+++   G +   S                    ++ LS  AA  +F+LYSA
Sbjct: 73  QSNQILFFGLIIAQLGLVFVISG------------------MINRLSGSAATSLFMLYSA 114

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L GL+LSS  ++YT  SI  TF I A  FG++SLYGYTTKRDL  +GS + MG  G+ L 
Sbjct: 115 LTGLTLSSILILYTGASIASTFVICAGMFGAMSLYGYTTKRDLSGLGSILFMGLIGIILA 174

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALM 238
           SLVN++++S A+   ++ +G+++F  LTAYDTQK+K   +     D     + +++GAL 
Sbjct: 175 SLVNIWLKSPALMWAVTYIGVLVFVGLTAYDTQKLKNMGAQLDANDKDGFRKYAIVGALT 234

Query: 239 LYMDFIQIFVHLLRFLGSRR 258
           LY+DFI +F+ LLR  G+RR
Sbjct: 235 LYLDFINLFLMLLRIFGNRR 254


>gi|77465107|ref|YP_354610.1| integral membrane protein [Rhodobacter sphaeroides 2.4.1]
 gi|126464559|ref|YP_001045672.1| hypothetical protein Rsph17029_3820 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221369108|ref|YP_002520204.1| integral membrane protein [Rhodobacter sphaeroides KD131]
 gi|332560704|ref|ZP_08415022.1| integral membrane protein [Rhodobacter sphaeroides WS8N]
 gi|77389525|gb|ABA80709.1| Predicted integral membrane protein [Rhodobacter sphaeroides 2.4.1]
 gi|126106370|gb|ABN78900.1| protein of unknown function UPF0005 [Rhodobacter sphaeroides ATCC
           17029]
 gi|221162160|gb|ACM03131.1| integral membrane protein [Rhodobacter sphaeroides KD131]
 gi|332274502|gb|EGJ19818.1| integral membrane protein [Rhodobacter sphaeroides WS8N]
          Length = 237

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 100/243 (41%), Positives = 152/243 (62%), Gaps = 19/243 (7%)

Query: 15  SGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           +   +  D GLRA+M+R+YN M LGL +TG+++ LV        P               
Sbjct: 13  ARSTAVYDDGLRAHMLRIYNYMGLGLALTGLVAVLVAATPAIYVP--------------- 57

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
               ++++PL+W+ + APL   +FL+ R+ ++SA  A+M+F  +  ++GLSL+S FLV+T
Sbjct: 58  ----IFSTPLKWVVMLAPLAFVLFLSFRIEAISAGTAQMLFWAFCGVMGLSLASIFLVFT 113

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI + FF  AA F  +SLYGYTTKRDL   GSF++MG  G+ L S++NLF+ SSA+  
Sbjct: 114 GTSIARAFFGAAAMFAGMSLYGYTTKRDLSQFGSFLMMGLIGVILASVINLFLGSSALQF 173

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
            +S +G+++F  LTA+DTQ IK  Y++  D   +++ +V+GAL LY++FI IF  LL   
Sbjct: 174 AISIIGILVFVGLTAWDTQAIKLQYAEHQDSETSQKLAVMGALSLYLNFINIFQLLLSLT 233

Query: 255 GSR 257
           G R
Sbjct: 234 GER 236


>gi|221236714|ref|YP_002519151.1| integral membrane protein [Caulobacter crescentus NA1000]
 gi|15214335|sp|Q9A2A3|Y3663_CAUCR RecName: Full=Uncharacterized protein CC_3663
 gi|220965887|gb|ACL97243.1| integral membrane protein [Caulobacter crescentus NA1000]
          Length = 250

 Score =  134 bits (338), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 92/260 (35%), Positives = 143/260 (55%), Gaps = 11/260 (4%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D                ++D GLR +M+ VYN +ALGL V+G +++  + +    D  
Sbjct: 1   MNDFNRGYARSIPADRADMSVDAGLRKFMLGVYNKVALGLVVSGALAYATSSVPAVRD-- 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                    + +   G L   +PL  +  FAPL + +     + +     A  ++    +
Sbjct: 59  --------LLFVVQGGRLAGVTPLYMVVAFAPLVLMLIAGFAMRNPKPETAGALYWTIVS 110

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           LIG SL S  L YT +S+  TFF+TA +FG LSL+GYTTK+DL   GSF++MG  GL + 
Sbjct: 111 LIGASLGSVMLRYTGESVAATFFVTATAFGGLSLFGYTTKKDLTGFGSFLMMGVIGLIVA 170

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALML 239
           S+V++F++S A+   ++ +G++IFS L AYDTQ++K  Y +   D A     +  GAL L
Sbjct: 171 SIVSIFLKSPALLFAINVLGVLIFSGLIAYDTQRLKMTYYEMGGDRASMAVATNFGALSL 230

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y++FI +F  LL F G  R+
Sbjct: 231 YINFINLFQFLLSFFGGNRE 250


>gi|92116172|ref|YP_575901.1| hypothetical protein Nham_0551 [Nitrobacter hamburgensis X14]
 gi|91799066|gb|ABE61441.1| protein of unknown function UPF0005 [Nitrobacter hamburgensis X14]
          Length = 271

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 119/258 (46%), Positives = 170/258 (65%), Gaps = 13/258 (5%)

Query: 1   MSDI-RNYQRVVNSGSGFG--STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATT- 56
           MSD+ RNY       +G    + +D GLR+YM+++YN M++GL +TG+ +  V + A T 
Sbjct: 1   MSDLDRNYTSPFGRAAGRVDRAAVDAGLRSYMLKIYNYMSIGLAITGLAALGVYMFAVTG 60

Query: 57  ------VDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYA 110
                      AS+ +  G  LT FG  MY SPL+W+FIFAPL +   ++  ++ L    
Sbjct: 61  DATLAAKSATGASLALKGGQYLTPFGLAMYASPLKWVFIFAPLAMVFAISFGINRLKPAT 120

Query: 111 AKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFM 170
           A+M+F  +SAL+G+SLSS FLVYT  SIV+ FFITAASFG+LSLYGYTTKRD+  +GSF+
Sbjct: 121 AQMLFWAFSALMGVSLSSIFLVYTHTSIVRVFFITAASFGALSLYGYTTKRDMTGMGSFL 180

Query: 171 IMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY---DVAY 227
           IMG FG+ + S+VN+F+ SS +   +S +G+++F+ LTAYDTQ++K  Y   Y       
Sbjct: 181 IMGLFGVIIASVVNIFVASSMLQFVVSVVGVLVFAGLTAYDTQRLKNDYIYGYASQGGEI 240

Query: 228 AERQSVIGALMLYMDFIQ 245
           AER ++ GAL LY++FI 
Sbjct: 241 AERAAITGALSLYLNFIN 258


>gi|299135434|ref|ZP_07028624.1| protein of unknown function UPF0005 [Afipia sp. 1NLS2]
 gi|298589842|gb|EFI50047.1| protein of unknown function UPF0005 [Afipia sp. 1NLS2]
          Length = 263

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 119/251 (47%), Positives = 167/251 (66%), Gaps = 7/251 (2%)

Query: 1   MSDI-RNYQRVVN--SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTV 57
           MSD  RNY       +G    + +D GLRAYM+++YN M +GL +TG  +  V + A T 
Sbjct: 1   MSDSDRNYASPFGHVAGRVDAAAVDAGLRAYMLKIYNYMTIGLAITGFAALGVYMGAVTT 60

Query: 58  DPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLL 117
           D  AA   +    MLT FG  M+ SPL+W+FIFAPL +   ++  ++ L    A+M+F  
Sbjct: 61  DSAAAVGRVGN-TMLTSFGVAMFVSPLKWVFIFAPLVMVFAISFGINRLRPQTAQMLFWA 119

Query: 118 YSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL 177
           +SAL+G+SLSS FLVYT  SIV+ FFITAASFG+LSLYGYTTKRD+  +GSF+IMG FG+
Sbjct: 120 FSALMGVSLSSIFLVYTHTSIVRVFFITAASFGALSLYGYTTKRDMTGMGSFLIMGLFGV 179

Query: 178 FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVI 234
            + S+VN+F+ SS +   +S +G+++F+ LTA+DTQ++K  Y   Y       AER ++ 
Sbjct: 180 IIASIVNIFVASSMLQFVVSIVGVLVFAGLTAWDTQRLKNDYIYGYGAMGGDIAERAAIT 239

Query: 235 GALMLYMDFIQ 245
           GAL LY++FI 
Sbjct: 240 GALSLYLNFIN 250


>gi|294676428|ref|YP_003577043.1| hypothetical protein RCAP_rcc00871 [Rhodobacter capsulatus SB 1003]
 gi|294475248|gb|ADE84636.1| protein of unknown function UPF0005, transmembrane [Rhodobacter
           capsulatus SB 1003]
          Length = 238

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 108/256 (42%), Positives = 162/256 (63%), Gaps = 21/256 (8%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + NY  + ++ +G  S ID+GLR +M +VY LM++ + VTG ++F V++           
Sbjct: 1   MANYNTMHSTAAGRASYIDEGLRTHMNKVYGLMSVAMIVTGAVAFGVSLND--------- 51

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                        A ++ +PL+W+ +FAPL V    +  +H +    A+M+F  YSAL+G
Sbjct: 52  ----------QLLAAIFGTPLKWVVMFAPLVVVFAFSALIHKMQTSTAQMVFFGYSALMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSLS  F VYT  SI QTF ITA +F +LSLYGYTTKR+L   GSF++MG  GL + SL+
Sbjct: 102 LSLSFIFKVYTGVSIAQTFLITAIAFAALSLYGYTTKRNLSAFGSFLMMGLIGLIVASLL 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYM 241
           N+F+ SSA+   +S +G+++F+ LTAYDTQ IK  Y    + D  +  + +++GAL LYM
Sbjct: 162 NIFIASSALQFAISVIGVLLFAGLTAYDTQNIKNTYLQLAQSDADFLGKAAILGALQLYM 221

Query: 242 DFIQIFVHLLRFLGSR 257
           DF+ +F+ LL+FLG+R
Sbjct: 222 DFLNLFMFLLQFLGNR 237


>gi|146279688|ref|YP_001169846.1| hypothetical protein Rsph17025_3673 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557929|gb|ABP72541.1| hypothetical protein Rsph17025_3673 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 236

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 100/254 (39%), Positives = 158/254 (62%), Gaps = 19/254 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +    R  ++G    +  D+GLRA+M+R+YN M LGL +TG+++ +V        P    
Sbjct: 1   MNPAPRGRSAGFAPSAYYDEGLRAHMLRIYNYMGLGLALTGLVAVVVAATPAIYVP---- 56

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                          ++++PL+W+ + APL   +FL+ R+ ++SA  A+M+F  +  ++G
Sbjct: 57  ---------------IFSTPLKWVVMLAPLAFVLFLSFRIEAISAGTAQMLFWAFCGVMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSL+S FLV+T  SI + FF  AA F  +SLYGYTTKRDL   GSF++MG  G+ + S++
Sbjct: 102 LSLASIFLVFTGTSIARAFFGAAAMFAGMSLYGYTTKRDLSQFGSFLMMGLIGVIIASVI 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           NLF+ SSA+   +S +G+++F  LTA+DTQ IK  Y++ +D   +++ +V+GAL LY++F
Sbjct: 162 NLFLGSSALQFAISIIGILVFVGLTAWDTQSIKLQYAEHHDSETSQKLAVMGALSLYLNF 221

Query: 244 IQIFVHLLRFLGSR 257
           I IF  LL   G R
Sbjct: 222 INIFQLLLSLTGER 235


>gi|197103337|ref|YP_002128715.1| hypothetical protein PHZ_p0197 [Phenylobacterium zucineum HLK1]
 gi|196480613|gb|ACG80140.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 250

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 93/259 (35%), Positives = 139/259 (53%), Gaps = 10/259 (3%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M++    +            +D GLR++M+ VYN +ALGL ++ ++++L +++    D  
Sbjct: 1   MANSNETRLRSLPMERADMAVDAGLRSFMVGVYNKVALGLVLSAVLAYLTSMVPPVRD-- 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                      LT  G     + +  +  FAPL V +     +   +A  A  ++    A
Sbjct: 59  -------LMFRLTPDGRFAGYTLIGMVVAFAPLVVLLGSMFAMRQPTARGASALYWTVCA 111

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           LIG SL    LVYT  S+  TF ITAA+FG+LSL+GYTTK+DL  IGSF+++G  GL + 
Sbjct: 112 LIGASLGVLGLVYTGASLASTFLITAAAFGALSLFGYTTKKDLTGIGSFLLVGLIGLVIA 171

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALML 239
           SLV +F         +SA G++IF+ L AYDTQ++K  Y +   D A     +  GAL L
Sbjct: 172 SLVQMFWNPPGFSFVISAAGVLIFAGLIAYDTQRLKLTYYELGGDQAALGAATSYGALSL 231

Query: 240 YMDFIQIFVHLLRFLGSRR 258
           Y++FI +F  LL   G RR
Sbjct: 232 YLNFINLFQFLLSLFGQRR 250


>gi|260427723|ref|ZP_05781702.1| integral membrane protein, interacts with FtsH [Citreicella sp.
           SE45]
 gi|260422215|gb|EEX15466.1| integral membrane protein, interacts with FtsH [Citreicella sp.
           SE45]
          Length = 246

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 94/260 (36%), Positives = 149/260 (57%), Gaps = 18/260 (6%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+  R  +      S   + ID+GLRA+M +VY  M++G+ +T  +++ V      +   
Sbjct: 1   MAQYRTIRTATGPTSA--AQIDEGLRAHMNKVYGTMSVGMLLTFAVAWAVGTSPELLSVF 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                +   ++              WI +FAPL +       L  +SA  A++ F  ++A
Sbjct: 59  RDPATLQPNIL-------------GWIVMFAPLIMAFAFGAALSRISAAGAQLFFFAFAA 105

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           ++GLSLS  F+ +T  SI Q F +TA +F  LSL+GYTTK+D+   GSF+IMG  G+ + 
Sbjct: 106 VMGLSLSWIFVAFTGFSIAQVFLVTAIAFAGLSLWGYTTKKDISGWGSFLIMGVIGILVA 165

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD---RYDVAYAERQSVIGAL 237
           S++N+F+ S AI   +S +G++IF+ LTAYDTQKIK  Y       D  +  + +++GAL
Sbjct: 166 SIINIFLGSPAIYFAISILGVLIFAGLTAYDTQKIKNTYLQYAAHGDSEWLGKAAIMGAL 225

Query: 238 MLYMDFIQIFVHLLRFLGSR 257
            LY+DFI +F+ LL+ LG+R
Sbjct: 226 NLYLDFINMFMFLLQLLGNR 245


>gi|13470643|ref|NP_102212.1| hypothetical protein mlr0409 [Mesorhizobium loti MAFF303099]
 gi|14021385|dbj|BAB47998.1| mlr0409 [Mesorhizobium loti MAFF303099]
          Length = 238

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 105/252 (41%), Positives = 158/252 (62%), Gaps = 19/252 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N    V +G+  G+  D+GLR +M+RVYN M LGL VTG+++FLV+       P      
Sbjct: 5   NLGYRVGTGAQAGAVFDEGLRQHMLRVYNYMGLGLVVTGLVAFLVSSTPALYVP------ 58

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                        +++SPL+++ + APL   +  + R+ ++SA +A+ MF  + A++GLS
Sbjct: 59  -------------IFSSPLKYVVMLAPLAFVLLFSFRMQTMSAASAQAMFWAFCAVMGLS 105

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L+S FLV+T  SI +TFFI A  FG+ SLYGYTT+RDL    SF+IMG  G+ + S+VN+
Sbjct: 106 LASVFLVFTGTSIARTFFIAATMFGATSLYGYTTRRDLTQFSSFLIMGLIGVVIASIVNI 165

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F+ S+A+   +S +G+ +F  LTA+DTQ IKE Y++ +D    ++ +V GA  LY++FI 
Sbjct: 166 FLGSTALQFAISVIGIAVFIGLTAWDTQTIKEQYAENFDAESRQKLAVFGAFSLYLNFIN 225

Query: 246 IFVHLLRFLGSR 257
           IF  LL F G R
Sbjct: 226 IFQLLLNFTGER 237


>gi|260459479|ref|ZP_05807734.1| protein of unknown function UPF0005 [Mesorhizobium opportunistum
           WSM2075]
 gi|259035033|gb|EEW36289.1| protein of unknown function UPF0005 [Mesorhizobium opportunistum
           WSM2075]
          Length = 238

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 106/252 (42%), Positives = 159/252 (63%), Gaps = 19/252 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N    V +G+  G+  D+GLR +M+RVYN M LGL VTG+++F+V+       P      
Sbjct: 5   NLGYRVGTGAQTGAAFDEGLRQHMLRVYNYMGLGLVVTGLVAFMVSSTPALYVP------ 58

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                        +++SPL+W+ + APL   +  + ++ ++SA +A+MMF  + A++GLS
Sbjct: 59  -------------IFSSPLKWVVMLAPLAFVMLFSFKMQTMSAASAQMMFWAFCAVMGLS 105

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L+S FLV+T  SI +TFFI A  FG+ SLYGYTT+RDL    SF+IMG  G+ + S+VN+
Sbjct: 106 LASVFLVFTGTSIARTFFIAATMFGATSLYGYTTRRDLTQFSSFLIMGLIGVVIASIVNI 165

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F+ S+A+   +S +G+ +F  LTA+DTQ IKE YS+ +D    ++ +V GA  LY++FI 
Sbjct: 166 FLGSTALQFAISVIGIAVFIGLTAWDTQTIKEQYSENFDGESRQKLAVFGAFSLYLNFIN 225

Query: 246 IFVHLLRFLGSR 257
           IF  LL F G R
Sbjct: 226 IFQLLLNFTGER 237


>gi|271500994|ref|YP_003334019.1| hypothetical protein Dd586_2465 [Dickeya dadantii Ech586]
 gi|270344549|gb|ACZ77314.1| protein of unknown function UPF0005 [Dickeya dadantii Ech586]
          Length = 236

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 94/254 (37%), Positives = 137/254 (53%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S          GL+ YM +VY  M  GL +T  +S+        +    +S I 
Sbjct: 1   MDRFPRSNGSIVQQASTGLQTYMAQVYGWMTCGLLLTAFVSWYAANTPAVLQLVFSSKIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G                  +   L+  +H LS   A  +F+LYSAL GL+L
Sbjct: 61  FYGLVIAQLG------------------LVFVLSGMVHRLSGGVATTLFMLYSALTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+VY+ +SI  TF ITA  FG++SLYGY TKRDL  +GS + M   G+ L +LVN +
Sbjct: 103 SSIFIVYSGESIASTFVITAGMFGAMSLYGYVTKRDLTGLGSMLFMALIGILLATLVNFW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++S  + L ++ +G+++F  LTAYDTQK+K    +    D     + S++GAL LY+DFI
Sbjct: 163 LKSEGLQLAITYIGVLVFVGLTAYDTQKLKNIGEELSVDDKDNFRKYSIMGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  GSRR
Sbjct: 223 NLFLMLLRLFGSRR 236


>gi|297300359|ref|XP_001098344.2| PREDICTED: glutamate [NMDA] receptor-associated protein 1-like
           isoform 2 [Macaca mulatta]
          Length = 440

 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/261 (16%), Positives = 101/261 (38%), Gaps = 28/261 (10%)

Query: 6   NYQRVVNSGSGFGSTI------DQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVD 58
           NYQ                   D+ +R A++ +V+ ++ L L VT     +   +     
Sbjct: 201 NYQEEGPPSYYDNQDFPATDWDDKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVGEVKG 260

Query: 59  PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
               ++          F +L+  S                              +   + 
Sbjct: 261 FVRENVWTYYVSYAVFFISLIVLSC-----------------CGDFRRKHPWNLVALSVL 303

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
           +A +   +      Y +++++    IT A   ++ ++   T+ D       +++    LF
Sbjct: 304 TASLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLF 363

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALM 238
           + +++ +F+R+  +++  +++G ++F+   A DTQ +         ++ +  + V  AL 
Sbjct: 364 IFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAALN 419

Query: 239 LYMDFIQIFVHLLRFLGSRRD 259
           LY D I IF+++L  +G  ++
Sbjct: 420 LYTDIINIFLYILTIIGRAKE 440


>gi|319783419|ref|YP_004142895.1| hypothetical protein Mesci_3726 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169307|gb|ADV12845.1| protein of unknown function UPF0005 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 238

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 103/252 (40%), Positives = 157/252 (62%), Gaps = 19/252 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N    V +G+  G+  D+GLR +M+RVYN M +GL VTG+++F+++       P      
Sbjct: 5   NLGYRVAAGAQTGAVFDEGLRQHMLRVYNYMGVGLVVTGLVAFMISSTPALYVP------ 58

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                        +++SPL+W+ + APL   +  + ++ ++SA  A+ MF  + A++GLS
Sbjct: 59  -------------IFSSPLKWVVMLAPLAFVMLFSFKMQTMSAANAQAMFWAFCAVMGLS 105

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L+S FLV+T  SI +TFFI A  FG+ SLYGYTTKRDL    SF+IMG  G+ + S+VN+
Sbjct: 106 LASVFLVFTGTSIARTFFIAATMFGATSLYGYTTKRDLTQFSSFLIMGLIGVVIASIVNI 165

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F+ S+A+   +S +G+ +F  LTA+DTQ IKE Y++ +D    ++ +V GA  LY++FI 
Sbjct: 166 FLGSTALQFAISVIGIAVFIGLTAWDTQTIKEQYAENFDAESRQKLAVFGAFSLYLNFIN 225

Query: 246 IFVHLLRFLGSR 257
           IF  LL F G R
Sbjct: 226 IFQLLLNFTGER 237


>gi|91205954|ref|YP_538309.1| integral membrane protein [Rickettsia bellii RML369-C]
 gi|157826685|ref|YP_001495749.1| integral membrane protein [Rickettsia bellii OSU 85-389]
 gi|91069498|gb|ABE05220.1| Integral membrane protein [Rickettsia bellii RML369-C]
 gi|157801989|gb|ABV78712.1| Integral membrane protein [Rickettsia bellii OSU 85-389]
          Length = 237

 Score =  133 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 99/256 (38%), Positives = 155/256 (60%), Gaps = 19/256 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + +Y + + + S    T D+GLR YM++VYN MAL L +TGI +     +    +     
Sbjct: 1   MIDYTKTLTASSSKNKTFDEGLRKYMLKVYNYMALALLLTGIAAVTTISVEPLYN----- 55

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                         LM+ +    + +FAPLG+ ++  +    ++   A+++F +Y+AL G
Sbjct: 56  --------------LMFQTGFGTLIMFAPLGIALYFFMGFGRMNLQTAQILFWVYAALTG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +SL+   LVYT +SI +TFFI A+ FG++SLYGY+T RDL  +GSF  MG  GL + SLV
Sbjct: 102 MSLAYLALVYTGESIARTFFICASVFGAMSLYGYSTNRDLTSMGSFCAMGLIGLIIASLV 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F++SS +    S +G+V+F  L A+DTQKIK  Y    +    ++ S++ A  LY+DF
Sbjct: 162 NMFLKSSGLSFATSLIGIVVFMGLIAWDTQKIKSMYYMAGNDETGQKLSIMAAFTLYLDF 221

Query: 244 IQIFVHLLRFLGSRRD 259
           I +F++L+RFLG+RRD
Sbjct: 222 INLFLYLMRFLGNRRD 237


>gi|110679285|ref|YP_682292.1| hypothetical protein RD1_2002 [Roseobacter denitrificans OCh 114]
 gi|109455401|gb|ABG31606.1| membrane protein, putative [Roseobacter denitrificans OCh 114]
          Length = 245

 Score =  133 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 91/257 (35%), Positives = 152/257 (59%), Gaps = 16/257 (6%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + +   +  +     + ID+GLRA+M +VY  M++G+ +T  +++ V      +      
Sbjct: 1   MADVNTIRTAAGSRAAQIDEGLRAHMNKVYATMSVGMLITFAVAWAVGTAPQLMAVFRDP 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
           + ++  ++              WI +FAPLG+    +  ++ LSA AA++ F  ++ ++G
Sbjct: 61  VTLSPNIL-------------GWIIMFAPLGMVFAFSAMINKLSAAAAQLFFYSFAGVMG 107

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LS+S  F+ +T  SI Q F IT+ +F  LSL+GYTTK+D+   GSF+IMG  GL + S+V
Sbjct: 108 LSISWIFVAFTGMSIAQIFLITSIAFAGLSLWGYTTKKDISGWGSFLIMGVIGLVVASIV 167

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLY 240
           N+F+ S AI   +SA+G++IF+ LTAYDTQ IK  Y   +   D  + ++  ++GAL LY
Sbjct: 168 NIFLGSPAIMFAISALGVLIFAGLTAYDTQNIKNTYLAHAHHGDSEWLQKSGIMGALSLY 227

Query: 241 MDFIQIFVHLLRFLGSR 257
           ++FI +F+ LL   G+R
Sbjct: 228 LNFINMFMMLLSLFGNR 244


>gi|251790116|ref|YP_003004837.1| hypothetical protein Dd1591_2518 [Dickeya zeae Ech1591]
 gi|247538737|gb|ACT07358.1| protein of unknown function UPF0005 [Dickeya zeae Ech1591]
          Length = 236

 Score =  133 bits (333), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 94/254 (37%), Positives = 137/254 (53%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S          GL+ YM +VY  M  GL +T  +S+        +    +S I 
Sbjct: 1   MDRFPRSNGSIVQQASTGLQTYMAQVYGWMTCGLLLTAFVSWYAAHTPAVLQLVFSSKIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G                  +   L+  +H LS   A  +F+LYSAL GL+L
Sbjct: 61  FYGLVIAQLG------------------LVFVLSGMVHRLSGGVATTLFMLYSALTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+VY+ +SI  TF ITA  FG++SLYGY TKRDL  +GS + M   G+ L +LVN +
Sbjct: 103 SSIFIVYSGESIASTFVITAGMFGAMSLYGYVTKRDLTGMGSMLFMALIGILLATLVNFW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++S  + L ++ +G+++F  LTAYDTQK+K    +    D     + S++GAL LY+DFI
Sbjct: 163 LKSEGLQLAITYIGVLVFVGLTAYDTQKLKNIGEELSVDDRDNFRKYSIMGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  GSRR
Sbjct: 223 NLFLMLLRLFGSRR 236


>gi|296284488|ref|ZP_06862486.1| integral membrane protein [Citromicrobium bathyomarinum JL354]
          Length = 263

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 93/245 (37%), Positives = 142/245 (57%), Gaps = 20/245 (8%)

Query: 15  SGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
               +T D GLR YM+ +YN M  G+ +TGI++ L       V   +             
Sbjct: 39  VASRTTFDAGLRKYMLSIYNYMCSGVLLTGIVALLTYQSGLAVTFASG------------ 86

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
                   PL WI   +PL +   ++      S    ++MF  ++ L+GLSLS+ F  YT
Sbjct: 87  --------PLMWIVALSPLAIVFAMSFGAQKFSQGTLQLMFWGFATLMGLSLSTVFFEYT 138

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI  TFF TA +F  LSL+GYTTK+DL   GSF+IMG  G+ +  ++N+F++S+A++L
Sbjct: 139 QGSIAATFFATAGAFAGLSLFGYTTKKDLSGWGSFLIMGVIGILIAMVINIFLQSAALEL 198

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
            +S +G++IF+ LTAYDTQ++K  Y      ++  +  ++GAL LY+DFI +F+ LLRF+
Sbjct: 199 AVSILGVLIFAGLTAYDTQRLKSDYQRLRGTSWEGKSIILGALSLYLDFINMFLFLLRFM 258

Query: 255 GSRRD 259
           G+ RD
Sbjct: 259 GAARD 263


>gi|209883727|ref|YP_002287584.1| integral membrane protein [Oligotropha carboxidovorans OM5]
 gi|209871923|gb|ACI91719.1| integral membrane protein [Oligotropha carboxidovorans OM5]
          Length = 260

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 115/246 (46%), Positives = 164/246 (66%), Gaps = 6/246 (2%)

Query: 5   RNYQRVVN--SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           RNY       +G    + +D GLRAYM+++YN M +GL +TG  +  V + A T D  +A
Sbjct: 3   RNYTSPFGHVAGRADAAAVDAGLRAYMLKIYNYMTIGLAITGFAALGVYMGAVTTDTASA 62

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
              +    MLT FG  M+ SPL+W+FIFAPL +   ++  ++ L    A+M+F  +SAL+
Sbjct: 63  VGRVGN-TMLTSFGVTMFVSPLKWVFIFAPLVMVFAISFGINRLRPATAQMLFWAFSALM 121

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G+SLSS FLVYT  SIV+ FFITAA+FG+LSLYGYTTKRD+  +GSF+IMG FG+ + S+
Sbjct: 122 GISLSSIFLVYTHTSIVRVFFITAAAFGALSLYGYTTKRDMTGMGSFLIMGLFGVIIASI 181

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALML 239
           VNLF+ SS +   +S +G+++F+ LTA+DTQ++K  Y   Y       AER ++ GAL L
Sbjct: 182 VNLFVASSMLQFVVSIVGVLVFAGLTAWDTQRLKNDYIYGYGAMGGDVAERAAITGALSL 241

Query: 240 YMDFIQ 245
           Y++FI 
Sbjct: 242 YLNFIN 247


>gi|159045319|ref|YP_001534113.1| hypothetical protein Dshi_2779 [Dinoroseobacter shibae DFL 12]
 gi|157913079|gb|ABV94512.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 240

 Score =  132 bits (331), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 98/258 (37%), Positives = 159/258 (61%), Gaps = 23/258 (8%)

Query: 4   IRNYQRVVNSGSG-FGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           +  Y  +  +G+G   + ID+GLRA+  +VY LM++ + +TG +++ V            
Sbjct: 1   MAQYDTIRTAGAGVRTAQIDEGLRAHFNKVYGLMSVAMVLTGAVAWAVGTNEA------- 53

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                         A ++ +P++W+ +FAPL +    +  ++ +SA AA++ F  ++A +
Sbjct: 54  ------------MLAAIFATPMKWVVMFAPLIMVFAFSAMINKMSAAAAQVFFYTFAAAM 101

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GLS+S  F VYT  SI  TF +TA +F SLSL+GYTTK+DL   G F+ MG  GL + S+
Sbjct: 102 GLSISFIFAVYTGVSIASTFLVTAIAFASLSLFGYTTKKDLSSWGRFLFMGVIGLIVASI 161

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALML 239
           +NLF+ S AI   +S++G++IF+ALTAYDTQ+IK  Y   +   D  +  + +++GAL L
Sbjct: 162 INLFLGSPAIAFAVSSLGVLIFAALTAYDTQRIKTEYIEHAQYGDQEWLNKSAIMGALSL 221

Query: 240 YMDFIQIFVHLLRFLGSR 257
           Y++FI +F+ LL+FLG+R
Sbjct: 222 YINFINLFMFLLQFLGNR 239


>gi|260574587|ref|ZP_05842590.1| protein of unknown function UPF0005 [Rhodobacter sp. SW2]
 gi|259023004|gb|EEW26297.1| protein of unknown function UPF0005 [Rhodobacter sp. SW2]
          Length = 246

 Score =  132 bits (331), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 100/258 (38%), Positives = 156/258 (60%), Gaps = 17/258 (6%)

Query: 4   IRNYQRVVNSGS-GFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           +  Y  + + G+    + ID GLRA+M +VY LM++G+ +TG +++ V    T +     
Sbjct: 1   MAEYDTIRSVGAGARAAQIDAGLRAHMNKVYGLMSVGMLLTGGVAWAVGTSDTLLSILRN 60

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                           M  + L WI +FAPL +       ++ LS  AA++ F  Y+A++
Sbjct: 61  PE-------------TMQPNLLGWIVMFAPLIMVFAFGALINRLSVAAAQLFFYAYAAVM 107

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GLSL+  F V+T  SI QTF +T+ +F  LSLYGYTTKR+L  +G+F++MG  GL +  +
Sbjct: 108 GLSLAWIFAVFTGVSIAQTFLVTSIAFAGLSLYGYTTKRNLSAMGTFLMMGLIGLLVAMV 167

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR---YDVAYAERQSVIGALML 239
           VN+F+ SSA+   +S +G++IF+ALTAYDTQ IK  Y       D  +  + +++GAL L
Sbjct: 168 VNIFVASSALAFAISVIGVLIFAALTAYDTQTIKNTYLQHAQAGDQEWLGKAAIMGALQL 227

Query: 240 YMDFIQIFVHLLRFLGSR 257
           Y+DFI +F+ LL+F+G+R
Sbjct: 228 YLDFINMFMFLLQFMGNR 245


>gi|298293923|ref|YP_003695862.1| hypothetical protein Snov_3973 [Starkeya novella DSM 506]
 gi|296930434|gb|ADH91243.1| protein of unknown function UPF0005 [Starkeya novella DSM 506]
          Length = 239

 Score =  131 bits (330), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 104/247 (42%), Positives = 155/247 (62%), Gaps = 19/247 (7%)

Query: 11  VNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGV 70
             + +   +  D+GLR +M+RVYN MALGL +TG+++F+V        P           
Sbjct: 11  SRTATVDQAVFDEGLRRHMLRVYNYMALGLVLTGVVAFIVGTTPALYVP----------- 59

Query: 71  MLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFF 130
                   ++++PL+W+ +FAPL   +F + R+ S+S   A+ MF  + A++GLS++S F
Sbjct: 60  --------IFSTPLKWVVMFAPLAFVLFFSFRMQSMSGAGAQTMFWAFCAVMGLSMASIF 111

Query: 131 LVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSS 190
           LV+T  SI +TFFI A  FG+ SLYGYTTKRDL   GSF+IMG  G+ + SLVN+F+ S+
Sbjct: 112 LVFTGTSIARTFFIAATMFGATSLYGYTTKRDLSQFGSFLIMGLIGVVIASLVNIFLGST 171

Query: 191 AIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHL 250
            +   +S +G+++F  LTA+DTQ IKE Y+D +D    ++ +V GA  LY++FI IF  L
Sbjct: 172 MLQFIVSVVGILVFVGLTAWDTQSIKEQYADYFDAESQQKLAVFGAFSLYLNFINIFQLL 231

Query: 251 LRFLGSR 257
           L F G R
Sbjct: 232 LNFTGER 238


>gi|307130568|ref|YP_003882584.1| hypothetical protein Dda3937_03769 [Dickeya dadantii 3937]
 gi|306528097|gb|ADM98027.1| Putative membrane protein [Dickeya dadantii 3937]
          Length = 236

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 93/254 (36%), Positives = 137/254 (53%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S          GL+ YM +VY  M  GL +T  +++        +    +S I 
Sbjct: 1   MDRFPRSNGSIVQQASTGLQTYMAQVYGWMTCGLLLTAFVAWYAANTPAVLQMVFSSKIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G                  +   L+  +H LS   A  +F+LYSAL GL+L
Sbjct: 61  FFGLVIAQLG------------------LVFVLSGMVHRLSGGVATTLFMLYSALTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+VY+ +SI  TF ITA  FG++SLYGY TKRDL  +GS + M   G+ L +LVN +
Sbjct: 103 SSIFIVYSGESIASTFVITAGMFGAMSLYGYVTKRDLTGMGSMLFMALIGILLATLVNFW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++S  + L ++ +G+++F  LTAYDTQK+K    +    D     + S++GAL LY+DFI
Sbjct: 163 LKSEGLQLAITYIGVLVFVGLTAYDTQKLKNIGEELSVDDRDNFRKYSIMGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  GSRR
Sbjct: 223 NLFLMLLRLFGSRR 236


>gi|326402686|ref|YP_004282767.1| hypothetical protein ACMV_05380 [Acidiphilium multivorum AIU301]
 gi|325049547|dbj|BAJ79885.1| hypothetical protein ACMV_05380 [Acidiphilium multivorum AIU301]
          Length = 256

 Score =  131 bits (329), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 101/260 (38%), Positives = 158/260 (60%), Gaps = 12/260 (4%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D+R+Y+    +       +D+GLRAYM+RVYN MA GL +T I+S+ ++           
Sbjct: 6   DMRSYRSATVAAGA--GVLDEGLRAYMLRVYNWMASGLLLTAIVSYAISHTGLINA---- 59

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                  V   G   +   S L +I IFAPL   + ++  ++ LS   A+ +F  +  L+
Sbjct: 60  ---FYPLVATPGGAMIREPSILAYISIFAPLAFMLVMSFGVNKLSTTQAQALFWAFCGLM 116

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G SL++ FLVYT +SI+ TFF+TA +F ++S+YGYTT+ DL   GSF++MG  GL +  +
Sbjct: 117 GASLTNIFLVYTGQSILTTFFVTAGTFAAMSIYGYTTRTDLTKFGSFLVMGVIGLLIAMV 176

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALML 239
           VN+F+ S A+   +SA+G+++F+ L AYDTQ+IK  Y           A ++SV  AL L
Sbjct: 177 VNIFLHSPAMQFAISAIGVLVFTGLAAYDTQRIKADYVQYGYRFGAGMAAKRSVYDALQL 236

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y++FI +F+ LL+F+G+RR+
Sbjct: 237 YLNFINLFLFLLQFMGNRRN 256


>gi|261822197|ref|YP_003260303.1| hypothetical protein Pecwa_2947 [Pectobacterium wasabiae WPP163]
 gi|261606210|gb|ACX88696.1| protein of unknown function UPF0005 [Pectobacterium wasabiae
           WPP163]
          Length = 235

 Score =  131 bits (329), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 94/252 (37%), Positives = 134/252 (53%), Gaps = 20/252 (7%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
                          GL+AYM +VY  M  GL +T  +S+         D   +S +   
Sbjct: 2   DRYPRSGSIVERSQSGLQAYMAQVYGWMGCGLLLTAFVSWYAAHTPAVFDFVFSSRVTFF 61

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
           G+++   G +   S                    +  LS   A  +F+LYSAL GL+LSS
Sbjct: 62  GLIIAQLGLVFVISG------------------MVQRLSGAVATSLFMLYSALTGLTLSS 103

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            F VY+++SI  TF ITA  FG++SLYGYTTKRDL   GS + M   G+ L SLVNL+++
Sbjct: 104 IFAVYSTESIASTFVITAGMFGAMSLYGYTTKRDLSGFGSMLFMALIGIILASLVNLWLK 163

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQI 246
           S A+   ++ +G+V+F  LTAYDTQK+K         D     + +++GAL LY+DFI +
Sbjct: 164 SEALMWAVTYIGVVVFVGLTAYDTQKLKNIGEQLSVDDKDSFRKYAIVGALTLYLDFINL 223

Query: 247 FVHLLRFLGSRR 258
           F+ LLR  G+RR
Sbjct: 224 FLMLLRIFGNRR 235


>gi|149914415|ref|ZP_01902946.1| hypothetical protein RAZWK3B_20481 [Roseobacter sp. AzwK-3b]
 gi|149811934|gb|EDM71767.1| hypothetical protein RAZWK3B_20481 [Roseobacter sp. AzwK-3b]
          Length = 239

 Score =  131 bits (329), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 96/257 (37%), Positives = 151/257 (58%), Gaps = 22/257 (8%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  ++ +  +     + ID GLRA+M +VY  M++G+ +T   ++ V   A   +     
Sbjct: 1   MAQFETIRTAAGARTAQIDAGLRAHMNKVYGTMSVGMLLTFAAAWAVGTNAALFET---- 56

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                          ++T   RWI +FAPL +    +  ++ LSA AA++ F  ++A++G
Sbjct: 57  ---------------LFTGITRWIVMFAPLIMVFAFSAMINKLSAAAAQLFFYTFAAVMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +S+S  F+V+T  SI Q F ITA +F  LSL+GYTTK+D+   GSF+IMG  GL + S+V
Sbjct: 102 VSISYIFVVFTDYSIAQVFLITAVAFAGLSLWGYTTKKDISGWGSFLIMGVIGLVVASIV 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLY 240
           N+F+ S AI   +SA+G++IF+ LTAYDTQ IK  Y   +   D  +  + +++GAL LY
Sbjct: 162 NIFLGSPAIMFAISAIGVLIFAGLTAYDTQDIKNEYLAHAHHGDSEWMGKSAIMGALRLY 221

Query: 241 MDFIQIFVHLLRFLGSR 257
           +DFI +F+ LL   G R
Sbjct: 222 LDFINMFIMLLSLFGQR 238


>gi|148259460|ref|YP_001233587.1| hypothetical protein Acry_0443 [Acidiphilium cryptum JF-5]
 gi|146401141|gb|ABQ29668.1| protein of unknown function UPF0005 [Acidiphilium cryptum JF-5]
          Length = 256

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 100/260 (38%), Positives = 157/260 (60%), Gaps = 12/260 (4%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D+R+Y+    +       +D+GLRAYM+RVYN MA GL +T I+S+ ++           
Sbjct: 6   DMRSYRSATVAAGA--GVLDEGLRAYMLRVYNWMASGLLLTAIVSYAISHTGLINA---- 59

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                  V   G   +     L +I IFAPL   + ++  ++ LS   A+ +F  +  L+
Sbjct: 60  ---FYPLVATPGGAMIREPGILAYISIFAPLAFMLVMSFGVNKLSTTQAQALFWAFCGLM 116

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G SL++ FLVYT +SI+ TFF+TA +F ++S+YGYTT+ DL   GSF++MG  GL +  +
Sbjct: 117 GASLTNIFLVYTGQSILTTFFVTAGTFAAMSIYGYTTRTDLTKFGSFLVMGVIGLLIAMV 176

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALML 239
           VN+F+ S A+   +SA+G+++F+ L AYDTQ+IK  Y           A ++SV  AL L
Sbjct: 177 VNIFLHSPAMQFAISAIGVLVFTGLAAYDTQRIKADYVQYGYRFGAGMAAKRSVYDALQL 236

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y++FI +F+ LL+F+G+RR+
Sbjct: 237 YLNFINLFLFLLQFMGNRRN 256


>gi|281425118|ref|ZP_06256031.1| putative membrane protein [Prevotella oris F0302]
 gi|281400962|gb|EFB31793.1| putative membrane protein [Prevotella oris F0302]
          Length = 289

 Score =  131 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 74/254 (29%), Positives = 127/254 (50%), Gaps = 17/254 (6%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N +            + +   A M +VY  M L L ++GI+++ V      +     + +
Sbjct: 52  NERIREQEYGTNDMVLSEAFPALMRKVYLWMTLALAISGIVAYGVATSPNLLYLIYTNQL 111

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           +  G+++T    +   S   W                  + S  A  +MF  ++AL G +
Sbjct: 112 VFWGLIITELVLVWKISGSIWK----------------ENRSLAATTLMFATFAALNGAT 155

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LS  F+++   +I++TFFIT+ +F   S YGY TK+DL   GSF+ M   GL +  + N+
Sbjct: 156 LSYIFILFAPTAIIKTFFITSGTFAVTSAYGYFTKKDLSKWGSFLFMALGGLIIALVANI 215

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYD-VAYAERQSVIGALMLYMDFI 244
           F +SS +D  +S  G+++F  LT +D+Q IK   +   D    +++ ++ GAL LY+DFI
Sbjct: 216 FFKSSMLDFIISIAGVLLFVGLTIWDSQNIKRQLAVAPDMSETSQKIALCGALDLYLDFI 275

Query: 245 QIFVHLLRFLGSRR 258
            +F++LLR  G   
Sbjct: 276 NLFIYLLRLFGRDN 289


>gi|209542443|ref|YP_002274672.1| hypothetical protein Gdia_0260 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530120|gb|ACI50057.1| protein of unknown function UPF0005 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 259

 Score =  131 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 103/260 (39%), Positives = 159/260 (61%), Gaps = 12/260 (4%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D R   R   +G+  G+ IDQGLRAYM+RVYN MA GL +TG +++LV   +      AA
Sbjct: 6   DFRTMTRPAGAGTDAGA-IDQGLRAYMLRVYNWMASGLVLTGTVAYLVANTSLRAAFFAA 64

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                   ++T  G  +  + L  + + APLG  + +++ ++ LS  A + +F L+ A++
Sbjct: 65  --------VMTPSGVAVRPTGLGMLAMIAPLGFVLVMSLGVNRLSRQAVQALFWLFCAVM 116

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G SLSS  L +T  S+V+ FF+TA +F ++S++GY T+ DL   GSF++MG FGL +  L
Sbjct: 117 GASLSSILLTFTGVSVVRVFFVTAGTFSAMSIWGYVTRTDLTRFGSFLLMGLFGLVIAGL 176

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALML 239
           VN+F+ SSA+ +  S +G+ IF  L A+DTQ+IK  Y   +       A ++SV  AL L
Sbjct: 177 VNMFLHSSALYMLYSVVGVFIFVGLAAFDTQRIKMTYQQFAYYEGPEGAAKRSVYDALTL 236

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y++FI +F  LL+F+G R +
Sbjct: 237 YLNFINLFQFLLQFMGVRSN 256


>gi|317492555|ref|ZP_07950982.1| hypothetical protein HMPREF0864_01746 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919305|gb|EFV40637.1| hypothetical protein HMPREF0864_01746 [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 236

 Score =  131 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 99/254 (38%), Positives = 141/254 (55%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R            + GL+ YM +VY  M  GL +T I+++        ++   +S I 
Sbjct: 1   MDRYPRGNGSIVERANTGLQTYMAQVYGWMTCGLLLTSIVAWYAAHTPAVLNFIFSSKIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G                  +   L+  +H LSA AA  +F+LYSAL GL+L
Sbjct: 61  FFGLVIVQLG------------------LVFVLSGMVHKLSAAAATSLFMLYSALTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           +S F+VYT  SI  TF +TA  FG++SLYGYTTKRDL  IGS M MG  G+ L SLVN++
Sbjct: 103 ASIFIVYTYSSIASTFVVTAGMFGAMSLYGYTTKRDLSGIGSMMFMGLIGIILASLVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++S A+   ++  G++IF  LTAYDTQK+K         D     + S++GAL LY+DFI
Sbjct: 163 LKSPALTWVITYAGVIIFVGLTAYDTQKLKAMGEQLSPDDKDNFRKYSILGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|87199165|ref|YP_496422.1| hypothetical protein Saro_1143 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134846|gb|ABD25588.1| protein of unknown function UPF0005 [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 247

 Score =  131 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 99/244 (40%), Positives = 147/244 (60%), Gaps = 20/244 (8%)

Query: 15  SGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
            G     D GLR +M+ +YN MA G+ ++GI++ L       +                 
Sbjct: 24  QGRSEVFDAGLRRHMLSIYNYMASGVLLSGIVALLFATSGAAL----------------- 66

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
               ++ +PLRW+   APL   + ++  ++ LS +A + MF  +S  +GLSLS+ F +YT
Sbjct: 67  ---AVFGTPLRWVVALAPLAFVMIMSFGVNRLSTFAMQAMFWGFSVAMGLSLSAIFFIYT 123

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
             SI  TFF TA +F  LSL+GYTTK+DL   GSF+IMG FGL + SL+N+F++S  +  
Sbjct: 124 GPSIAVTFFATAGAFAGLSLFGYTTKKDLSGFGSFLIMGVFGLLIASLINMFLQSPGLAW 183

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
            +S +G++IF+ LTAYDTQK+KE Y+      +A +  V+GAL LY+DFI +F  LL+F+
Sbjct: 184 AVSFLGVLIFAGLTAYDTQKLKEQYAYVAGTDFAGKAVVLGALNLYLDFINMFQFLLQFM 243

Query: 255 GSRR 258
           G RR
Sbjct: 244 GDRR 247


>gi|27382433|ref|NP_773962.1| hypothetical protein bll7322 [Bradyrhizobium japonicum USDA 110]
 gi|27355604|dbj|BAC52587.1| bll7322 [Bradyrhizobium japonicum USDA 110]
          Length = 232

 Score =  131 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 110/255 (43%), Positives = 163/255 (63%), Gaps = 23/255 (9%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + NY + +   +     +D GLR YM+R+YN MA G+G+T ++++L   L          
Sbjct: 1   MSNYDQNL--ATSDAIAVDAGLRGYMLRIYNYMAAGVGLTAVVAWLTYQLT--------- 49

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                       G  +  SPL W+FI APL +  F++ R+++LSA  A+++F +Y+AL+G
Sbjct: 50  ------------GPALLQSPLMWVFILAPLALVFFISARINTLSAATARLLFFIYAALVG 97

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +SLS    +YTS SI + FFI AA FG+LS++GYTT+RDL  +G+F+ MG  G+ + SLV
Sbjct: 98  VSLSILLHIYTSASITRVFFIAAAMFGALSVFGYTTRRDLSGLGTFLFMGLIGVIIASLV 157

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           NLF++SS +D  +S +G+ +F+ LTAYDTQ+IK  Y    D   A R+SVI AL LY++F
Sbjct: 158 NLFLQSSGLDWLISVVGVGVFAGLTAYDTQRIKAMYDSGDDETSAGRKSVISALSLYLNF 217

Query: 244 IQIFVHLLRFLGSRR 258
           I +F+ LLR  GSRR
Sbjct: 218 INLFMMLLRLAGSRR 232


>gi|26246758|ref|NP_752798.1| hypothetical protein c0868 [Escherichia coli CFT073]
 gi|26107157|gb|AAN79341.1|AE016757_245 Hypothetical protein ybhL [Escherichia coli CFT073]
          Length = 261

 Score =  130 bits (327), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 92/238 (38%), Positives = 139/238 (58%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++     A  ++    + +   G+++          
Sbjct: 42  AGLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII---------- 91

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 92  --------AQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTF 143

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 144 VVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 203

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 204 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 261


>gi|85707776|ref|ZP_01038842.1| integral membrane protein [Erythrobacter sp. NAP1]
 gi|85689310|gb|EAQ29313.1| integral membrane protein [Erythrobacter sp. NAP1]
          Length = 252

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 99/266 (37%), Positives = 153/266 (57%), Gaps = 24/266 (9%)

Query: 1   MSDIRNYQRVVNS---------GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVN 51
           M+D ++ QR                  ++ D+GLR+YM+ +YN MA G+ +TGI++ L +
Sbjct: 1   MADWKDTQRTTQGFGSVPRAGGDVASRASYDEGLRSYMLSIYNYMASGVLLTGIVAILFS 60

Query: 52  ILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAA 111
                                      M   PL WI   APLG  + ++  LH +S    
Sbjct: 61  WGGNESAVAWLY---------------MNGGPLLWIIKLAPLGFILAMSFGLHKMSQTTL 105

Query: 112 KMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMI 171
           +++F  ++ ++G+S+S+ FLVYT +SI  TFF TAA+F  LSL+GYTTK+DL   GSF+I
Sbjct: 106 QIVFWAFATVMGMSMSTIFLVYTGESIATTFFATAAAFAGLSLFGYTTKKDLSGFGSFLI 165

Query: 172 MGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQ 231
           MG  GL +  +VN F++S A+   +S +G++IF+ LTAYDTQ++K  Y       +  + 
Sbjct: 166 MGVIGLIVAMIVNWFLQSEAMAFVISGLGVLIFAGLTAYDTQRLKNDYQYLRGTEFMGKA 225

Query: 232 SVIGALMLYMDFIQIFVHLLRFLGSR 257
            ++GA  LY+DF+ +F+ LL+FLGSR
Sbjct: 226 VIMGATSLYLDFVNMFMFLLQFLGSR 251


>gi|253687906|ref|YP_003017096.1| hypothetical protein PC1_1517 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754484|gb|ACT12560.1| protein of unknown function UPF0005 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 235

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 95/252 (37%), Positives = 135/252 (53%), Gaps = 20/252 (7%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
                          GL+AYM +VY  M  GL +T  +S+        ++   +S I   
Sbjct: 2   DRYPRSGSIVERSQSGLQAYMAQVYGWMTCGLLLTAFVSWYAANTPAVLNFVFSSQITFF 61

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
           G+++   G +   S                    +  LS   A  +F+LYSAL GL+LSS
Sbjct: 62  GLIIAQLGLVFVISG------------------MVQRLSGAVATSLFMLYSALTGLTLSS 103

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            F VY+++SI  TF ITA  FG++SLYGYTTKRDL   GS + M   G+ L SLVNL+++
Sbjct: 104 IFAVYSTESIASTFVITAGMFGAMSLYGYTTKRDLSGFGSMLFMALIGIVLASLVNLWLK 163

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQI 246
           S A+   ++ +G+V+F  LTAYDTQK+K         D     + S++GAL LY+DFI +
Sbjct: 164 SEALMWAVTYIGVVVFVGLTAYDTQKLKNIGEQLSVDDKDSFRKYSIVGALTLYLDFINL 223

Query: 247 FVHLLRFLGSRR 258
           F+ LLR  G+RR
Sbjct: 224 FLMLLRIFGNRR 235


>gi|253990405|ref|YP_003041761.1| inner membrane protein ybhl [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781855|emb|CAQ85018.1| inner membrane protein ybhl [Photorhabdus asymbiotica]
          Length = 236

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 99/254 (38%), Positives = 144/254 (56%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S          GL+AYM +VY  M  GL +T  +++ V+     V    ++ I+
Sbjct: 1   MDRYPRSNGSIIQQAGTGLQAYMAQVYGWMTCGLLLTAFVAWYVSQNQAVVLYIFSNSIL 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++  FG                  +   L+  ++ + A  A  +F+LYSAL GL+L
Sbjct: 61  FYGLIIAQFG------------------LVFVLSGMINRMGASLATGLFMLYSALTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+VYT+ SI  TF +TA  FG+LS YGYTTKR L  +GSF+ MG  G+ L SL+N +
Sbjct: 103 SSIFVVYTTGSIASTFVVTAGMFGALSFYGYTTKRSLSGLGSFLFMGLSGIILASLINFW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFI 244
           ++S A+   ++ +G+VIF+ LTAYDTQK+KE   D    D     + S++GAL LY+DFI
Sbjct: 163 LKSEALMWAVTYIGVVIFAGLTAYDTQKLKEMGEDLDVNDKENLRKFSIVGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G RR
Sbjct: 223 NMFLMLLRIFGDRR 236


>gi|73974854|ref|XP_532348.2| PREDICTED: similar to glutamate receptor, ionotropic, N-methyl
           D-asparate-associated protein 1 [Canis familiaris]
          Length = 492

 Score =  129 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 36/239 (15%), Positives = 95/239 (39%), Gaps = 22/239 (9%)

Query: 22  DQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           D+ +R A++ +V+ ++ L L VT     +   +         ++          F +L+ 
Sbjct: 275 DKSIRQAFIRKVFLVLTLQLSVTLSTVAVFTFVGEVKGFVRENVWTYYVSYAVFFISLIV 334

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S                              +   + +  +   +      Y +++++ 
Sbjct: 335 LSC-----------------CGDFRRKHPWNLVALSILTVSLSYMVGMIASFYNTEAVIM 377

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              IT     ++ ++   T+ D       +++    L + +++ +F+R+  +++  +++G
Sbjct: 378 AVGITTTVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLVIFAILCIFIRNRILEIVYASLG 437

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++F+   A DTQ +         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 438 ALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 492


>gi|163733428|ref|ZP_02140871.1| hypothetical protein RLO149_17293 [Roseobacter litoralis Och 149]
 gi|161393216|gb|EDQ17542.1| hypothetical protein RLO149_17293 [Roseobacter litoralis Och 149]
          Length = 245

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 90/257 (35%), Positives = 151/257 (58%), Gaps = 16/257 (6%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + +   +  +     + ID GLRA+M +VY  M++G+ +T  +++ V      +      
Sbjct: 1   MADVNTIRTAAGSRAAQIDAGLRAHMNKVYATMSIGMLITFAVAWAVGTAPQLMAVFRDP 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
           + ++  ++              WI +FAPLG+    +  ++ +SA AA++ F  ++ ++G
Sbjct: 61  VTLSPNIL-------------GWIIMFAPLGMVFAFSAMINKMSAAAAQLFFYAFAGVMG 107

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LS+S  F+ +T  SI Q F IT+ +F  LSL+GYTTK+D+   GSF+IMG  GL + S+V
Sbjct: 108 LSISWIFVAFTGMSIAQIFLITSIAFAGLSLWGYTTKKDISAWGSFLIMGVIGLVVASIV 167

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLY 240
           N+F+ S AI   +SA+G++IF+ LTAYDTQ IK  Y   +   D  + ++  ++GAL LY
Sbjct: 168 NIFLGSPAIMFAISALGVLIFAGLTAYDTQNIKNTYLAHAHHGDSEWLQKSGIMGALSLY 227

Query: 241 MDFIQIFVHLLRFLGSR 257
           ++FI +F+ LL   G+R
Sbjct: 228 LNFINMFMMLLSLFGNR 244


>gi|307295118|ref|ZP_07574960.1| protein of unknown function UPF0005 [Sphingobium chlorophenolicum
           L-1]
 gi|306879592|gb|EFN10810.1| protein of unknown function UPF0005 [Sphingobium chlorophenolicum
           L-1]
          Length = 269

 Score =  129 bits (324), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 93/254 (36%), Positives = 148/254 (58%), Gaps = 19/254 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + N  R+   G+   +  D GLRA+M+ V+  M +GL +TG+++  +             
Sbjct: 34  VNNPVRMPGYGASQTAQTDAGLRAHMLGVFRNMGIGLVITGLVAAFIGNTPV-------- 85

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                        A ++ +PL+W+ IFAPL    F + R+  ++   A+M F  +SA++G
Sbjct: 86  -----------LAAAIFGTPLKWVAIFAPLAFVFFFSFRMEKMTTAGARMAFYAFSAVMG 134

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +SL+S FLV+T  SI Q FF  A  F +++L+GYTT RDL   GSF+IMG  G+ + SL+
Sbjct: 135 VSLASIFLVFTGGSIAQAFFSAAVMFLAMALWGYTTGRDLSKFGSFLIMGLIGILVASLI 194

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F+ SSA+ + +S +G+V+F+ LTA+D Q+IK  Y        A++  V+GAL LY++F
Sbjct: 195 NIFIGSSAMQMVISIIGVVVFTGLTAWDVQRIKSEYFYYAGHEVAQKMQVMGALSLYLNF 254

Query: 244 IQIFVHLLRFLGSR 257
           + +F  LL   G R
Sbjct: 255 VNLFQMLLSLTGER 268


>gi|85373196|ref|YP_457258.1| integral membrane protein [Erythrobacter litoralis HTCC2594]
 gi|84786279|gb|ABC62461.1| integral membrane protein [Erythrobacter litoralis HTCC2594]
          Length = 248

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 96/268 (35%), Positives = 149/268 (55%), Gaps = 29/268 (10%)

Query: 1   MSDIRNYQRVVNS---------GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVN 51
           M+D  + ++                  +T D GLR YM+ +YN MA G+ +TGI++ L  
Sbjct: 1   MADWNDPRQAQQGFGSVPRAGGDVASRTTFDAGLRKYMLSIYNYMASGILLTGIIAMLTA 60

Query: 52  ILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAA 111
                    +                     P+ WI   +PL +   ++  ++  S    
Sbjct: 61  NSGLAYSFASG--------------------PMMWIVALSPLAIVFAMSFGMNKFSKGTL 100

Query: 112 KMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMI 171
           + M+  ++ L+GLSLS+ FLVYT  SI  TFF TA +F  LSL+GYTT++DL   GSF+I
Sbjct: 101 QAMYWGFAVLMGLSLSTIFLVYTGASIAVTFFATAGAFAGLSLFGYTTQKDLSGWGSFLI 160

Query: 172 MGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQ 231
           MG  GL + S++N+F++S A+   +S +G++IF+ LTAYDTQK+K  YS        ++ 
Sbjct: 161 MGVVGLIIASVINIFLQSEALMWAVSFLGVLIFAGLTAYDTQKLKNIYSSVRGTPMMDKV 220

Query: 232 SVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++GAL LY+DFI +F+ LLRF+G+ R+
Sbjct: 221 VIMGALNLYLDFINMFLFLLRFMGATRE 248


>gi|50121736|ref|YP_050903.1| hypothetical protein ECA2812 [Pectobacterium atrosepticum SCRI1043]
 gi|227326984|ref|ZP_03831008.1| hypothetical protein PcarcW_06554 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
 gi|49612262|emb|CAG75712.1| putative membrane protein [Pectobacterium atrosepticum SCRI1043]
          Length = 235

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 94/252 (37%), Positives = 135/252 (53%), Gaps = 20/252 (7%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
                          GL+AYM +VY  M  GL +T  +S+        ++   +S I   
Sbjct: 2   DRYPRSGSIVERSQSGLQAYMAQVYGWMTCGLLLTAFVSWYAANTPAVLNFVFSSQITFF 61

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
           G+++   G +   S                    +  LS   A  +F+LYSAL GL+LSS
Sbjct: 62  GLIIAQLGLVFVISG------------------MVQRLSGTVATSLFMLYSALTGLTLSS 103

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            F++Y+ +SI  TF ITA  FG++SLYGYTTKRDL   GS + M   G+ L SLVNL+++
Sbjct: 104 IFIMYSGESIASTFVITAGMFGAMSLYGYTTKRDLSGFGSMLFMALIGIVLASLVNLWLK 163

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQI 246
           S A+   ++ +G+V+F  LTAYDTQK+K         D     + S++GAL LY+DFI +
Sbjct: 164 SEALMWAVTYIGVVVFVGLTAYDTQKLKNIGEQLSVDDKDSFRKYSIVGALTLYLDFINL 223

Query: 247 FVHLLRFLGSRR 258
           F+ LLR  G+RR
Sbjct: 224 FLMLLRIFGNRR 235


>gi|227113008|ref|ZP_03826664.1| hypothetical protein PcarbP_08603 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 235

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 94/252 (37%), Positives = 135/252 (53%), Gaps = 20/252 (7%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
                          GL+AYM +VY  M  GL +T  +S+        ++   +S I   
Sbjct: 2   DRYPRSGSIVERSQSGLQAYMAQVYGWMTCGLLLTAFVSWYAANTPAVLNFVFSSQITFF 61

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
           G+++   G +   S                    +  LS   A  +F+LYSAL GL+LSS
Sbjct: 62  GLIIAQLGLVFVISG------------------MVQRLSGAVATSLFMLYSALTGLTLSS 103

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            F++Y+ +SI  TF ITA  FG++SLYGYTTKRDL   GS + M   G+ L SLVNL+++
Sbjct: 104 IFIMYSGESIASTFVITAGMFGAMSLYGYTTKRDLSGFGSMLFMALIGIVLASLVNLWLK 163

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQI 246
           S A+   ++ +G+V+F  LTAYDTQK+K         D     + S++GAL LY+DFI +
Sbjct: 164 SEALMWAVTYIGVVVFVGLTAYDTQKLKNIGEQLSVDDKDSFRKYSIVGALTLYLDFINL 223

Query: 247 FVHLLRFLGSRR 258
           F+ LLR  G+RR
Sbjct: 224 FLMLLRIFGNRR 235


>gi|22126895|ref|NP_670318.1| hypothetical protein y3018 [Yersinia pestis KIM 10]
 gi|45440831|ref|NP_992370.1| hypothetical protein YP_0996 [Yersinia pestis biovar Microtus str.
           91001]
 gi|108812998|ref|YP_648765.1| membrane protein [Yersinia pestis Nepal516]
 gi|145599803|ref|YP_001163879.1| membrane protein [Yersinia pestis Pestoides F]
 gi|149366841|ref|ZP_01888875.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|162419433|ref|YP_001605957.1| hypothetical protein YpAngola_A1438 [Yersinia pestis Angola]
 gi|165924546|ref|ZP_02220378.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165938360|ref|ZP_02226918.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166011618|ref|ZP_02232516.1| putative membrane protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166211762|ref|ZP_02237797.1| putative membrane protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167400327|ref|ZP_02305840.1| putative membrane protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419426|ref|ZP_02311179.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167424262|ref|ZP_02316015.1| putative membrane protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|218928327|ref|YP_002346202.1| hypothetical protein YPO1163 [Yersinia pestis CO92]
 gi|229841103|ref|ZP_04461262.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229843207|ref|ZP_04463353.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229894044|ref|ZP_04509230.1| putative membrane protein [Yersinia pestis Pestoides A]
 gi|229903435|ref|ZP_04518548.1| putative membrane protein [Yersinia pestis Nepal516]
 gi|270487210|ref|ZP_06204284.1| inner membrane family protein [Yersinia pestis KIM D27]
 gi|294503163|ref|YP_003567225.1| hypothetical protein YPZ3_1053 [Yersinia pestis Z176003]
 gi|21959931|gb|AAM86569.1|AE013903_6 hypothetical protein y3018 [Yersinia pestis KIM 10]
 gi|45435689|gb|AAS61247.1| putative membrane protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|108776646|gb|ABG19165.1| membrane protein [Yersinia pestis Nepal516]
 gi|115346938|emb|CAL19827.1| putative membrane protein [Yersinia pestis CO92]
 gi|145211499|gb|ABP40906.1| membrane protein [Yersinia pestis Pestoides F]
 gi|149291215|gb|EDM41290.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|162352248|gb|ABX86196.1| putative membrane protein [Yersinia pestis Angola]
 gi|165913738|gb|EDR32357.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165923606|gb|EDR40738.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989566|gb|EDR41867.1| putative membrane protein [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207533|gb|EDR52013.1| putative membrane protein [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962167|gb|EDR58188.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167050276|gb|EDR61684.1| putative membrane protein [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167057111|gb|EDR66874.1| putative membrane protein [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229679205|gb|EEO75308.1| putative membrane protein [Yersinia pestis Nepal516]
 gi|229689554|gb|EEO81615.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229697469|gb|EEO87516.1| putative membrane protein [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229703929|gb|EEO90942.1| putative membrane protein [Yersinia pestis Pestoides A]
 gi|262361200|gb|ACY57921.1| hypothetical protein YPD4_1012 [Yersinia pestis D106004]
 gi|262365243|gb|ACY61800.1| hypothetical protein YPD8_1115 [Yersinia pestis D182038]
 gi|270335714|gb|EFA46491.1| inner membrane family protein [Yersinia pestis KIM D27]
 gi|294353622|gb|ADE63963.1| hypothetical protein YPZ3_1053 [Yersinia pestis Z176003]
 gi|320014303|gb|ADV97874.1| putative membrane protein [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 236

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 91/254 (35%), Positives = 140/254 (55%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S          G++AYM +VY  M  GL +T ++++      + +    ++ I+
Sbjct: 1   MDRYPRSNGSIVERAGSGIQAYMAQVYGWMTCGLLLTAVVAWYAANTPSIIFALQSNQIL 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G +   S                    ++ LS  AA  +F+LYSAL GL+L
Sbjct: 61  FFGLIIAQLGLVFVISG------------------MVNRLSGTAATSLFMLYSALTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS  ++YT  SI  TF I A  FG++S YGYTTKRDL  +GS + MG  G+ L SLVN++
Sbjct: 103 SSILIMYTGASIASTFVICAGMFGAMSFYGYTTKRDLSGMGSMLFMGLIGIILASLVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFI 244
           ++S A+   ++ +G+++F  LTAYDTQK+K   +     D     + S++GAL LY+DFI
Sbjct: 163 LKSPALMWVVTYIGVLVFVGLTAYDTQKLKNLGAQLDVNDKDSFRKYSIVGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|51595538|ref|YP_069729.1| stationary phase anti-death family (SAD), acetate uptake [Yersinia
           pseudotuberculosis IP 32953]
 gi|153947670|ref|YP_001401795.1| hypothetical protein YpsIP31758_2832 [Yersinia pseudotuberculosis
           IP 31758]
 gi|170025140|ref|YP_001721645.1| hypothetical protein YPK_2918 [Yersinia pseudotuberculosis YPIII]
 gi|186894594|ref|YP_001871706.1| hypothetical protein YPTS_1274 [Yersinia pseudotuberculosis PB1/+]
 gi|51588820|emb|CAH20434.1| Stationary phase anti-death Family (SAD), acetate uptake [Yersinia
           pseudotuberculosis IP 32953]
 gi|152959165|gb|ABS46626.1| putative membrane protein [Yersinia pseudotuberculosis IP 31758]
 gi|169751674|gb|ACA69192.1| protein of unknown function UPF0005 [Yersinia pseudotuberculosis
           YPIII]
 gi|186697620|gb|ACC88249.1| protein of unknown function UPF0005 [Yersinia pseudotuberculosis
           PB1/+]
          Length = 236

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 91/254 (35%), Positives = 140/254 (55%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S          G++AYM +VY  M  GL +T ++++      + +    ++ I+
Sbjct: 1   MDRYPRSNGSIVERAGSGIQAYMAQVYGWMTCGLLLTAVVAWYAANTPSIIFALQSNQIL 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G +   S                    ++ LS  AA  +F+LYSAL GL+L
Sbjct: 61  FFGLIIAQLGLVFVISG------------------MVNRLSGTAATSLFMLYSALTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS  ++YT  SI  TF I A  FG++S YGYTTKRDL  +GS + MG  G+ L SLVN++
Sbjct: 103 SSILIMYTGASIASTFVICAGMFGAMSFYGYTTKRDLSGMGSMLFMGLIGIILASLVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFI 244
           ++S A+   ++ +G+++F  LTAYDTQK+K   +     D     + S++GAL LY+DFI
Sbjct: 163 LKSPALMWAVTYIGVLVFVGLTAYDTQKLKNLGAQLDVNDKDSFRKYSIVGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|293414066|ref|ZP_06656715.1| ybhL protein [Escherichia coli B185]
 gi|293433047|ref|ZP_06661475.1| ybhL protein [Escherichia coli B088]
 gi|331651789|ref|ZP_08352808.1| inner membrane protein YbhL [Escherichia coli M718]
 gi|331672297|ref|ZP_08373088.1| inner membrane protein YbhL [Escherichia coli TA280]
 gi|254966706|gb|ACT97342.1| putative amikacin resistance protein [mixed culture bacterium
           AM_gF1DD01_12]
 gi|291323866|gb|EFE63288.1| ybhL protein [Escherichia coli B088]
 gi|291434124|gb|EFF07097.1| ybhL protein [Escherichia coli B185]
 gi|323379419|gb|ADX51687.1| protein of unknown function UPF0005 [Escherichia coli KO11]
 gi|331050067|gb|EGI22125.1| inner membrane protein YbhL [Escherichia coli M718]
 gi|331070492|gb|EGI41856.1| inner membrane protein YbhL [Escherichia coli TA280]
          Length = 261

 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 92/238 (38%), Positives = 139/238 (58%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++     A  ++    + +   G+++          
Sbjct: 42  AGLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII---------- 91

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 92  --------AQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTF 143

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 144 VVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 203

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 204 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 261


>gi|290474032|ref|YP_003466906.1| putative transport protein [Xenorhabdus bovienii SS-2004]
 gi|289173339|emb|CBJ80116.1| putative transport protein [Xenorhabdus bovienii SS-2004]
          Length = 236

 Score =  129 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 98/254 (38%), Positives = 145/254 (57%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S          G++ YM +VY  M  GL +T  ++  V      ++   +S I+
Sbjct: 1   MDRYQRSSGSIVQKAGSGVQTYMAQVYGWMTCGLLLTAFVAGYVANSPEILNAIFSSSIV 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++                  A L +   L+  +H +S   A  +F+LYS L GL+L
Sbjct: 61  FYGLII------------------AQLALVFVLSGLVHKMSGALATGLFMLYSMLTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+VYTS SI  TF I+AA FG+LS+YGYTTKR L  +GSF+ MG  G+ L SL+N++
Sbjct: 103 SSIFVVYTSGSIASTFVISAAMFGALSVYGYTTKRSLSGLGSFLFMGLIGIVLASLINIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFI 244
           ++S A+   ++ +G+++F+ LTAYDTQK+KE  ++    D     R S+ GAL LY+DFI
Sbjct: 163 LKSPALMWAITYIGVLVFAGLTAYDTQKLKEMGAELDVNDKENLRRYSITGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR LG RR
Sbjct: 223 NLFLMLLRILGDRR 236


>gi|37525454|ref|NP_928798.1| hypothetical protein plu1503 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36784882|emb|CAE13796.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 236

 Score =  129 bits (323), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 97/254 (38%), Positives = 143/254 (56%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S          GL+ YM +VY  M  GL +T  +++ V+     V    ++ I+
Sbjct: 1   MDRYPRSNGSIIQQAGTGLQTYMAQVYGWMTCGLLLTAFVAWYVSQNQNVVLYIFSNSIL 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++  FG                  +   L+  ++ + A  A  +F+LYSAL GL+L
Sbjct: 61  FYGLIIAQFG------------------LVFVLSGMINRIGASLATGLFMLYSALTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F++YT  S+  TF +TA  FG+LS YGYTTKR L  +GSF+ MG  G+ L SL+NL+
Sbjct: 103 SSIFVIYTIGSVASTFVVTAGMFGALSFYGYTTKRSLSGLGSFLFMGLIGIILASLINLW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFI 244
           ++S A+   ++ +G+VIF+ LTAYDTQK+KE   D    D     + S++GAL LY+DFI
Sbjct: 163 LKSEALTWAVTYIGVVIFAGLTAYDTQKLKEMGEDLDVNDKENLRKFSIVGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G RR
Sbjct: 223 NMFLMLLRIFGDRR 236


>gi|330993472|ref|ZP_08317407.1| hypothetical protein SXCC_03371 [Gluconacetobacter sp. SXCC-1]
 gi|329759502|gb|EGG76011.1| hypothetical protein SXCC_03371 [Gluconacetobacter sp. SXCC-1]
          Length = 259

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 91/253 (35%), Positives = 152/253 (60%), Gaps = 10/253 (3%)

Query: 10  VVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRG 69
           +  + +    ++D GLRAYM+RVYN MA GL +TG++++L+              +  + 
Sbjct: 11  IRPTANSAVDSVDMGLRAYMLRVYNWMASGLVLTGLVAYLIANTGL-------QALFYQH 63

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
           V L   G  +  + L  + + APLG  + ++  ++ LS    + +F L+  ++G S+S+ 
Sbjct: 64  VPLPMGGVALRPTALSMLAMIAPLGFVLVMSFGVNRLSTQTVQTLFWLFCGVMGASMSNI 123

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
           F+V+T  S+ + FFITAA+F ++S++GYTT+ DL   GSF++MG FGL +  LVN+F+ S
Sbjct: 124 FMVFTGVSVTRVFFITAATFCTMSIWGYTTRTDLSRFGSFLMMGLFGLVIAGLVNMFLHS 183

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQI 246
             +    SA+G+++F  LT +DTQ+IK  Y   +       A ++SV  AL LY++FI +
Sbjct: 184 PGLYFVYSAVGVLLFVGLTMFDTQRIKATYQQFAYYEGADQAAKRSVYDALNLYLNFINL 243

Query: 247 FVHLLRFLGSRRD 259
           F  LL+F+G R +
Sbjct: 244 FQFLLQFMGVRSN 256


>gi|94495839|ref|ZP_01302418.1| Predicted integral membrane protein [Sphingomonas sp. SKA58]
 gi|94424531|gb|EAT09553.1| Predicted integral membrane protein [Sphingomonas sp. SKA58]
          Length = 236

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 96/254 (37%), Positives = 148/254 (58%), Gaps = 19/254 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + N  R+   G+      D GLRA+M+ V+  M LGL +TG+++ LV             
Sbjct: 1   MNNPVRMPGYGASRSVDTDAGLRAHMLGVFRNMGLGLVITGLVAALVGNTPA-------- 52

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                        A +Y +PL+W+ IFAPL    F + R+  ++   A+  F  ++A++G
Sbjct: 53  -----------LAAAIYGTPLKWVAIFAPLAFVFFFSFRIEKMTTAGARTAFYAFAAVMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +SL S FLV+T  SI Q FF  A  F +++L+GYTT+RDL  +GSF+IMG  G+ + SL+
Sbjct: 102 VSLGSVFLVFTGGSIAQAFFSAAVMFLAMALWGYTTQRDLTKMGSFLIMGLIGIIVASLI 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           NLF+ SSA+ + +S +G+V+F+ LTA+D Q+IK  Y        A++  V+GAL LY++F
Sbjct: 162 NLFIGSSAMAMVISIIGVVVFTGLTAWDVQRIKSEYFYYAGHEVAQKMQVMGALSLYLNF 221

Query: 244 IQIFVHLLRFLGSR 257
           + +F  LL   G R
Sbjct: 222 VNLFQMLLSLTGER 235


>gi|296115133|ref|ZP_06833774.1| hypothetical protein GXY_05111 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978234|gb|EFG84971.1| hypothetical protein GXY_05111 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 259

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 97/253 (38%), Positives = 155/253 (61%), Gaps = 10/253 (3%)

Query: 10  VVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRG 69
              + +G  S+ID GLRAYM+RVYN M  GL +TG++++L+   A           +   
Sbjct: 11  ARPTANGAASSIDMGLRAYMLRVYNWMTSGLVLTGLVAYLIAHNAALQT-------LFYQ 63

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
           V+ T  G  +  + L  + + APLG  + ++  ++ LS  A + +F L+  ++G SL++ 
Sbjct: 64  VVETPAGNAVRPTGLGMLAMIAPLGFVLVMSFGVNRLSLQAVQGLFWLFCGVMGCSLANI 123

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
           FLV+T  SI + FFITAA+F ++S++GYTT+ DL   GSF++MG FGL +  LVN+F+ S
Sbjct: 124 FLVFTGVSITRVFFITAATFATMSIWGYTTRSDLTRFGSFLMMGLFGLVIAGLVNMFLHS 183

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
            A+    S +G+++F  LT +DTQ+IK   + Y+       A R+SV  AL LY++FI +
Sbjct: 184 PAVYFLYSVVGVLLFVGLTMFDTQRIKFTYQQYAAYEGPEMAARRSVYDALALYLNFINL 243

Query: 247 FVHLLRFLGSRRD 259
           F  +L+F+G R +
Sbjct: 244 FQFMLQFMGVRSN 256


>gi|304392622|ref|ZP_07374562.1| inner membrane protein YbhL [Ahrensia sp. R2A130]
 gi|303295252|gb|EFL89612.1| inner membrane protein YbhL [Ahrensia sp. R2A130]
          Length = 249

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 103/263 (39%), Positives = 160/263 (60%), Gaps = 21/263 (7%)

Query: 1   MSDIRNYQRVVN-----SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILAT 55
           M+D R   R          +G     D+GLR+YM+ +YN MA  L VTG+ +  +   A 
Sbjct: 1   MADYREEYRTRTMPGAAPAAGTDVQYDEGLRSYMLGIYNYMATALAVTGLSAIGLATWAQ 60

Query: 56  TVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMF 115
           +    A                 +Y SPL+W+ + APL   + ++  ++ LS  AA  +F
Sbjct: 61  SNPAVA---------------NAVYNSPLKWVLMLAPLAFVLVISFGINKLSKTAAMGVF 105

Query: 116 LLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAF 175
             ++A++G S+S  F+VY+  SI QTFF+T+A+F  LSLYGYTTKR L  +GSF++MG  
Sbjct: 106 YAFAAVMGASISWIFMVYSLGSITQTFFVTSAAFAGLSLYGYTTKRVLSGMGSFLMMGLI 165

Query: 176 GLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY-SDRYDVAYAERQSVI 234
           GL L  +VN+F++SSA+   +SA+G++IF+ LTAYDTQ++K  Y S  ++     + S++
Sbjct: 166 GLILAMVVNIFLQSSALGFAISAIGVLIFAGLTAYDTQRLKHMYDSVAHNGEMMAKASIM 225

Query: 235 GALMLYMDFIQIFVHLLRFLGSR 257
           GAL LY++F+ +F+ LL F+G+R
Sbjct: 226 GALSLYLNFVNMFMFLLSFMGNR 248


>gi|94497519|ref|ZP_01304088.1| hypothetical protein SKA58_08389 [Sphingomonas sp. SKA58]
 gi|94422936|gb|EAT07968.1| hypothetical protein SKA58_08389 [Sphingomonas sp. SKA58]
          Length = 248

 Score =  128 bits (322), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 109/248 (43%), Positives = 152/248 (61%), Gaps = 18/248 (7%)

Query: 12  NSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVM 71
           N+ +  G   D GLR YM+ VYN MA G+ +TGI++ L           A   I+   +M
Sbjct: 19  NATAARGEAFDAGLRRYMLSVYNYMASGVLLTGIVALLFASSGLAYQVLAGPGILKYIIM 78

Query: 72  LTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFL 131
                              APL   + L+  ++ LS   A+ ++ +Y+A++GLSLSS FL
Sbjct: 79  F------------------APLAFVMVLSFGINRLSTATAQALYWVYAAVMGLSLSSIFL 120

Query: 132 VYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSA 191
           VYT  SI QTFF TAA+F  LSL+GYTTK+DL   G+F+IMG  GL + SL+NLF+RSSA
Sbjct: 121 VYTGTSIAQTFFATAAAFAGLSLWGYTTKKDLSGFGTFLIMGVVGLLVASLINLFLRSSA 180

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLL 251
           +DL +S +G+++F+ LTAYDTQKIK  Y+         +  ++GAL LY+DFI +F+ LL
Sbjct: 181 MDLVISFLGVLLFAGLTAYDTQKIKSIYAHVAGTDMMGKSVIMGALNLYLDFINMFLFLL 240

Query: 252 RFLGSRRD 259
           RF+G  RD
Sbjct: 241 RFMGGSRD 248


>gi|238799252|ref|ZP_04642698.1| Inner membrane protein YbhL [Yersinia mollaretii ATCC 43969]
 gi|238716886|gb|EEQ08756.1| Inner membrane protein YbhL [Yersinia mollaretii ATCC 43969]
          Length = 236

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 91/254 (35%), Positives = 141/254 (55%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S        + G++AYM +VY  M  GL +T ++++      + V    ++ I+
Sbjct: 1   MDRYPRSNGSIVERANTGIQAYMAQVYGWMTCGLLLTAVVAWYAANTPSIVIALQSNQIL 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G +   S                    ++ LS  AA  +F+LYSAL GL+L
Sbjct: 61  FFGLIIAQLGLVFVISG------------------MINRLSGTAATSLFMLYSALTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS  ++YT  SI  TF I A  FG++S YGYTTKRDL  +GS + MG  G+ L S+VN++
Sbjct: 103 SSILMMYTGASIASTFIICAGMFGAMSFYGYTTKRDLSGMGSMLFMGLIGIVLASIVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++S A+   ++ +G+++F  LTAYDTQK+K   +     D     + S++GAL LY+DFI
Sbjct: 163 LKSPALMWAVTYIGVLVFVGLTAYDTQKLKNMGAQLDANDKDSFRKYSIVGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|300722427|ref|YP_003711715.1| putative transport protein [Xenorhabdus nematophila ATCC 19061]
 gi|297628932|emb|CBJ89515.1| putative transport protein [Xenorhabdus nematophila ATCC 19061]
          Length = 236

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 93/254 (36%), Positives = 139/254 (54%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S          G++ YM +VY  M  GL +T  +++ V                
Sbjct: 1   MDRYQRSNGSIVQKTGSGIQTYMAQVYGWMTCGLLLTAFVAWYVANTPEI---------- 50

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                      +  +S + +  I A L +   L+  +H +S   A  +F+LYS L GL+L
Sbjct: 51  --------LSVIFSSSMVFYGLIIAQLALVFVLSGLVHKMSGALATSLFMLYSLLTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+ YTS SI  TF ++A  FG+LS+YGY+TKR L  +GSF+ MG  G+ L SL+N++
Sbjct: 103 SSIFVAYTSSSIASTFVVSAGMFGALSVYGYSTKRSLSGMGSFLFMGLIGIVLASLINIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFI 244
           ++S A+   ++ +G+++F+ LTAYDTQK+KE   +    D     R S+ GAL LY+DFI
Sbjct: 163 LKSPALMWAITYIGVLVFAGLTAYDTQKLKEMGEELDVNDKENMRRYSITGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR LG RR
Sbjct: 223 NLFLMLLRILGDRR 236


>gi|241761686|ref|ZP_04759773.1| protein of unknown function UPF0005 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260752250|ref|YP_003225143.1| hypothetical protein Za10_0005 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|283856454|ref|YP_163087.2| hypothetical protein ZMO1352 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373994|gb|EER63527.1| protein of unknown function UPF0005 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258551613|gb|ACV74559.1| protein of unknown function UPF0005 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|283775458|gb|AAV89976.2| protein of unknown function UPF0005 [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 242

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 110/262 (41%), Positives = 156/262 (59%), Gaps = 24/262 (9%)

Query: 1   MSDIRNYQRVVNSGSGF----GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATT 56
           M++  + +  V   +       S  D GLR+YM+ VYN MA G+ +TGI+++LV   A  
Sbjct: 1   MANWNDSRMTVTESAARGRNGASERDAGLRSYMLSVYNYMAGGVLLTGIVAYLVAHSA-- 58

Query: 57  VDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFL 116
                              GA +  SPLRW+ I APL     L+  ++       K +F 
Sbjct: 59  ------------------LGAAIIFSPLRWLVILAPLAFVFALSAGVNRFKLSTLKTLFW 100

Query: 117 LYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFG 176
            Y+A++GLS++  F VYT  SI QTFF TAA+F  LS++GY TK+DL  IGSF+IM  FG
Sbjct: 101 SYAAVMGLSMAVIFFVYTGTSIAQTFFATAAAFAGLSVFGYLTKKDLSGIGSFLIMAVFG 160

Query: 177 LFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGA 236
           L + SL+N+F+ SS++   +SA+G++IF+ LTAYDTQ+IK  Y       YA + +V+GA
Sbjct: 161 LIVASLLNMFIHSSSLQFGISALGVLIFAGLTAYDTQQIKSMYFMTSGGEYAGKMAVMGA 220

Query: 237 LMLYMDFIQIFVHLLRFLGSRR 258
           L LY+DFI +F  LL F+G RR
Sbjct: 221 LSLYLDFINMFSFLLNFMGDRR 242


>gi|194433176|ref|ZP_03065458.1| putative membrane protein [Shigella dysenteriae 1012]
 gi|194418673|gb|EDX34760.1| putative membrane protein [Shigella dysenteriae 1012]
          Length = 261

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 91/238 (38%), Positives = 138/238 (57%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++     A  ++    + +   G+++          
Sbjct: 42  AGLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII---------- 91

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + I L+  +  LSA    M+F+LYS L GL+LSS F+VYT+ SI  TF
Sbjct: 92  --------AQLALVIVLSAMIQKLSAGVTTMLFMLYSVLTGLTLSSIFIVYTAASIASTF 143

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 144 VVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 203

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 204 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 261


>gi|148553772|ref|YP_001261354.1| hypothetical protein Swit_0849 [Sphingomonas wittichii RW1]
 gi|148498962|gb|ABQ67216.1| protein of unknown function UPF0005 [Sphingomonas wittichii RW1]
          Length = 242

 Score =  128 bits (322), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 103/253 (40%), Positives = 153/253 (60%), Gaps = 20/253 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N            +  D GLR+YM+ +YN MA G+ +TGI++ L                
Sbjct: 10  NAAPAATRAGVADAAFDAGLRSYMLSIYNYMASGVLLTGIVALLFAESG----------- 58

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                      A ++ +PLRW+ + APL   + L+  ++ LS  AA+ +F  ++A++GLS
Sbjct: 59  ---------LAAQLFVTPLRWLIVLAPLAFIMVLSFGINKLSTTAAQGLFWAFAAVMGLS 109

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           +SS FL YT  SI  TFF TA +F +LSL+GYTTK+DL   G+F+IMG  GL + SL+N+
Sbjct: 110 MSSLFLAYTGSSIAITFFATATAFAALSLWGYTTKKDLSGFGTFLIMGVVGLLVASLLNI 169

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F +S A++L +SA+G+++F+ LTAYDTQKIK  Y       +A +  V+GAL LY+DF+ 
Sbjct: 170 FFKSPALNLAISAIGVLLFAGLTAYDTQKIKSMYFYVAGTDFAGKAVVMGALTLYLDFVN 229

Query: 246 IFVHLLRFLGSRR 258
           +F  LL+F+G RR
Sbjct: 230 MFTFLLQFMGDRR 242


>gi|123443109|ref|YP_001007083.1| hypothetical protein YE2895 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332161006|ref|YP_004297583.1| hypothetical protein YE105_C1384 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|122090070|emb|CAL12933.1| putative membrane protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318604878|emb|CBY26376.1| putative membrane protein [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665236|gb|ADZ41880.1| hypothetical protein YE105_C1384 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330859398|emb|CBX69743.1| inner membrane protein ybhL [Yersinia enterocolitica W22703]
          Length = 236

 Score =  128 bits (321), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 90/254 (35%), Positives = 140/254 (55%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S        + G++AYM +VY  M  GL +T ++++        ++   +S I 
Sbjct: 1   MDRYPRSNGSIVERANSGIQAYMAQVYGWMTCGLLLTAVVAWYAANTPAVMNFIFSSQIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G +   S                    ++ LS   A  +F+LYSAL GL+L
Sbjct: 61  FFGLIIVQLGLVFVISG------------------MVNRLSGSMATSLFMLYSALTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS  ++YT  SI  TF I A  FG++S+YGYTTKRDL  +GS + MG  G+ L S+VN++
Sbjct: 103 SSILIMYTGASIASTFIICAGMFGAMSVYGYTTKRDLSGMGSMLFMGLIGIVLASIVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++S A+   ++ +G+++F  LTAYDTQK+K   +     D     + S++GAL LY+DFI
Sbjct: 163 LKSPALMWAVTYIGVLVFVGLTAYDTQKLKNMGAQLDSNDRDNFRKYSIVGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|149920702|ref|ZP_01909167.1| hypothetical protein PPSIR1_01924 [Plesiocystis pacifica SIR-1]
 gi|149818489|gb|EDM77938.1| hypothetical protein PPSIR1_01924 [Plesiocystis pacifica SIR-1]
          Length = 255

 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 89/257 (34%), Positives = 138/257 (53%), Gaps = 25/257 (9%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           NY   + +G+     +  G+  +M RV   MA G+G+TG+ +FLV    T V+       
Sbjct: 21  NYAPGMQAGARPSPELASGVEQFMTRVNAWMAAGVGLTGLTAFLVAQSPTLVN------- 73

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                        ++ + L W+ + AP+ +   +  R+  +S  AA   FL+YSAL G+S
Sbjct: 74  ------------AIFGTGLFWVAVLAPVILVFVIASRVQKMSPAAATATFLVYSALNGMS 121

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF---LLSL 182
           L+  F VY+  +I   F ITA ++GSL+L+G+ TKRDL   G F+ M   GL    +  +
Sbjct: 122 LAFIFFVYSLGTIASVFAITAVTYGSLALWGFATKRDLSGWGRFLFMALVGLIVSSIAFM 181

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
               +  S + L  + +G+++F+ALTAYDTQKIK+ Y            +++GAL LY+D
Sbjct: 182 FIPGVMGSTMYLVYNVIGVLVFAALTAYDTQKIKQIYLVNG---GGGNLAILGALTLYLD 238

Query: 243 FIQIFVHLLRFLGSRRD 259
           FI +F+ LLR  G  RD
Sbjct: 239 FINLFMFLLRLFGGGRD 255


>gi|294013313|ref|YP_003546773.1| putative integral membrane protein [Sphingobium japonicum UT26S]
 gi|292676643|dbj|BAI98161.1| putative integral membrane protein [Sphingobium japonicum UT26S]
          Length = 236

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 93/254 (36%), Positives = 148/254 (58%), Gaps = 19/254 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + N  R+   G+   +  D GLRA+M+ V+  M +GL +TG+++  +             
Sbjct: 1   MNNPVRMPGYGASQTAQTDAGLRAHMLGVFRNMGIGLVITGLVAAFIGNTPV-------- 52

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                        A ++ +PL+W+ IFAPL    F + R+  ++   A+M F  +SA++G
Sbjct: 53  -----------LAAAIFGTPLKWVAIFAPLAFVFFFSFRIEKMTTAGARMAFYAFSAVMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +SL+S FLV+T  SI Q FF  A  F +++L+GYTT RDL   GSF+IMG  G+ + SL+
Sbjct: 102 VSLASIFLVFTGGSIAQAFFSAAVMFLAMALWGYTTGRDLSKFGSFLIMGLIGILVASLI 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F+ SSA+ + +S +G+V+F+ LTA+D Q+IK  Y        A++  V+GAL LY++F
Sbjct: 162 NIFIGSSAMQMVISIIGVVVFTGLTAWDVQRIKSEYFAYAGHEVAQKMQVMGALSLYLNF 221

Query: 244 IQIFVHLLRFLGSR 257
           + +F  LL   G R
Sbjct: 222 VNLFQMLLSLTGER 235


>gi|329114803|ref|ZP_08243560.1| hypothetical protein APO_1601 [Acetobacter pomorum DM001]
 gi|326695934|gb|EGE47618.1| hypothetical protein APO_1601 [Acetobacter pomorum DM001]
          Length = 258

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 89/263 (33%), Positives = 148/263 (56%), Gaps = 13/263 (4%)

Query: 1   MSDIRNYQRVVNSGS--GFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVD 58
           MS   +Y+            + +D GLRAYM+RVYN MA GL +TGI+++++   + +  
Sbjct: 1   MSFSHDYRSPATPTDWNAQAANLDAGLRAYMLRVYNWMASGLLLTGIVAYVIANTSLSH- 59

Query: 59  PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
                  +   V+    G +   + L  + + +PL   + ++  L+ LS   A+ +F  +
Sbjct: 60  -------LFFQVVQVPGGLVPRPTLLGDVAMLSPLAFVLVMSFGLNRLSLQGAQALFWAF 112

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
            A +G S+++ F++YT  SIV+ F +TA  F + SL+GY TK +L    SF++MG FGL 
Sbjct: 113 CATMGASMANIFVIYTDTSIVRVFLVTACMFAATSLWGYVTKANLLRFSSFLMMGLFGLL 172

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIG 235
           +  LVNLF++S A+    S +G+ IF+A +A+D Q+I+  Y   +         ++SV  
Sbjct: 173 IAGLVNLFLKSPALYYVYSIVGVFIFTAFSAFDAQRIRVTYPQLAAYEGPEMTAKRSVYD 232

Query: 236 ALMLYMDFIQIFVHLLRFLGSRR 258
           AL LY++FI +F  LL+F+G R 
Sbjct: 233 ALSLYLNFINLFQFLLQFMGVRN 255


>gi|258541193|ref|YP_003186626.1| hypothetical protein APA01_00890 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632271|dbj|BAH98246.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256635328|dbj|BAI01297.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256638383|dbj|BAI04345.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256641437|dbj|BAI07392.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256644492|dbj|BAI10440.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256647547|dbj|BAI13488.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256650600|dbj|BAI16534.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256653591|dbj|BAI19518.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 258

 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 88/263 (33%), Positives = 147/263 (55%), Gaps = 13/263 (4%)

Query: 1   MSDIRNYQRVVNSGS--GFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVD 58
           MS   +Y+            + +D GLRAYM+RVYN MA GL +TGI+++++   + +  
Sbjct: 1   MSFSHDYRSPATPTDWNAQAANLDAGLRAYMLRVYNWMASGLLLTGIVAYVIANTSLSH- 59

Query: 59  PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
                  +   V+    G +   + L  + + +PL   + ++  L+ LS   A+ +F  +
Sbjct: 60  -------LFFQVVQVPGGLVPRPTLLGDVAMLSPLAFVLVMSFGLNRLSLQGAQALFWAF 112

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
            A +G S ++ F++YT  SIV+ F +TA  F + SL+GY TK +L    SF++MG FGL 
Sbjct: 113 CAAMGASTANIFVIYTDTSIVRVFLVTACMFAATSLWGYVTKANLLRFSSFLMMGLFGLL 172

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIG 235
           +  LVNLF++S A+    S +G+ IF+A +A+D Q+I+  Y   +         ++SV  
Sbjct: 173 IAGLVNLFLKSPALYYVYSIVGVFIFTAFSAFDAQRIRVTYPQLAAYEGPEMTAKRSVYD 232

Query: 236 ALMLYMDFIQIFVHLLRFLGSRR 258
           AL LY++FI +F   L+F+G+R 
Sbjct: 233 ALSLYLNFINLFQFFLQFMGARN 255


>gi|114327040|ref|YP_744197.1| secY stabilizing membrane protein [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315214|gb|ABI61274.1| secY stabilizing membrane protein [Granulibacter bethesdensis
           CGDNIH1]
          Length = 267

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 97/255 (38%), Positives = 158/255 (61%), Gaps = 11/255 (4%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N  R    G+   +++D GLRAYM+RV+N MA G+ +TGI+++ +   +         + 
Sbjct: 17  NSVRPGVWGAADTASMDAGLRAYMLRVFNWMASGVALTGIVAYAIAHTSL--------MN 68

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                ++T  G  +  + L +I + +PL   + L+  ++ LS    + +F L    +G S
Sbjct: 69  AFYHPVMTEQGVSIQPTALAFISMISPLAFVLVLSFGINRLSLGTVQALFWLLCVAMGAS 128

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L++ FLVYT+ SIVQTFF++AA+F ++SLYGYTT+ DL   GSF++MG  G+ + S+VN+
Sbjct: 129 LTNIFLVYTNASIVQTFFVSAATFAAMSLYGYTTRSDLTRFGSFLMMGLIGIVIASVVNM 188

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMD 242
           F+ S  +   +S +G+++F+ LTAYDTQ+IK  Y+       ++   R+SV  AL LY++
Sbjct: 189 FVHSGMMGFVISVIGVLVFTGLTAYDTQRIKVDYAQFATQGGSDFAARRSVFDALQLYLN 248

Query: 243 FIQIFVHLLRFLGSR 257
           FI +F+ LLR LG+R
Sbjct: 249 FINLFMMLLRLLGNR 263


>gi|126739244|ref|ZP_01754938.1| hypothetical protein RSK20926_22629 [Roseobacter sp. SK209-2-6]
 gi|126719861|gb|EBA16569.1| hypothetical protein RSK20926_22629 [Roseobacter sp. SK209-2-6]
          Length = 257

 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 89/257 (34%), Positives = 156/257 (60%), Gaps = 6/257 (2%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  ++ + ++     + ID+GLRA+M +VY  M++GL +T + ++ +  L+ T  P+   
Sbjct: 1   MAQFENIRSAAGVRTAEIDEGLRAHMNKVYGTMSVGLLITALAAWAIAGLSITSTPNE-- 58

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFL-LYSALI 122
             I  G  LT  G  +Y SP++++ + APL    F    L    + A   +    ++A++
Sbjct: 59  YQIGAGRYLTDLGYTLYVSPVKFVLMLAPLAFIFFGWGALMRRGSAAVVQLGFLAFAAVM 118

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G+S+ + F++YT  SI QTF +TA +F  LSL+GYTTK+DL  +G+F++MG  GL +  +
Sbjct: 119 GISMGTVFMIYTPYSIAQTFLVTAIAFAGLSLWGYTTKKDLSGMGTFLMMGVIGLIVAMI 178

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALML 239
           VN+F++S  + + +SA+G++IF+ LTA+ TQ IK  Y   + + D  + ++ +  GAL L
Sbjct: 179 VNMFLQSGVMMMAISAIGVLIFAGLTAFYTQDIKNTYVAMATQGDKEWLDKAAYDGALSL 238

Query: 240 YMDFIQIFVHLLRFLGS 256
           Y+ F+ +F  LL F+G 
Sbjct: 239 YISFLNMFQFLLMFMGQ 255


>gi|238785225|ref|ZP_04629217.1| Inner membrane protein YbhL [Yersinia bercovieri ATCC 43970]
 gi|238713903|gb|EEQ05923.1| Inner membrane protein YbhL [Yersinia bercovieri ATCC 43970]
          Length = 236

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 90/254 (35%), Positives = 139/254 (54%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S        + G++AYM +VY  M  GL +T ++++        ++   +S I 
Sbjct: 1   MDRYPRSNGSIVERANTGIQAYMAQVYGWMTCGLLLTAVVAWYAANTPAVLNFIFSSQIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G +   S                    ++ LS   A  +F+LYSAL GL+L
Sbjct: 61  FFGLIIAQLGLVFVISG------------------MVNRLSGSMATSLFMLYSALTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS  ++YT  SI  TF I A  FG++S YGYTTKRDL  +GS + MG  G+ L S+VN++
Sbjct: 103 SSVLIMYTGASIASTFIICAGMFGAMSFYGYTTKRDLSGMGSMLFMGLIGIVLASVVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++S A+   ++ +G+++F  LTAYDTQK+K   +     D     + S++GAL LY+DFI
Sbjct: 163 LKSPALMWAVTYIGVLVFVGLTAYDTQKLKNMGAQLDANDKDSFRKYSIVGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|15892112|ref|NP_359826.1| hypothetical protein RC0189 [Rickettsia conorii str. Malish 7]
 gi|15619238|gb|AAL02727.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 236

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 97/247 (39%), Positives = 149/247 (60%), Gaps = 19/247 (7%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
           + +    T D+GLR YM++VYN MAL L +TG+ +     +    +              
Sbjct: 9   TAASKHKTFDEGLRQYMLKVYNYMALALLLTGVAAVTTISVEPIYN-------------- 54

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
                LM+ +    I +FAPLG+ ++  +    ++   A+++F +Y+ L G+SL+   L+
Sbjct: 55  -----LMFQTGFGTIIMFAPLGIALYFFMGFGQMNLPTAQILFWVYAGLTGMSLAYLALI 109

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNLF++SSA+
Sbjct: 110 YTGASIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNLFLKSSAL 169

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
               S +G+VIF  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI +F++L+R
Sbjct: 170 SFATSLIGIVIFMGLIAWDTQKIKSMYYMAGNDEVGQKLSIMAAFTLYLDFINLFLYLMR 229

Query: 253 FLGSRRD 259
           FLG+RRD
Sbjct: 230 FLGNRRD 236


>gi|34580857|ref|ZP_00142337.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262242|gb|EAA25746.1| unknown [Rickettsia sibirica 246]
          Length = 236

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 97/247 (39%), Positives = 149/247 (60%), Gaps = 19/247 (7%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
           + +    T D+GLR YM++VYN MAL L +TG+ +     +    +              
Sbjct: 9   TAASKNKTFDEGLRQYMLKVYNYMALALLLTGVAAVTTISVEPIYN-------------- 54

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
                LM+ +    I +FAPLG+ ++  +    ++   A+++F +Y+ L G+SL+   L+
Sbjct: 55  -----LMFQTGFGTIIMFAPLGIALYFFMGFGQMNLPTAQILFWVYAGLTGMSLAYLALI 109

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNLF++SSA+
Sbjct: 110 YTGASIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNLFLKSSAL 169

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
               S +G+VIF  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI +F++L+R
Sbjct: 170 SFATSLIGIVIFMGLIAWDTQKIKSMYYMAGNDEVGQKLSIMAAFTLYLDFINLFLYLMR 229

Query: 253 FLGSRRD 259
           FLG+RRD
Sbjct: 230 FLGNRRD 236


>gi|242239850|ref|YP_002988031.1| hypothetical protein Dd703_2427 [Dickeya dadantii Ech703]
 gi|242131907|gb|ACS86209.1| protein of unknown function UPF0005 [Dickeya dadantii Ech703]
          Length = 236

 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 93/254 (36%), Positives = 138/254 (54%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S           ++A+M +VY  MA GL +T  +++     +  +     S   
Sbjct: 1   MDRFSRSSGSIVQQAGTRVQAFMAQVYGWMACGLLLTAFVAWYAPQNSAIMQLVFGSKFT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G                  +   L+  +H LS   A  +F+LYSAL GL++
Sbjct: 61  FFGLVIVQLG------------------LVFVLSGMVHRLSGGVATTLFMLYSALTGLTI 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS FLVYT  SI  TF ITA +FG++S+YGYTTKRDL  +GS + M   G+ L +LVN +
Sbjct: 103 SSIFLVYTGDSIASTFVITAGTFGAMSVYGYTTKRDLTGLGSMLFMALIGILLATLVNFW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFI 244
           ++SS + L ++ +G+++F  LTAYDTQK+K         D     R S++GAL LY+DFI
Sbjct: 163 LKSSGLALAINYIGVLVFVGLTAYDTQKLKYLGESLSPDDRENFRRYSIVGALDLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRLFGNRR 236


>gi|260597178|ref|YP_003209749.1| Inner membrane protein YbhL [Cronobacter turicensis z3032]
 gi|260216355|emb|CBA29379.1| Inner membrane protein ybhL [Cronobacter turicensis z3032]
          Length = 235

 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 92/252 (36%), Positives = 134/252 (53%), Gaps = 20/252 (7%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
                 S        GL+ +M +VY  M  GL +T  +++        +    +S  +  
Sbjct: 2   DRFPRSSESIVQPRAGLQTFMAQVYGWMTCGLLLTAFVAWYSANNENLMMYIFSSRFVFF 61

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
           G+++                  A L +   L+  +H LS   A  +F+LYSAL GL+LSS
Sbjct: 62  GLII------------------AQLALVFVLSGLVHKLSPAVATALFMLYSALTGLTLSS 103

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            FLVYT  SI  TF +TA  FG +SLYGYTTKRDL   G+ + M   GL + SLVN +++
Sbjct: 104 IFLVYTYASIASTFVVTAGMFGVMSLYGYTTKRDLSGWGNILFMALIGLIIASLVNFWLK 163

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQI 246
           S A+   ++ +G+++F  LTAYDTQK+K         D     + S++GAL LY+DFI +
Sbjct: 164 SPALMWAVTYIGVIVFVGLTAYDTQKLKSLGEQIDVNDHGNLRKYSILGALTLYLDFINL 223

Query: 247 FVHLLRFLGSRR 258
           F+ LLR  G+RR
Sbjct: 224 FLMLLRIFGNRR 235


>gi|294637132|ref|ZP_06715441.1| membrane protein [Edwardsiella tarda ATCC 23685]
 gi|291089666|gb|EFE22227.1| membrane protein [Edwardsiella tarda ATCC 23685]
          Length = 236

 Score =  126 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 91/254 (35%), Positives = 137/254 (53%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   +          GL+AYM +VY  M  GL +T ++++        ++   A+ ++
Sbjct: 1   MDRYPRTNGTLVERAGSGLQAYMAQVYGWMCCGLLLTALVAWYAARTPALMELIFANKVV 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G +   S                    ++ LS  AA  +F+ YS L GL+L
Sbjct: 61  FFGLIIVQLGVVFVLSG------------------MVNRLSGSAATGLFMFYSLLTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+VYT  SI  TF ++A  FG++SLYGYTTKRDL  +GS + M   GL L SLVN++
Sbjct: 103 SSIFIVYTYSSIASTFVVSAGMFGAMSLYGYTTKRDLSGMGSMLFMALIGLVLASLVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++SS +   ++  G++IF  LTAYDTQK++         D     R +++GAL LY+DFI
Sbjct: 163 LKSSTLTWIVTYAGVLIFVGLTAYDTQKLRVMGEQIASDDRDGFRRYAIMGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G RR
Sbjct: 223 NLFLMLLRIFGDRR 236


>gi|157803334|ref|YP_001491883.1| aspartyl-tRNA synthetase [Rickettsia canadensis str. McKiel]
 gi|157784597|gb|ABV73098.1| aspartyl-tRNA synthetase [Rickettsia canadensis str. McKiel]
          Length = 236

 Score =  126 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 97/247 (39%), Positives = 149/247 (60%), Gaps = 19/247 (7%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
           + +    T D+GLR YM++VYN MAL L +TG+ +     +    +              
Sbjct: 9   TATAKNKTFDEGLRKYMLKVYNYMALALLLTGVAALTTISVEPIYN-------------- 54

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
                LM+ +    I +FAPLG+ ++  +    ++   A+++F +Y+ L G+SL+   L+
Sbjct: 55  -----LMFQTSFGTIIMFAPLGIALYFFMGFGRMNLQTAQILFWVYTTLTGMSLAYLALI 109

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNLF++SSA+
Sbjct: 110 YTGTSIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNLFLKSSAL 169

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
               S +G+V+F  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI +F+HL+R
Sbjct: 170 SFATSLIGIVVFMGLIAWDTQKIKSMYYMAGNNEVGQKLSIMAAFTLYLDFINLFLHLVR 229

Query: 253 FLGSRRD 259
           FLG+RRD
Sbjct: 230 FLGNRRD 236


>gi|307719711|ref|YP_003875243.1| hypothetical protein STHERM_c20350 [Spirochaeta thermophila DSM
           6192]
 gi|306533436|gb|ADN02970.1| hypothetical protein STHERM_c20350 [Spirochaeta thermophila DSM
           6192]
          Length = 234

 Score =  126 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 94/238 (39%), Positives = 135/238 (56%), Gaps = 20/238 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
            L+  +  VY  M  GL +TG++S  V                          A      
Sbjct: 15  ALQRILTNVYLWMTGGLALTGVVSLGVASSPAL------------------LRAFFSNPL 56

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           + ++ I   L +  +L++R+  +S +AA + F  YSAL G++L+  FLVYT  SI Q FF
Sbjct: 57  IFFLLIGGELALVFYLSLRIQKMSPFAATVAFASYSALNGVTLAPLFLVYTGTSIAQVFF 116

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           ITAA+F  +S YGY TKRDL  +GS + M  +GL + SLVN+F+RS    L +S +G++I
Sbjct: 117 ITAATFAGMSAYGYLTKRDLSRVGSIVGMALWGLIIASLVNIFLRSEGFSLVISYVGVLI 176

Query: 204 FSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           F  LTAYDTQ +K+  +     D +   R S++GAL LY+DFI +F+ LLR +GSRRD
Sbjct: 177 FVGLTAYDTQVLKQWATQIDPSDESVYVRFSIMGALKLYLDFINLFLFLLRIMGSRRD 234


>gi|302344623|ref|YP_003809152.1| hypothetical protein Deba_3205 [Desulfarculus baarsii DSM 2075]
 gi|301641236|gb|ADK86558.1| protein of unknown function UPF0005 [Desulfarculus baarsii DSM
           2075]
          Length = 241

 Score =  126 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 79/249 (31%), Positives = 127/249 (51%), Gaps = 14/249 (5%)

Query: 10  VVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRG 69
              +G        Q + A+M RVYN M LGL ++G++++ V      +     +      
Sbjct: 7   RSPAGEAISDRQTQIIGAFMRRVYNWMTLGLALSGVVAWWVMNSDAALSVFIDAQTG--- 63

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
                       + + W  I    G+ I L+  +   S   A  +F  Y+AL G++L   
Sbjct: 64  -----------PTMMFWAAIIGEFGLVIALSAGIRRFSPTTAMALFTAYAALNGVTLGIV 112

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
            L +T  S+ + F ITA +FG  S++  TTK+DL   GSF+ MG  G+ + S+VN+F  S
Sbjct: 113 MLAFTGASVAKAFLITAGTFGVTSIWASTTKKDLSAWGSFLFMGLIGIIIASVVNIFFES 172

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
             +D  +S +G+ +F  LTAYDTQ+++    +  +     + ++ GAL LY+DFI +F+ 
Sbjct: 173 PMMDWIISVVGVGLFVGLTAYDTQRLRAMVLEAANEVTVSKMAIFGALQLYLDFINLFLM 232

Query: 250 LLRFLGSRR 258
           LLR  G RR
Sbjct: 233 LLRLFGDRR 241


>gi|15604023|ref|NP_220538.1| hypothetical protein RP147 [Rickettsia prowazekii str. Madrid E]
 gi|15214359|sp|Q9ZE15|Y147_RICPR RecName: Full=Uncharacterized protein RP147
 gi|3860714|emb|CAA14615.1| unknown [Rickettsia prowazekii]
 gi|292571742|gb|ADE29657.1| Integral membrane protein, interact swith FtsH [Rickettsia
           prowazekii Rp22]
          Length = 236

 Score =  126 bits (315), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 96/247 (38%), Positives = 148/247 (59%), Gaps = 19/247 (7%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
           + +    T D+GLR YM++VYN MAL L +TG+ +     +                   
Sbjct: 9   TTTSKNKTFDEGLRRYMLKVYNYMALALLLTGVAAITTISVEPIY--------------- 53

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
                LM+ +    I +FAPLG+ ++  +    ++   A+++F +Y+ L G+SLS   L+
Sbjct: 54  ----HLMFQTGFGTIIMFAPLGIALYFFMGFGRMNLQTAQILFWVYAGLTGMSLSYLALI 109

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNLF++SS++
Sbjct: 110 YTGTSIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNLFLKSSSL 169

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
               S +G+V+F  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI +F++L+R
Sbjct: 170 SFATSLIGIVVFMGLIAWDTQKIKSMYYIAGNDEVGQKLSIMAAFTLYLDFINLFLYLMR 229

Query: 253 FLGSRRD 259
           FLG+RRD
Sbjct: 230 FLGNRRD 236


>gi|157828063|ref|YP_001494305.1| hypothetical protein A1G_01075 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165932761|ref|YP_001649550.1| stabilizing membrane protein [Rickettsia rickettsii str. Iowa]
 gi|157800544|gb|ABV75797.1| hypothetical protein A1G_01075 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165907848|gb|ABY72144.1| stabilizing membrane protein [Rickettsia rickettsii str. Iowa]
          Length = 236

 Score =  125 bits (314), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 97/247 (39%), Positives = 149/247 (60%), Gaps = 19/247 (7%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
           + +    T D+GLR YM++VYN MAL L +TG+ +     +    +              
Sbjct: 9   TAASKNKTFDEGLRQYMLKVYNYMALALLLTGVAAVTTISVEPIYN-------------- 54

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
                LM+ +    I +FAPLG+ ++  +    ++   A+++F +Y+ L G+SL+   L+
Sbjct: 55  -----LMFQTGFGTIIMFAPLGIALYFFMGFGQMNLQTAQILFWVYAGLTGMSLAYLALI 109

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNLF++SSA+
Sbjct: 110 YTGASIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNLFLKSSAL 169

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
               S +G+VIF  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI +F++L+R
Sbjct: 170 SFATSLIGIVIFMGLIAWDTQKIKSMYYMAGNDEVGQKLSIMAAFTLYLDFINLFLYLMR 229

Query: 253 FLGSRRD 259
           FLG+RRD
Sbjct: 230 FLGNRRD 236


>gi|238759760|ref|ZP_04620918.1| Inner membrane protein YbhL [Yersinia aldovae ATCC 35236]
 gi|238701992|gb|EEP94551.1| Inner membrane protein YbhL [Yersinia aldovae ATCC 35236]
          Length = 236

 Score =  125 bits (314), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 91/254 (35%), Positives = 141/254 (55%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S        + G++AYM +VY  M  GL +T ++++        ++   +S I 
Sbjct: 1   MDRYPRSNGSIVERANSGIQAYMAQVYGWMTCGLLLTAVVAWYAANTPAILNFIFSSQIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G +   S                    ++ LS   A  +F+LYSAL GL++
Sbjct: 61  FFGLIIVQLGLVFVISG------------------MVNRLSGSMATSLFMLYSALTGLTI 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F++YTS SI  TF I A  FG++S YGYTTKRDL  +GS + MG  G+ L S+VN++
Sbjct: 103 SSIFIMYTSSSIASTFLIAAGMFGAMSFYGYTTKRDLSGLGSMLFMGLIGIVLASIVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++S A+   ++ +G+++F  LTAYDTQK+K   +     D     + S++GAL LY+DFI
Sbjct: 163 LKSPALMWAVTYIGVLVFVGLTAYDTQKLKNMGAQLDANDRDSFRKYSIVGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|291616780|ref|YP_003519522.1| YbhL [Pantoea ananatis LMG 20103]
 gi|291151810|gb|ADD76394.1| YbhL [Pantoea ananatis LMG 20103]
          Length = 242

 Score =  125 bits (314), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 98/260 (37%), Positives = 141/260 (54%), Gaps = 20/260 (7%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M + R                 +GL+AYM +VY  M  GL +T  +S+        ++  
Sbjct: 1   MFNKRCIMDRYPQNDSIVQPASRGLQAYMAQVYGWMTCGLLLTAFVSWFAARTPAVMELV 60

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A+ I   G+++                    L +  FL+  +H LS   A  +F+LYSA
Sbjct: 61  FANRITFFGLII------------------VQLALVFFLSGMVHRLSGAVATGLFMLYSA 102

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L GL+++S FLVYT  SI  TFF+TA  FG++S YGYTTKRDL  +GS + M   G+ L 
Sbjct: 103 LTGLTMASIFLVYTYSSIASTFFVTAGMFGAMSFYGYTTKRDLSRLGSLLFMALIGILLA 162

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALM 238
           SLVN +++S A+   ++ +G+V+F  LTAYDTQK+K         D     R S++GAL 
Sbjct: 163 SLVNFWLKSPALMWAITYIGVVVFVGLTAYDTQKLKNIGEQIDARDTENLRRYSIMGALT 222

Query: 239 LYMDFIQIFVHLLRFLGSRR 258
           LY+DFI +F+ LLR  G+RR
Sbjct: 223 LYLDFINLFLMLLRIFGNRR 242


>gi|229586387|ref|YP_002844888.1| Integral membrane protein, interacts with FtsH [Rickettsia africae
           ESF-5]
 gi|228021437|gb|ACP53145.1| Integral membrane protein, interacts with FtsH [Rickettsia africae
           ESF-5]
          Length = 236

 Score =  125 bits (314), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 98/247 (39%), Positives = 149/247 (60%), Gaps = 19/247 (7%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
           + +    T D+GLR YM++VYN MAL L +TG+ +     +    +              
Sbjct: 9   TAASKNKTFDEGLRQYMLKVYNYMALALLLTGVAAVTTISVEPIYN-------------- 54

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
                LM+ +    I +FAPLG+ ++  +    ++   A+++F +Y+ L G+SL+   L+
Sbjct: 55  -----LMFQTGFGTIIMFAPLGIALYFFMGFGQMNLQTAQILFWVYAGLTGMSLAYLALI 109

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNLF++SSA+
Sbjct: 110 YTGASIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNLFLKSSAL 169

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
               S +G+VIF  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI +F+HL+R
Sbjct: 170 SFATSLIGIVIFMGLIAWDTQKIKSMYYMAGNDKAGQKLSIMAAFTLYLDFINLFLHLMR 229

Query: 253 FLGSRRD 259
           FLG+RRD
Sbjct: 230 FLGNRRD 236


>gi|5354188|gb|AAD42397.1|AF157493_5 conserved hypothetical integral membrane protein [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 234

 Score =  125 bits (314), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 109/248 (43%), Positives = 150/248 (60%), Gaps = 20/248 (8%)

Query: 11  VNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGV 70
              G    S  D GLR+YM+ VYN MA G+ +TGI+++LV   A                
Sbjct: 7   AARGRNGASERDAGLRSYMLSVYNYMAGGVLLTGIVAYLVAHSA---------------- 50

Query: 71  MLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFF 130
                GA +  SPLRW+ I APL     L+  ++       K +F  Y+A++GLS++  F
Sbjct: 51  ----LGAAIIFSPLRWLVILAPLAFVFALSAGVNRFKLSTLKTLFWSYAAVMGLSMAVIF 106

Query: 131 LVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSS 190
            VYT  SI QTFF TAA+F  LS++GY TK+DL  IGSF+IM  FGL + SL+N+F+ SS
Sbjct: 107 FVYTGTSIAQTFFATAAAFAGLSVFGYLTKKDLSGIGSFLIMAVFGLIVASLLNMFIHSS 166

Query: 191 AIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHL 250
           ++   +SA+G++IF+ LTAYDTQ+IK  Y       YA + +V+GAL LY+DFI +F  L
Sbjct: 167 SLQFGISALGVLIFAGLTAYDTQQIKSMYFMTSGGEYAGKMAVMGALSLYLDFINMFSFL 226

Query: 251 LRFLGSRR 258
           L F+G RR
Sbjct: 227 LNFMGDRR 234


>gi|308186124|ref|YP_003930255.1| hypothetical protein Pvag_0604 [Pantoea vagans C9-1]
 gi|308056634|gb|ADO08806.1| Uncharacterized protein [Pantoea vagans C9-1]
          Length = 235

 Score =  125 bits (314), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 97/237 (40%), Positives = 138/237 (58%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+AYM +VY  M  GL +T  +S+        ++   A+ I   G+++           
Sbjct: 17  GLQAYMAQVYGWMTCGLLLTAFVSWFAARTPAVMELVFANRITFFGLII----------- 65

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                  A L +  FL+  +H LS   A  +F+LYSAL G++++S FLVYT  SI  TFF
Sbjct: 66  -------AQLALVFFLSGMVHRLSGAVATGLFMLYSALTGITMASIFLVYTYSSIASTFF 118

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++S YGYTTKRDL   GS + M   G+ L SLVN +++S A+   ++ +G+V+
Sbjct: 119 VTAGMFGAMSFYGYTTKRDLSRFGSLLFMALIGIVLASLVNFWLKSPALMWAITYIGVVV 178

Query: 204 FSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K         D     R S++GAL LY+DFI +F+ LLR LG+RR
Sbjct: 179 FVGLTAYDTQKLKNIGEQIDARDTENLRRYSIMGALTLYLDFINLFLMLLRILGNRR 235


>gi|304395760|ref|ZP_07377643.1| protein of unknown function UPF0005 [Pantoea sp. aB]
 gi|304357054|gb|EFM21418.1| protein of unknown function UPF0005 [Pantoea sp. aB]
          Length = 235

 Score =  125 bits (313), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 99/252 (39%), Positives = 141/252 (55%), Gaps = 20/252 (7%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
                      +  +GL+AYM +VY  M  GL +T  +S+        ++   A+ I   
Sbjct: 2   DRYPRNDSIVQSASRGLQAYMAQVYGWMTCGLLLTAFVSWYAARTPAVMEMVFANRITFF 61

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
           G+++                  A L +  FL+  +H LS   A  +F+LYSAL GL+++S
Sbjct: 62  GLII------------------AQLALVFFLSGMVHRLSGAVATGLFMLYSALTGLTMAS 103

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            FLVYT  SI  TFF+TA  FG++S YGYTTKRDL   GS + MG  G+ L SLVN +++
Sbjct: 104 IFLVYTYSSIASTFFVTAGMFGAMSFYGYTTKRDLSRFGSLLFMGLIGIVLASLVNFWLK 163

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQI 246
           S A+   ++ +G+V+F  LTAYDTQK+K         D     R S++GAL LY+DFI +
Sbjct: 164 SPALMWAITYIGVVLFVGLTAYDTQKLKNIGEQIDARDTENLRRYSIMGALTLYLDFINL 223

Query: 247 FVHLLRFLGSRR 258
           F+ LLR LG+RR
Sbjct: 224 FLMLLRILGNRR 235


>gi|296209716|ref|XP_002751690.1| PREDICTED: glutamate [NMDA] receptor-associated protein 1-like
           [Callithrix jacchus]
          Length = 362

 Score =  125 bits (313), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 92/232 (39%), Gaps = 20/232 (8%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++I+V+ ++++ L +T +++ +             +      +    F   +  +    
Sbjct: 151 AFIIKVFLILSVQLVITMVITSVFIFWEALKVWVLKTPWFIYTIFPAFFLVFIMLACCGN 210

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
           +                      A  ++  +++ L GL L +    Y +  ++     TA
Sbjct: 211 LR-----------------RQVPANYILLGVFTVLQGLLLGAISAFYKADEVLWATAATA 253

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
               +L+L+   TK D   +   + +  F L +  ++ +F+ S  + L  + +G V+FS 
Sbjct: 254 LVTLALTLFALHTKWDFTLLNGGLFVFCFVLLVYGIILIFVPSYWLHLLYAGLGTVLFSL 313

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
               D Q         +  +    + V   L +Y+DFI +F+ +LR +G  R
Sbjct: 314 YLVMDVQL---MLGGHHRYSLDPEEYVFAVLNIYLDFINLFLFILRLIGLGR 362


>gi|157964214|ref|YP_001499038.1| integral membrane protein, interacts with FtsH [Rickettsia
           massiliae MTU5]
 gi|157843990|gb|ABV84491.1| Integral membrane protein, interacts with FtsH [Rickettsia
           massiliae MTU5]
          Length = 249

 Score =  125 bits (313), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 96/247 (38%), Positives = 148/247 (59%), Gaps = 19/247 (7%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
           + +    T D+GLR YM++VYN MAL L +TG+ +     +    +              
Sbjct: 22  TTASKNKTFDEGLRKYMLKVYNYMALALLLTGVAAVTTISVEPIYN-------------- 67

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
                LM+ +    I +FAPLG+ ++  +    ++    +++F +Y+ L G+SL+   L+
Sbjct: 68  -----LMFQTGFGTIIMFAPLGIALYFFMGFGRMNLQTTQILFWVYAGLTGMSLAYLALI 122

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNLF++SSA+
Sbjct: 123 YTGASIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNLFLKSSAL 182

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
               S +G+VIF  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI +F++L+R
Sbjct: 183 SFATSLIGIVIFMGLIAWDTQKIKSMYYTAGNDEVGQKLSIMAAFTLYLDFINLFLYLMR 242

Query: 253 FLGSRRD 259
           FLG+RRD
Sbjct: 243 FLGNRRD 249


>gi|67459526|ref|YP_247150.1| integral membrane protein [Rickettsia felis URRWXCal2]
 gi|67005059|gb|AAY61985.1| Integral membrane protein [Rickettsia felis URRWXCal2]
          Length = 236

 Score =  125 bits (313), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 96/247 (38%), Positives = 149/247 (60%), Gaps = 19/247 (7%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
           + +    T D+GLR YM++VYN MAL L +TG+ +     +    +              
Sbjct: 9   TATSKNKTFDEGLRKYMLKVYNYMALALLLTGVAAVTTISVEPIYN-------------- 54

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
                LM+ +    I +FAPLG+ ++  +    ++   A+++F +Y+ L G+SL+   L+
Sbjct: 55  -----LMFQTGFGTIMMFAPLGIALYFFMGFGRMNLKTAQILFWVYAGLTGMSLAYLALI 109

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNLF++SSA+
Sbjct: 110 YTGASIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNLFLKSSAL 169

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
               S +G+V+F  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI +F++L+R
Sbjct: 170 SFATSLIGIVVFMGLIAWDTQKIKSMYYMAGNDEVGQKLSIMAAFTLYLDFINLFLYLMR 229

Query: 253 FLGSRRD 259
           FLG+RRD
Sbjct: 230 FLGNRRD 236


>gi|238650366|ref|YP_002916218.1| stabilizing membrane protein [Rickettsia peacockii str. Rustic]
 gi|238624464|gb|ACR47170.1| stabilizing membrane protein [Rickettsia peacockii str. Rustic]
          Length = 236

 Score =  124 bits (312), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 97/247 (39%), Positives = 149/247 (60%), Gaps = 19/247 (7%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
           + +    T D+GLR YM++VYN MAL L +TG+ +     +    +              
Sbjct: 9   TATSKNKTFDEGLRQYMLKVYNYMALALLLTGVAAVTTIAVEPIYN-------------- 54

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
                LM+ +    I +FAPLG+ ++  +    ++   A+++F +Y+ L G+SL+   L+
Sbjct: 55  -----LMFQTGFGTIIMFAPLGIALYFFMGFGQMNLQTAQILFWVYAGLTGMSLAYLALI 109

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNLF++SSA+
Sbjct: 110 YTGASIARTFFICSSVFGAMSLYGYSTSRDLTSMGSFFAMGLIGLIIASLVNLFLKSSAL 169

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
               S +G+VIF  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI +F++L+R
Sbjct: 170 SFATSLIGIVIFMGLIAWDTQKIKSMYYMAGNDEVGQKLSIMAAFTLYLDFINLFLYLMR 229

Query: 253 FLGSRRD 259
           FLG+RRD
Sbjct: 230 FLGNRRD 236


>gi|327393206|dbj|BAK10628.1| inner membrane protein YbhL [Pantoea ananatis AJ13355]
          Length = 235

 Score =  124 bits (312), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 96/237 (40%), Positives = 137/237 (57%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+AYM +VY  M  GL +T  +S+        ++   A+ I   G+++           
Sbjct: 17  GLQAYMAQVYGWMTCGLLLTAFVSWFAARTPAVMELVFANRITFFGLII----------- 65

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                    L +  FL+  +H LS   A  +F+LYSAL GL+++S FLVYT  SI  TFF
Sbjct: 66  -------VQLALVFFLSGMVHRLSGAVATGLFMLYSALTGLTMASIFLVYTYSSIASTFF 118

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++S YGYTTKRDL  +GS + M   G+ L SLVN +++S A+   ++ +G+V+
Sbjct: 119 VTAGMFGAMSFYGYTTKRDLSRLGSLLFMALIGILLASLVNFWLKSPALMWAITYIGVVV 178

Query: 204 FSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K         D     R S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 179 FVGLTAYDTQKLKNIGEQIDARDTENLRRYSIMGALTLYLDFINLFLMLLRIFGNRR 235


>gi|317504064|ref|ZP_07962067.1| protein of hypothetical function UPF0005 [Prevotella salivae DSM
           15606]
 gi|315664806|gb|EFV04470.1| protein of hypothetical function UPF0005 [Prevotella salivae DSM
           15606]
          Length = 265

 Score =  124 bits (312), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 81/259 (31%), Positives = 131/259 (50%), Gaps = 19/259 (7%)

Query: 3   DIRNYQRVVN--SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           D + +   V          +      A + +VY  M   L ++GI+++ V      +   
Sbjct: 23  DFKEFNDRVRDIEYGNSEPSYSAAFPALIRKVYLWMTFALAISGIVAYGVATSPNLLMLI 82

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            ++ ++  G++   F  +   S                      + S  A  +MF LYS 
Sbjct: 83  YSNKLVFWGIIAVNFLLVWKISGSTMKP----------------NRSLAATTLMFALYSV 126

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L G  LS  F+VY   +I++TFFITA  F S + YGY TK+DL   G F+ M   GL L 
Sbjct: 127 LTGAILSFIFVVYAPTAIIKTFFITAGMFVSTAAYGYFTKKDLSNWGGFLTMALLGLILA 186

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDV-AYAERQSVIGALML 239
            +VN+F++SS++D  +S +G+++F  LT +D+Q IK   ++  DV   +++ +V GAL L
Sbjct: 187 LVVNMFLKSSSLDYIISIVGVIVFVGLTIWDSQTIKRQLAEMPDVSEASQKLAVCGALSL 246

Query: 240 YMDFIQIFVHLLRFLGSRR 258
           Y+DFI +F++LLR  G  R
Sbjct: 247 YLDFINLFLYLLRIFGRDR 265


>gi|148550821|ref|YP_001260260.1| hypothetical protein Swit_5385 [Sphingomonas wittichii RW1]
 gi|148503240|gb|ABQ71493.1| protein of unknown function UPF0005 [Sphingomonas wittichii RW1]
          Length = 241

 Score =  124 bits (312), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 85/255 (33%), Positives = 139/255 (54%), Gaps = 19/255 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
                      S      D GLR +MI +Y  MALGL +TG+++F V       +P    
Sbjct: 5   FNRTMPSQRRASPIDRGFDAGLRNHMIGIYRNMALGLALTGLVAFGVASTPALYEP---- 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                          ++ +PL+W+ IFAPL   + L+  LH +SA  A+  + +++ ++G
Sbjct: 61  ---------------IFGTPLKWVAIFAPLAFVLLLSFGLHQMSAAMAQTAYFVFAGVMG 105

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +S++S FL++T +SI   FF  AA F ++SL+GYTT  DL      +++G   +   S+V
Sbjct: 106 ISMASIFLMFTGESIALAFFTAAAVFAAMSLWGYTTGADLSRWAPILMVGLLAVVAASIV 165

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
            LF+ SS + +  S  G+V+F+ LTA+DTQ+++  Y        A + +++GAL LY++ 
Sbjct: 166 TLFLGSSTLQMLFSIAGIVVFTGLTAWDTQRLRNEYYAYAGQEEAGKLAIVGALSLYLNL 225

Query: 244 IQIFVHLLRFLGSRR 258
           I +F  LL F+G RR
Sbjct: 226 INLFQLLLTFMGQRR 240


>gi|238753341|ref|ZP_04614704.1| Inner membrane protein YbhL [Yersinia ruckeri ATCC 29473]
 gi|238708294|gb|EEQ00649.1| Inner membrane protein YbhL [Yersinia ruckeri ATCC 29473]
          Length = 236

 Score =  124 bits (312), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 91/254 (35%), Positives = 138/254 (54%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S        + G++AYM +VY  M  GL +T  +++        +    +S I 
Sbjct: 1   MDRYPRSNGSIVERANTGIQAYMAQVYGWMTCGLLLTAFVAWYTASTPAILHFIFSSQIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G +   S                    ++ LS   A  +F+LYSAL GL+L
Sbjct: 61  FFGLIIAQLGLVFVISG------------------MVNRLSGTMATSLFMLYSALTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS  ++YT  SI  TF I A  FG++S++GYTTKRDL  +GS + MG  G+ L SLVN++
Sbjct: 103 SSILVMYTGASIASTFIICAGMFGAMSVFGYTTKRDLSGMGSMLFMGLIGIVLASLVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++S A+   ++ +G+V+F  LTAYDTQK+K   +     D     + S++GAL LY+DFI
Sbjct: 163 LKSDALMWAVTYIGVVVFVGLTAYDTQKLKNMGAQLDANDKDSFRKYSIVGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|60477740|gb|AAH41788.2| Glutamate receptor, ionotropic, N-methyl D-aspartate-associated
           protein 1 (glutamate binding) [Homo sapiens]
          Length = 371

 Score =  124 bits (312), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 40/239 (16%), Positives = 99/239 (41%), Gaps = 22/239 (9%)

Query: 22  DQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           D+ +R A++ +V+ ++ L L VT     +   +A        ++          F +L+ 
Sbjct: 154 DKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVRENVWTYYVSYAVFFISLIV 213

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S                              +   + +A +   +      Y +++++ 
Sbjct: 214 LSC-----------------CGDFRRKHPWNLVALSVLTASLSYMVGMIASFYNTEAVIM 256

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              IT A   ++ ++   T+ D       +++    LF+ +++ +F+R+  +++  +++G
Sbjct: 257 AVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLG 316

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++F+   A DTQ +         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 317 ALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 371


>gi|317047404|ref|YP_004115052.1| hypothetical protein Pat9b_1174 [Pantoea sp. At-9b]
 gi|316949021|gb|ADU68496.1| protein of unknown function UPF0005 [Pantoea sp. At-9b]
          Length = 235

 Score =  124 bits (312), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 98/252 (38%), Positives = 136/252 (53%), Gaps = 20/252 (7%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
                          GL+ YM +VY  M  GL +T  +S+        ++   A+ I   
Sbjct: 2   DRYPRNDSIVQQASAGLQTYMAQVYGWMTCGLLLTAFVSWFAARTPAVMELVFANRITFF 61

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
           G+++                  A L V   L+  +H LS   A  +F+LYSAL GL+L+S
Sbjct: 62  GLII------------------AQLAVVFVLSGMVHRLSGALATALFMLYSALTGLTLAS 103

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            FLVYT  SI  TFF+TA  FG++S YGYTTKRDL   GS + M   G+ L SLVN +++
Sbjct: 104 IFLVYTYSSIASTFFVTAGMFGAMSFYGYTTKRDLSRFGSLLFMALIGILLASLVNFWLK 163

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQI 246
           S A+   ++ +G+V+F  LTAYDTQK+K      D  D     R S++GAL LY+DFI +
Sbjct: 164 SPALMWAITYIGVVVFVGLTAYDTQKLKAIGETVDVNDKENLRRLSIMGALTLYLDFINL 223

Query: 247 FVHLLRFLGSRR 258
           F+ LLR  G+RR
Sbjct: 224 FLMLLRIFGNRR 235


>gi|238794068|ref|ZP_04637685.1| Inner membrane protein YbhL [Yersinia intermedia ATCC 29909]
 gi|238726573|gb|EEQ18110.1| Inner membrane protein YbhL [Yersinia intermedia ATCC 29909]
          Length = 249

 Score =  124 bits (312), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 93/260 (35%), Positives = 144/260 (55%), Gaps = 20/260 (7%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M  +    R   S        + G++AYM +VY  M  GL +T ++++        ++  
Sbjct: 8   MHKVTTMDRYPRSNGSIVERANTGIQAYMAQVYGWMTCGLLLTAVVAWYAANTPAVLNFI 67

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            +S I   G+++   G +   S                    ++ LS   A  +F+LYSA
Sbjct: 68  FSSQITFFGLIIVQLGLVFVISG------------------MVNRLSGSMATSLFMLYSA 109

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L GL++SS F++YTS SI  TF I A  FG++S YGYTTKRDL  +GS + MG  G+ L 
Sbjct: 110 LTGLTISSIFIMYTSSSIASTFLIAAGMFGAMSFYGYTTKRDLSGMGSMLFMGLIGIVLA 169

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALM 238
           S+VN++++S+A+   ++ +G+++F  LTAYDTQK+K   S     D     + S++GAL 
Sbjct: 170 SIVNIWLKSTALMWAVTYIGVLVFVGLTAYDTQKLKNMGSQLDANDKDNFRKYSIVGALT 229

Query: 239 LYMDFIQIFVHLLRFLGSRR 258
           LY+DFI +F+ LLR  G+RR
Sbjct: 230 LYLDFINLFLMLLRIFGNRR 249


>gi|57165373|ref|NP_000828.1| glutamate [NMDA] receptor-associated protein 1 [Homo sapiens]
 gi|57165375|ref|NP_001009184.1| glutamate [NMDA] receptor-associated protein 1 [Homo sapiens]
 gi|74738689|sp|Q7Z429|GRINA_HUMAN RecName: Full=Glutamate [NMDA] receptor-associated protein 1;
           AltName: Full=NMDA receptor glutamate-binding subunit;
           AltName: Full=Putative MAPK-activating protein PM02
 gi|31455507|dbj|BAC77379.1| putative MAPK activating protein [Homo sapiens]
 gi|54261527|gb|AAH84553.1| Glutamate receptor, ionotropic, N-methyl D-aspartate-associated
           protein 1 (glutamate binding) [Homo sapiens]
 gi|119572690|gb|EAW52305.1| glutamate receptor, ionotropic, N-methyl D-asparate-associated
           protein 1 (glutamate binding), isoform CRA_b [Homo
           sapiens]
 gi|193785386|dbj|BAG54539.1| unnamed protein product [Homo sapiens]
          Length = 371

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/239 (16%), Positives = 99/239 (41%), Gaps = 22/239 (9%)

Query: 22  DQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           D+ +R A++ +V+ ++ L L VT     +   +A        ++          F +L+ 
Sbjct: 154 DKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVRENVWTYYVSYAVFFISLIV 213

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S                              +   + +A +   +      Y +++++ 
Sbjct: 214 LSC-----------------CGDFRRKHPWNLVALSVLTASLSYMVGMIASFYNTEAVIM 256

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              IT A   ++ ++   T+ D       +++    LF+ +++ +F+R+  +++  +++G
Sbjct: 257 AVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLG 316

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++F+   A DTQ +         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 317 ALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 371


>gi|300715931|ref|YP_003740734.1| hypothetical protein EbC_13520 [Erwinia billingiae Eb661]
 gi|299061767|emb|CAX58883.1| Putative membrane protein [Erwinia billingiae Eb661]
          Length = 236

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 92/254 (36%), Positives = 138/254 (54%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S S   S  + GL+ YM +VY  M  GL +T  +S+        ++   A+ I 
Sbjct: 1   MDRYPRSDSSMVSQANTGLQTYMAQVYGWMTCGLLLTAFVSWFAANTPAVMEMVFANRIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G                  +   L+  +H LS   A  +F+LYSAL GL++
Sbjct: 61  FYGLIIVQLG------------------LVFVLSGMVHKLSGAVATGLFMLYSALTGLTM 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           +S FLVYT  SI  TF +    FG +S +GYTTKRDL  +GS + M   G+ L S+VN++
Sbjct: 103 ASIFLVYTYSSIAGTFLVAGGMFGVMSFWGYTTKRDLSGMGSMLFMALIGIVLASVVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++S+A+   ++ +G+++F  LTAYDTQK+K         D     R S++GAL LY+DFI
Sbjct: 163 LKSTALMWAVTYIGVLVFVGLTAYDTQKLKNIGEGINVEDKENLRRYSIMGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|109087972|ref|XP_001098240.1| PREDICTED: glutamate [NMDA] receptor-associated protein 1-like
           isoform 1 [Macaca mulatta]
 gi|109087976|ref|XP_001098441.1| PREDICTED: glutamate [NMDA] receptor-associated protein 1-like
           isoform 3 [Macaca mulatta]
          Length = 371

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 98/239 (41%), Gaps = 22/239 (9%)

Query: 22  DQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           D+ +R A++ +V+ ++ L L VT     +   +         ++          F +L+ 
Sbjct: 154 DKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVGEVKGFVRENVWTYYVSYAVFFISLIV 213

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S                              +   + +A +   +      Y +++++ 
Sbjct: 214 LSC-----------------CGDFRRKHPWNLVALSVLTASLSYMVGMIASFYNTEAVIM 256

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              IT A   ++ ++   T+ D       +++    LF+ +++ +F+R+  +++  +++G
Sbjct: 257 AVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLG 316

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++F+   A DTQ +         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 317 ALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 371


>gi|238788767|ref|ZP_04632558.1| Inner membrane protein YbhL [Yersinia frederiksenii ATCC 33641]
 gi|238723072|gb|EEQ14721.1| Inner membrane protein YbhL [Yersinia frederiksenii ATCC 33641]
          Length = 236

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 91/254 (35%), Positives = 142/254 (55%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S        + G++AYM +VY  M  GL +T ++++        ++   +S I 
Sbjct: 1   MDRYPRSNGSIVERANSGIQAYMAQVYGWMTCGLLLTAVVAWYAANTPAVLNFIFSSQIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G +   S                    ++ LS   A  +F+LYSAL GL++
Sbjct: 61  FFGLIIVQLGLVFVISG------------------MVNRLSGTMATSLFMLYSALTGLTI 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F++YTS SI  TF I A  FG++S YGYTTKRDL  +GS + MG  G+ L S+VN++
Sbjct: 103 SSIFIMYTSSSIASTFLIAAGMFGAMSFYGYTTKRDLSGMGSMLFMGLIGIVLASIVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++S+A+   ++ +G+++F  LTAYDTQK+K   +     D     + S++GAL LY+DFI
Sbjct: 163 LKSTALMWAVTYIGVLVFVGLTAYDTQKLKNMGAQLDANDKDGFRKYSIVGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|320538876|ref|ZP_08038552.1| putative inner membrane protein [Serratia symbiotica str. Tucson]
 gi|320031036|gb|EFW13039.1| putative inner membrane protein [Serratia symbiotica str. Tucson]
          Length = 236

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 93/254 (36%), Positives = 139/254 (54%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S        + G++AYM +VY  M  GL +T  +S+        ++   +S I 
Sbjct: 1   MDRYPRSNGSIVERANSGIQAYMAQVYGWMTCGLLLTAFVSWYAAQTPAILNFIFSSQIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++                  A L +   ++  ++ LSA  A  +F+LYS L GL+L
Sbjct: 61  FFGLII------------------AQLALVFVISGMVNRLSAALATSLFMLYSVLTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+ YT  SI  TF +TA  FG++SLYGYTTKRDL   GS + M   G+ L SLVN++
Sbjct: 103 SSIFIAYTYSSIASTFVVTAGMFGAMSLYGYTTKRDLSGFGSMLFMALIGIVLASLVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++SSA+   ++ +G+ +F  LTAYDTQK+K         D     + +++GAL LY+DFI
Sbjct: 163 LKSSALMWVITYIGVAVFVGLTAYDTQKLKAMGEQLNTDDHDSLRKYAIVGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|156934723|ref|YP_001438639.1| hypothetical protein ESA_02558 [Cronobacter sakazakii ATCC BAA-894]
 gi|156532977|gb|ABU77803.1| hypothetical protein ESA_02558 [Cronobacter sakazakii ATCC BAA-894]
          Length = 235

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 91/238 (38%), Positives = 134/238 (56%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ +M +VY  M  GL +T  +++        +    +S  +  G+++          
Sbjct: 16  AGLQTFMAQVYGWMTCGLLLTAFVAWYSANNENLMMYIFSSRFVFFGLII---------- 65

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L +   L+  +H LS   A  +F+LYSAL GL+LSS FLVYT  SI  TF
Sbjct: 66  --------AQLALVFVLSGLVHKLSPAVATALFMLYSALTGLTLSSIFLVYTYASIASTF 117

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG +SLYGYTTKRDL   G+ + M   GL + SLVN +++S+A+   ++ +G++
Sbjct: 118 VVTAGMFGVMSLYGYTTKRDLSGWGNILFMALIGLIIASLVNFWLKSTALMWAVTYIGVI 177

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D     + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 VFVGLTAYDTQKLKALGEQIDVNDHGNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 235


>gi|333006904|gb|EGK26400.1| hypothetical protein SFVA6_1204 [Shigella flexneri VA-6]
          Length = 234

 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 92/238 (38%), Positives = 140/238 (58%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++     A  ++    + +   G+++          
Sbjct: 15  AGLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 65  --------AQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++SLYGYTTKRDL  +G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 117 VVTAGMFGAMSLYGYTTKRDLSGLGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|238749847|ref|ZP_04611351.1| hypothetical protein yrohd0001_36140 [Yersinia rohdei ATCC 43380]
 gi|238711776|gb|EEQ03990.1| hypothetical protein yrohd0001_36140 [Yersinia rohdei ATCC 43380]
          Length = 236

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 92/254 (36%), Positives = 142/254 (55%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S        + G++AYM +VY  M  GL +T ++++        ++   +S I 
Sbjct: 1   MDRYPRSNGSIVERANTGIQAYMAQVYGWMTCGLLLTAVVAWYAANTPAVLNFIFSSQIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G +   S                    ++ LS   A  +F+LYSAL GL++
Sbjct: 61  FFGLIIVQLGLVFVISG------------------MVNRLSGAMATSLFMLYSALTGLTI 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+VYTS SI  TF I A  FG++S YGYTTKRDL  +GS + MG  G+ L S+VN++
Sbjct: 103 SSIFIVYTSSSIASTFLIAAGMFGAMSFYGYTTKRDLSGMGSMLFMGLIGIVLASIVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++S+A+   ++ +G+++F  LTAYDTQK+K   +     D     + S++GAL LY+DFI
Sbjct: 163 LKSTALMWAVTYIGVLVFVGLTAYDTQKLKNMGAQLDANDKDSFRKYSIVGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|332263591|ref|XP_003280833.1| PREDICTED: glutamate [NMDA] receptor-associated protein 1-like
           [Nomascus leucogenys]
          Length = 381

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 98/239 (41%), Gaps = 22/239 (9%)

Query: 22  DQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           D+ +R A++ +V+ ++ L L VT     +   +         ++          F +L+ 
Sbjct: 164 DKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVGEVKGFVRENVWTYYVSYAVFFISLIV 223

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S                              +   + +A +   +      Y +++++ 
Sbjct: 224 LSC-----------------CGDFRRKHPWNLVALSVLTASLSYMVGMIASFYNTEAVIM 266

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              IT A   ++ ++   T+ D       +++    LF+ +++ +F+R+  +++  +++G
Sbjct: 267 AVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLG 326

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++F+   A DTQ +         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 327 ALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 381


>gi|284920635|emb|CBG33697.1| putative membrane protein [Escherichia coli 042]
          Length = 234

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 92/238 (38%), Positives = 140/238 (58%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++     A  ++    + +   G+++          
Sbjct: 15  AGLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + I L+  +  LSA A  M+F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 65  --------AQLALVIVLSAMIQKLSAGATTMLFMLYSALTGLTLSSIFIVYTAASIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++SLYGYTTKRDL   G+ + M   G+ + SLVN +++S A+   ++ +G++
Sbjct: 117 VVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVIASLVNFWLKSEALMWAVTYIGVI 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|323976829|gb|EGB71917.1| inner membrane protein ybhL [Escherichia coli TW10509]
          Length = 234

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 93/238 (39%), Positives = 140/238 (58%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++     A  ++    + +   G+++          
Sbjct: 15  AGLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 65  --------AQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++SLYGYTTKRDLG  G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 117 VVTAGMFGAMSLYGYTTKRDLGGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|158521735|ref|YP_001529605.1| hypothetical protein Dole_1724 [Desulfococcus oleovorans Hxd3]
 gi|158510561|gb|ABW67528.1| protein of unknown function UPF0005 [Desulfococcus oleovorans Hxd3]
          Length = 235

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 89/248 (35%), Positives = 140/248 (56%), Gaps = 21/248 (8%)

Query: 15  SGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
               +     +  ++  VYN MA+GL +TG +++ V                      T 
Sbjct: 6   QARATQTQVVVNTFIRSVYNWMAVGLALTGFLAYYVAHNE------------------TM 47

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
              +     L +  I A LG+  +L+ R+  + A  A  +F++Y+ L G++LS  F+ YT
Sbjct: 48  LRIVFGNQALFFGLIIAELGLVFYLSARIQKIEATTATALFIIYAMLNGVTLSFIFIAYT 107

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDL 194
           + SI  TFF+ AA+FG  S+YG  TK+DL  +G FM MG  G+ + S+VN+F+RS A+++
Sbjct: 108 AASIASTFFVCAATFGVCSIYGMVTKKDLTSVGQFMFMGLIGIIIASVVNIFLRSPAMNM 167

Query: 195 TMSAMGLVIFSALTAYDTQKIKEAYS---DRYDVAYAERQSVIGALMLYMDFIQIFVHLL 251
            +S +G+ +F  LTAYDTQK+K       +  D A A + +++GAL LY+DFI +F+ LL
Sbjct: 168 IISYIGVFVFVGLTAYDTQKLKHMALTQPEGLDPAVARKGAIMGALTLYLDFINMFLFLL 227

Query: 252 RFLGSRRD 259
           R LG+ RD
Sbjct: 228 RILGASRD 235


>gi|269139687|ref|YP_003296388.1| hypothetical protein ETAE_2342 [Edwardsiella tarda EIB202]
 gi|267985348|gb|ACY85177.1| hypothetical protein ETAE_2342 [Edwardsiella tarda EIB202]
 gi|304559556|gb|ADM42220.1| Putative membrane protein [Edwardsiella tarda FL6-60]
          Length = 236

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 92/254 (36%), Positives = 140/254 (55%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   +     +    G++AYM +VY  M  GL +T ++++        ++   A+ ++
Sbjct: 1   MDRYPRTNGTLAARAGSGIQAYMAQVYGWMCCGLLLTALVAWYAARTPAVLNLIFANKMV 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G +   S                    ++ LS  AA  +F+LYS L GL+L
Sbjct: 61  FFGLIIVQLGVVFVLSG------------------MVNRLSGAAATSLFMLYSLLTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+VYT  SI  TF ++A  FG++SLYGYTTKRDL  +GS + M   GL L SLVN++
Sbjct: 103 SSIFIVYTYSSIASTFVVSAGMFGAMSLYGYTTKRDLSGMGSMLFMALIGLVLASLVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++SSA+   ++  G++IF  LTAYDTQK++         D     R +++GAL LY+DFI
Sbjct: 163 LKSSALTWIVTYAGVLIFVGLTAYDTQKLRVMGEQLSADDRDGFRRYAIMGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G RR
Sbjct: 223 NLFLMLLRIFGDRR 236


>gi|237707256|ref|ZP_04537737.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|226898466|gb|EEH84725.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
          Length = 234

 Score =  124 bits (310), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 91/238 (38%), Positives = 138/238 (57%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++     A  ++    + +   G+++          
Sbjct: 15  AGLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 65  --------AQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++S YGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 117 VVTAGMFGAMSRYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|238920523|ref|YP_002934038.1| hypothetical protein NT01EI_2635 [Edwardsiella ictaluri 93-146]
 gi|238870092|gb|ACR69803.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 236

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 91/254 (35%), Positives = 140/254 (55%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   +     +    G++AYM +VY  M  GL +T ++++        ++   A+ ++
Sbjct: 1   MDRYPRTNDTLVARAGSGIQAYMAQVYGWMCCGLLLTALVAWYAARTPAVLNLIFANKMV 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G +   S                    ++ LS  AA  +F+LYS L GL+L
Sbjct: 61  FFGLIIVQLGVVFVLSG------------------MVNRLSGAAATSLFMLYSLLTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+VYT  SI  TF ++A  FG++SLYGYTTKRDL  +GS + M   GL L S+VN++
Sbjct: 103 SSIFVVYTYSSIASTFVVSAGMFGAMSLYGYTTKRDLSGMGSMLFMALIGLVLASVVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++SSA+   ++  G++IF  LTAYDTQK++         D     R +++GAL LY+DFI
Sbjct: 163 LKSSALTWIVTYAGVLIFVGLTAYDTQKLRVMGEQLSADDRDGFRRYAIMGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G RR
Sbjct: 223 NLFLMLLRIFGDRR 236


>gi|83949853|ref|ZP_00958586.1| hypothetical protein ISM_02125 [Roseovarius nubinhibens ISM]
 gi|83837752|gb|EAP77048.1| hypothetical protein ISM_02125 [Roseovarius nubinhibens ISM]
          Length = 239

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 97/257 (37%), Positives = 156/257 (60%), Gaps = 22/257 (8%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  +  +        + ID+GLRA+M +VY  M++G+ +T + ++ V   A  ++     
Sbjct: 1   MAQFDTIRTRAGAQAAAIDEGLRAHMSKVYGTMSVGMLLTFLAAWAVGNNAAMME----- 55

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                         +++T   R+I +FAPL +       ++ LSA AA++ F  ++AL+G
Sbjct: 56  --------------VLFTGFTRYIVMFAPLIMVFAFGAVINRLSAAAAQLFFYAFAALMG 101

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +S+S  F+V+T  SI Q FF TAA+FG LSL+GYTTK+D+   GSF+IMG  GL + S+V
Sbjct: 102 VSISYIFVVFTDMSIAQVFFATAAAFGGLSLWGYTTKKDISGWGSFLIMGVIGLIVASIV 161

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLY 240
           N+F+ S  + + +SA+G++IF+ LTAYDTQ IK  Y   +   D  +  + +++GAL LY
Sbjct: 162 NIFLGSGVVSMAISAIGVLIFAGLTAYDTQNIKNTYIAHAAHGDSEWLGKSAIMGALNLY 221

Query: 241 MDFIQIFVHLLRFLGSR 257
           ++FI +F+ LL  LGSR
Sbjct: 222 LNFINMFMMLLNLLGSR 238


>gi|51473346|ref|YP_067103.1| hypothetical protein RT0136 [Rickettsia typhi str. Wilmington]
 gi|51459658|gb|AAU03621.1| conserved hypothetical protein (integral membrane protein)
           [Rickettsia typhi str. Wilmington]
          Length = 236

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 97/247 (39%), Positives = 149/247 (60%), Gaps = 19/247 (7%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
           + +    T D+GLR YM++VYN MAL L +TG+ +     +                   
Sbjct: 9   TTTSKNKTFDEGLRRYMLKVYNYMALALLLTGVAAITTISVEPIY--------------- 53

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
                LM+ +    I +FAPLG+ ++  +    ++   A+++F +Y+ L G+SLS   L+
Sbjct: 54  ----HLMFQTGFGTIIMFAPLGIALYFFMGFGRMNLQTAQILFWVYAGLTGMSLSYLALI 109

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT  SI +TFFI ++ FG++SLYGY+T RDL  +GSF  MG  GL + SLVNLF++SS++
Sbjct: 110 YTGTSIARTFFICSSVFGAMSLYGYSTNRDLTSMGSFFAMGLIGLIIASLVNLFLKSSSL 169

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
               S +G+V+F  L A+DTQKIK  Y    + A  ++ S++ A  LY+DFI +F++L+R
Sbjct: 170 SFATSLIGIVVFMGLIAWDTQKIKSMYYIAGNDAAGQKLSIMAAFTLYLDFINLFLNLMR 229

Query: 253 FLGSRRD 259
           FLG+RRD
Sbjct: 230 FLGNRRD 236


>gi|315185953|gb|EFU19717.1| protein of unknown function UPF0005 [Spirochaeta thermophila DSM
           6578]
          Length = 234

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 93/238 (39%), Positives = 135/238 (56%), Gaps = 20/238 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
            L+  +  +Y  M  GL +TG++S  V                      T          
Sbjct: 15  ALQRILTNIYLWMTGGLALTGVVSLGVASSP------------------TLLRTFFSNPL 56

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           + ++ I   L +  +L++R+  +S +AA + F  YSAL G++L+  FLVYT  SI Q FF
Sbjct: 57  IFFLLIGGELALVFYLSLRIQKMSPFAATVAFASYSALNGVTLAPLFLVYTGTSIAQVFF 116

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           ITAA+F  +S YGY TKRDL  +GS + M  +GL + SLVN+F+RS    L +S +G++I
Sbjct: 117 ITAATFAGMSAYGYLTKRDLSRVGSIVGMALWGLIIASLVNIFLRSEGFSLIISYVGVLI 176

Query: 204 FSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           F  LTAYDTQ +K+  +     D +   R S++GAL LY+DFI +F+ LLR +GSRRD
Sbjct: 177 FVGLTAYDTQILKQWATQIDPSDESVYVRFSIMGALKLYLDFINLFLFLLRIMGSRRD 234


>gi|258570873|ref|XP_002544240.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237904510|gb|EEP78911.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 498

 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 51/264 (19%), Positives = 102/264 (38%), Gaps = 33/264 (12%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQG---LR-AYMIRVYNLMALGLGVTGIMSFLVNILATT 56
           M   R+    V     FG ++ +    +R  ++ +VY+++ + L VT  +S +     + 
Sbjct: 262 MGVPRDEDDNVPDDFKFGGSVAEATLPIRMQFIRKVYSILTVQLLVTAALSGVSFFNNSY 321

Query: 57  VDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFL 116
                A+                       +F+     +   L       S  +  +   
Sbjct: 322 RRWVQANSW--------------------MMFVSVIGALVFMLLTYWKRKSYPSNLLFLS 361

Query: 117 LYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFG 176
            ++ L G ++S     Y S  ++Q   +T   F +L+L+   TK D      ++    + 
Sbjct: 362 AFTLLEGYAISVVTSFYDSAIVMQALVLTLGIFLALTLFACQTKYDFTSWIPYLFGALWF 421

Query: 177 LFLLSLV-NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIG 235
           L L   +   F   S ++L   A+G +IFS     DTQ +   +    +        +  
Sbjct: 422 LVLFGFMSMFFQMGSKMELVYGAIGALIFSGYILVDTQLVMRHHHVEEE--------IAA 473

Query: 236 ALMLYMDFIQIFVHLLRFLGSRRD 259
           ++ LY+D I +F+ +LR L S+ +
Sbjct: 474 SISLYLDVINLFLAILRILNSQSN 497


>gi|16128754|ref|NP_415307.1| inner membrane protein, UPF0005 family [Escherichia coli str. K-12
           substr. MG1655]
 gi|74311330|ref|YP_309749.1| hypothetical protein SSON_0765 [Shigella sonnei Ss046]
 gi|82543233|ref|YP_407180.1| hypothetical protein SBO_0673 [Shigella boydii Sb227]
 gi|89107637|ref|AP_001417.1| predicted inner membrane protein [Escherichia coli str. K-12
           substr. W3110]
 gi|91209817|ref|YP_539803.1| hypothetical protein UTI89_C0786 [Escherichia coli UTI89]
 gi|110640990|ref|YP_668718.1| hypothetical protein ECP_0800 [Escherichia coli 536]
 gi|110804787|ref|YP_688307.1| hypothetical protein SFV_0769 [Shigella flexneri 5 str. 8401]
 gi|117622968|ref|YP_851881.1| hypothetical protein APECO1_1304 [Escherichia coli APEC O1]
 gi|157158723|ref|YP_001461974.1| hypothetical protein EcE24377A_0849 [Escherichia coli E24377A]
 gi|157160261|ref|YP_001457579.1| hypothetical protein EcHS_A0840 [Escherichia coli HS]
 gi|170020858|ref|YP_001725812.1| hypothetical protein EcolC_2857 [Escherichia coli ATCC 8739]
 gi|170080445|ref|YP_001729765.1| inner membrane protein [Escherichia coli str. K-12 substr. DH10B]
 gi|187733215|ref|YP_001881028.1| hypothetical protein SbBS512_E2566 [Shigella boydii CDC 3083-94]
 gi|188493130|ref|ZP_03000400.1| putative membrane protein [Escherichia coli 53638]
 gi|191169282|ref|ZP_03031032.1| putative membrane protein [Escherichia coli B7A]
 gi|191174497|ref|ZP_03035996.1| putative membrane protein [Escherichia coli F11]
 gi|193064456|ref|ZP_03045537.1| putative membrane protein [Escherichia coli E22]
 gi|193069370|ref|ZP_03050325.1| putative membrane protein [Escherichia coli E110019]
 gi|194428198|ref|ZP_03060741.1| putative membrane protein [Escherichia coli B171]
 gi|194438436|ref|ZP_03070526.1| putative membrane protein [Escherichia coli 101-1]
 gi|209918031|ref|YP_002292115.1| hypothetical protein ECSE_0840 [Escherichia coli SE11]
 gi|215485874|ref|YP_002328305.1| predicted inner membrane protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218553369|ref|YP_002386282.1| hypothetical protein ECIAI1_0821 [Escherichia coli IAI1]
 gi|218557691|ref|YP_002390604.1| hypothetical protein ECS88_0803 [Escherichia coli S88]
 gi|218688572|ref|YP_002396784.1| hypothetical protein ECED1_0751 [Escherichia coli ED1a]
 gi|218694259|ref|YP_002401926.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli 55989]
 gi|218704164|ref|YP_002411683.1| hypothetical protein ECUMN_0929 [Escherichia coli UMN026]
 gi|238900045|ref|YP_002925841.1| putative inner membrane protein [Escherichia coli BW2952]
 gi|253774211|ref|YP_003037042.1| hypothetical protein ECBD_2837 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160863|ref|YP_003043971.1| putative inner membrane protein [Escherichia coli B str. REL606]
 gi|256021144|ref|ZP_05435009.1| predicted inner membrane protein [Shigella sp. D9]
 gi|256023618|ref|ZP_05437483.1| predicted inner membrane protein [Escherichia sp. 4_1_40B]
 gi|260843028|ref|YP_003220806.1| putative inner membrane protein [Escherichia coli O103:H2 str.
           12009]
 gi|260854077|ref|YP_003227968.1| putative inner membrane protein [Escherichia coli O26:H11 str.
           11368]
 gi|260866953|ref|YP_003233355.1| putative inner membrane protein [Escherichia coli O111:H- str.
           11128]
 gi|293404087|ref|ZP_06648081.1| inner membrane protein ybhL [Escherichia coli FVEC1412]
 gi|293409164|ref|ZP_06652740.1| conserved hypothetical protein [Escherichia coli B354]
 gi|298379868|ref|ZP_06989473.1| inner membrane protein ybhL [Escherichia coli FVEC1302]
 gi|306812812|ref|ZP_07447005.1| putative inner membrane protein [Escherichia coli NC101]
 gi|307137410|ref|ZP_07496766.1| putative inner membrane protein [Escherichia coli H736]
 gi|307313804|ref|ZP_07593421.1| protein of unknown function UPF0005 [Escherichia coli W]
 gi|331641299|ref|ZP_08342434.1| inner membrane protein YbhL [Escherichia coli H736]
 gi|331656803|ref|ZP_08357765.1| inner membrane protein YbhL [Escherichia coli TA206]
 gi|331662141|ref|ZP_08363064.1| inner membrane protein YbhL [Escherichia coli TA143]
 gi|331667149|ref|ZP_08368014.1| inner membrane protein YbhL [Escherichia coli TA271]
 gi|331676520|ref|ZP_08377216.1| inner membrane protein YbhL [Escherichia coli H591]
 gi|331682293|ref|ZP_08382912.1| inner membrane protein YbhL [Escherichia coli H299]
 gi|332282371|ref|ZP_08394784.1| inner membrane protein [Shigella sp. D9]
 gi|84027847|sp|P0AAC4|YBHL_ECOLI RecName: Full=Inner membrane protein YbhL
 gi|85700282|sp|P0AAC5|YBHL_ECOL6 RecName: Full=Inner membrane protein YbhL
 gi|1787004|gb|AAC73873.1| inner membrane protein, UPF0005 family [Escherichia coli str. K-12
           substr. MG1655]
 gi|4062342|dbj|BAA35444.1| predicted inner membrane protein [Escherichia coli str. K12 substr.
           W3110]
 gi|73854807|gb|AAZ87514.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|81244644|gb|ABB65352.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|91071391|gb|ABE06272.1| hypothetical protein UTI89_C0786 [Escherichia coli UTI89]
 gi|110342582|gb|ABG68819.1| putative membrane protein [Escherichia coli 536]
 gi|110614335|gb|ABF03002.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
 gi|115512092|gb|ABJ00167.1| conserved hypothetical protein YbhL [Escherichia coli APEC O1]
 gi|157065941|gb|ABV05196.1| putative membrane protein [Escherichia coli HS]
 gi|157080753|gb|ABV20461.1| putative membrane protein [Escherichia coli E24377A]
 gi|169755786|gb|ACA78485.1| protein of unknown function UPF0005 [Escherichia coli ATCC 8739]
 gi|169888280|gb|ACB01987.1| predicted inner membrane protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|187430207|gb|ACD09481.1| putative membrane protein [Shigella boydii CDC 3083-94]
 gi|188488329|gb|EDU63432.1| putative membrane protein [Escherichia coli 53638]
 gi|190900671|gb|EDV60470.1| putative membrane protein [Escherichia coli B7A]
 gi|190905210|gb|EDV64850.1| putative membrane protein [Escherichia coli F11]
 gi|192928918|gb|EDV82531.1| putative membrane protein [Escherichia coli E22]
 gi|192957323|gb|EDV87771.1| putative membrane protein [Escherichia coli E110019]
 gi|194413758|gb|EDX30037.1| putative membrane protein [Escherichia coli B171]
 gi|194422660|gb|EDX38657.1| putative membrane protein [Escherichia coli 101-1]
 gi|209911290|dbj|BAG76364.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215263946|emb|CAS08286.1| predicted inner membrane protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218350991|emb|CAU96695.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli 55989]
 gi|218360137|emb|CAQ97686.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli IAI1]
 gi|218364460|emb|CAR02142.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli S88]
 gi|218426136|emb|CAR06956.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli ED1a]
 gi|218431261|emb|CAR12138.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli UMN026]
 gi|222032517|emb|CAP75256.1| Inner membrane protein ybhL [Escherichia coli LF82]
 gi|238862537|gb|ACR64535.1| predicted inner membrane protein [Escherichia coli BW2952]
 gi|242376578|emb|CAQ31287.1| predicted inner membrane protein [Escherichia coli BL21(DE3)]
 gi|253325255|gb|ACT29857.1| protein of unknown function UPF0005 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972764|gb|ACT38435.1| predicted inner membrane protein [Escherichia coli B str. REL606]
 gi|253976984|gb|ACT42654.1| predicted inner membrane protein [Escherichia coli BL21(DE3)]
 gi|257752726|dbj|BAI24228.1| predicted inner membrane protein [Escherichia coli O26:H11 str.
           11368]
 gi|257758175|dbj|BAI29672.1| predicted inner membrane protein [Escherichia coli O103:H2 str.
           12009]
 gi|257763309|dbj|BAI34804.1| predicted inner membrane protein [Escherichia coli O111:H- str.
           11128]
 gi|260450067|gb|ACX40489.1| protein of unknown function UPF0005 [Escherichia coli DH1]
 gi|281177922|dbj|BAI54252.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|291428673|gb|EFF01698.1| inner membrane protein ybhL [Escherichia coli FVEC1412]
 gi|291469632|gb|EFF12116.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294489671|gb|ADE88427.1| putative membrane protein [Escherichia coli IHE3034]
 gi|298279566|gb|EFI21074.1| inner membrane protein ybhL [Escherichia coli FVEC1302]
 gi|305853575|gb|EFM54014.1| putative inner membrane protein [Escherichia coli NC101]
 gi|306906444|gb|EFN36958.1| protein of unknown function UPF0005 [Escherichia coli W]
 gi|307552631|gb|ADN45406.1| inner membrane protein [Escherichia coli ABU 83972]
 gi|307627804|gb|ADN72108.1| putative inner membrane protein [Escherichia coli UM146]
 gi|309701062|emb|CBJ00360.1| putative membrane protein [Escherichia coli ETEC H10407]
 gi|312945304|gb|ADR26131.1| putative inner membrane protein [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315060022|gb|ADT74349.1| predicted inner membrane protein [Escherichia coli W]
 gi|315135436|dbj|BAJ42595.1| YbhL protein [Escherichia coli DH1]
 gi|320183275|gb|EFW58130.1| Putative membrane protein [Shigella flexneri CDC 796-83]
 gi|320198975|gb|EFW73572.1| Putative membrane protein [Escherichia coli EC4100B]
 gi|323155693|gb|EFZ41864.1| hypothetical protein ECEPECA14_2410 [Escherichia coli EPECa14]
 gi|323175596|gb|EFZ61191.1| hypothetical protein ECOK1180_5881 [Escherichia coli 1180]
 gi|323938141|gb|EGB34401.1| inner membrane protein ybhL [Escherichia coli E1520]
 gi|323942659|gb|EGB38824.1| inner membrane protein ybhL [Escherichia coli E482]
 gi|323947057|gb|EGB43070.1| inner membrane protein ybhL [Escherichia coli H120]
 gi|323953551|gb|EGB49417.1| inner membrane protein ybhL [Escherichia coli H252]
 gi|323958075|gb|EGB53784.1| inner membrane protein ybhL [Escherichia coli H263]
 gi|323963033|gb|EGB58604.1| inner membrane protein ybhL [Escherichia coli H489]
 gi|323971951|gb|EGB67172.1| inner membrane protein ybhL [Escherichia coli TA007]
 gi|324116209|gb|EGC10131.1| inner membrane protein ybhL [Escherichia coli E1167]
 gi|330910531|gb|EGH39041.1| putative membrane protein [Escherichia coli AA86]
 gi|331038097|gb|EGI10317.1| inner membrane protein YbhL [Escherichia coli H736]
 gi|331055051|gb|EGI27060.1| inner membrane protein YbhL [Escherichia coli TA206]
 gi|331060563|gb|EGI32527.1| inner membrane protein YbhL [Escherichia coli TA143]
 gi|331065505|gb|EGI37398.1| inner membrane protein YbhL [Escherichia coli TA271]
 gi|331075209|gb|EGI46507.1| inner membrane protein YbhL [Escherichia coli H591]
 gi|331079924|gb|EGI51103.1| inner membrane protein YbhL [Escherichia coli H299]
 gi|332104723|gb|EGJ08069.1| inner membrane protein [Shigella sp. D9]
 gi|333020437|gb|EGK39700.1| hypothetical protein SFK227_0951 [Shigella flexneri K-227]
          Length = 234

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 92/238 (38%), Positives = 139/238 (58%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++     A  ++    + +   G+++          
Sbjct: 15  AGLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 65  --------AQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 117 VVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|291241676|ref|XP_002740736.1| PREDICTED: fas apoptotic inhibitory molecule 2-like [Saccoglossus
           kowalevskii]
          Length = 601

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 44/245 (17%), Positives = 88/245 (35%), Gaps = 22/245 (8%)

Query: 15  SGFGSTIDQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
           +   S  D  +R  ++ +VY ++ + L VT  +  L        D    +          
Sbjct: 95  TSENSFSDMNVRNGFIRKVYLILMVQLLVTFAVVCLFVFSEPMCDFVQDNPGFYFASYAV 154

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
                +  +    +                    +    ++  L++  +   + +    Y
Sbjct: 155 FLVCFIALACCGDLR-----------------RKSPTNLILLALFTLSLSYMVGTISSFY 197

Query: 134 TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAID 193
            +KS++    I A    S+SL+   TK D       +      LF      +  RS  + 
Sbjct: 198 ETKSVLIALGICAGVCLSVSLFSIQTKYDFTSCAGVLFACCMCLFFFGFFCIIFRSEILQ 257

Query: 194 LTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
           +  + +G ++F+   AYDTQ I          A +  + +  AL LY+D + IF+ +L  
Sbjct: 258 VVYAGLGAILFTLFLAYDTQLII----GNKRYAISPEEYIFAALNLYIDIVYIFLFILSL 313

Query: 254 LGSRR 258
            G ++
Sbjct: 314 FGGKK 318


>gi|270260814|ref|ZP_06189087.1| hypothetical protein SOD_a00390 [Serratia odorifera 4Rx13]
 gi|270044298|gb|EFA17389.1| hypothetical protein SOD_a00390 [Serratia odorifera 4Rx13]
          Length = 236

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 92/254 (36%), Positives = 140/254 (55%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S        + G++AYM +VY  M  GL +T  +S+        ++   +S I 
Sbjct: 1   MDRYPRSNGSIVERANSGIQAYMAQVYGWMTCGLLLTAFVSWYAANTPAILNFIFSSQIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++                  A L +   ++  ++ LS   A  +F+LYSAL GL+L
Sbjct: 61  FFGLII------------------AQLALVFVISGMVNRLSGTVATSLFMLYSALTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+ YT  SI  TF +TA  FG++SLYGYTTKRDL   GS + M   G+ L SLVN++
Sbjct: 103 SSIFIAYTYSSIASTFVVTAGMFGAMSLYGYTTKRDLSGFGSMLFMALIGIVLASLVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++S+A+   ++ +G+++F  LTAYDTQK+K         D     + +++GAL LY+DFI
Sbjct: 163 LKSTALMWAITYIGVLVFVGLTAYDTQKLKAMGEQLNADDKDSFRKYAIVGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|294011230|ref|YP_003544690.1| putative integral membrane protein [Sphingobium japonicum UT26S]
 gi|292674560|dbj|BAI96078.1| putative integral membrane protein [Sphingobium japonicum UT26S]
          Length = 245

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 108/248 (43%), Positives = 155/248 (62%), Gaps = 18/248 (7%)

Query: 12  NSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVM 71
            +    G   D GLR+YM+ VYN MA G+ +TG+++ L           A   I+     
Sbjct: 16  GATVARGEAYDAGLRSYMLSVYNYMASGVLLTGVVAMLFASSGLAYQILAGPGIL----- 70

Query: 72  LTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFL 131
                        +++ +FAPL   + ++  ++ LS +A + MF  Y+A++GLSLSS  L
Sbjct: 71  -------------KYVIMFAPLLFVMTMSFGINRLSTFAMQAMFWAYAAVMGLSLSSILL 117

Query: 132 VYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSA 191
           VYT  S+ QTFF TAA+F  LSL+GYTTKRDL   G+F+IMG  GL + SL+NLF+RSSA
Sbjct: 118 VYTGTSVAQTFFATAAAFAGLSLWGYTTKRDLSGFGTFLIMGVVGLLVASLINLFLRSSA 177

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLL 251
           ++L +S +G+++F+ LTAYDTQKIK  Y+         +  V+GAL LY+DFI +F+ LL
Sbjct: 178 MNLVISFIGVLLFAGLTAYDTQKIKSIYAHVAGTDMMGKSVVMGALNLYLDFINMFLFLL 237

Query: 252 RFLGSRRD 259
           RF+GS+RD
Sbjct: 238 RFMGSQRD 245


>gi|218549650|ref|YP_002383441.1| hypothetical protein EFER_2325 [Escherichia fergusonii ATCC 35469]
 gi|218357191|emb|CAQ89826.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia fergusonii ATCC 35469]
 gi|324114350|gb|EGC08319.1| inner membrane protein ybhL [Escherichia fergusonii B253]
 gi|325498043|gb|EGC95902.1| hypothetical protein ECD227_2140 [Escherichia fergusonii ECD227]
          Length = 234

 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 91/238 (38%), Positives = 136/238 (57%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M  GL +T  +++     A  ++    + +   G+++          
Sbjct: 15  SGLQTYMAQVYGWMTAGLLLTAFVAWYAANSAALMELLFTNRVFLIGLVI---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + I L+  +  LSA     +F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 65  --------AQLALVIVLSAMIQKLSAGVTTTLFMLYSALTGLTLSSIFIVYTAASIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG +SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 117 VVTAGMFGVMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|157128927|ref|XP_001661552.1| nmda receptor glutamate-binding chain [Aedes aegypti]
 gi|108872427|gb|EAT36652.1| nmda receptor glutamate-binding chain [Aedes aegypti]
          Length = 319

 Score =  123 bits (308), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 51/259 (19%), Positives = 104/259 (40%), Gaps = 22/259 (8%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPD 60
            +  NY     S  GF  +     + ++ +VY+++ + LG+T G ++  +    T     
Sbjct: 82  GNYSNYDPEDQSAKGFDFSDQSIRKGFIRKVYSILTVQLGITLGFIALFMYHKGT----- 136

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
              +  +  +     G ++ T             +            A    +   LY+ 
Sbjct: 137 KLWVQRHPEMFWIALGVMIVT-------------LISMACCGNVRRKAPMNFIFLALYTF 183

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
                L      ++S  ++    ITAA    L+L+ + +K D   +G  + +    L L 
Sbjct: 184 AQSFLLGVTTANFSSDEVLLAVGITAAVCLGLTLFAFQSKWDFTVMGGVLFVAVIILMLF 243

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            ++ +F     I +  ++ G ++FS    YDTQ +       +  + +  + +  AL LY
Sbjct: 244 GIIAIFFPGKTITIVYASAGALLFSIYLIYDTQLMM---GGEHKYSISPEEYIFAALNLY 300

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +D I IF+++L  +G+ RD
Sbjct: 301 LDIINIFMYILTIIGASRD 319


>gi|296227073|ref|XP_002759199.1| PREDICTED: glutamate [NMDA] receptor-associated protein 1-like
           [Callithrix jacchus]
          Length = 371

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 38/239 (15%), Positives = 97/239 (40%), Gaps = 22/239 (9%)

Query: 22  DQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           D+ +R A++ +V+ ++ L L VT     +   +         ++          F +L+ 
Sbjct: 154 DKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVGEVKGFVRQNVWTYYVSYAVFFISLVV 213

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S                              +   + +A +   +      Y +++++ 
Sbjct: 214 LSC-----------------CGDFRRKHPWNLVALSVLTASLSYMVGMIASFYNTEAVIM 256

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              IT     ++ ++   T+ D       +++    LF+ +++ +F+R+  +++  +++G
Sbjct: 257 AVGITTVVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLG 316

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++F+   A DTQ +         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 317 ALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 371


>gi|299142122|ref|ZP_07035255.1| membrane protein [Prevotella oris C735]
 gi|298576211|gb|EFI48084.1| membrane protein [Prevotella oris C735]
          Length = 244

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 74/254 (29%), Positives = 126/254 (49%), Gaps = 17/254 (6%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N +            + +   A M +VY  M L L ++GI+++ V      +     + +
Sbjct: 7   NERIREQEYGTNDMVLSEAFPALMRKVYLWMTLALAISGIVAYGVATSPNLLYLIYTNQL 66

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           +  G+++T    +   S   W                  + S  A  +MF  ++AL G +
Sbjct: 67  VFWGLIITELVLVWKISGSIWK----------------ENRSLAATTLMFATFAALNGAT 110

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           LS  F+ +   +I++TFFIT+ +F   S YGY TK+DL   GSF+ M   GL +  + N+
Sbjct: 111 LSYIFIRFAPTAIIKTFFITSGTFAVTSAYGYFTKKDLSKWGSFLFMALDGLIIALVANI 170

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYD-VAYAERQSVIGALMLYMDFI 244
           F +SS +D  +S  G+++F  LT +D+Q IK   +   D    +++ ++ GAL LY+DFI
Sbjct: 171 FFKSSMLDFIISIAGVLLFVGLTIWDSQNIKRQLAVAPDMSETSQKIALCGALDLYLDFI 230

Query: 245 QIFVHLLRFLGSRR 258
            +F++LLR  G   
Sbjct: 231 NLFIYLLRLFGRDN 244


>gi|114769357|ref|ZP_01446983.1| hypothetical protein OM2255_06485 [alpha proteobacterium HTCC2255]
 gi|114550274|gb|EAU53155.1| hypothetical protein OM2255_06485 [alpha proteobacterium HTCC2255]
          Length = 238

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 108/260 (41%), Positives = 154/260 (59%), Gaps = 26/260 (10%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D +   R           ID+GLRA+M  VY +M+ G+  TGI+++L           
Sbjct: 1   MADYQTINR----AGTTALEIDEGLRAHMSSVYGIMSAGMATTGIVAYLTGQNDA----- 51

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                           A ++T  LRW  +FAPL +  FL   ++ LS   A++ F+ +SA
Sbjct: 52  --------------LLATLFTGGLRWAVMFAPLIMVFFLGSMINRLSQTGARLAFITFSA 97

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLS+S  F VYT  SI QTFF TA +FG LSLYGYTTKRD+   GSF+IMG  GL + 
Sbjct: 98  LMGLSISWIFAVYTGISITQTFFTTAIAFGGLSLYGYTTKRDISGWGSFLIMGVIGLIVA 157

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSVIGAL 237
           S++N++M SSA+   +S +GL+IF+ LTAYDTQKIK  Y   +      +  + +++GAL
Sbjct: 158 SILNIWMASSAMTFAISVIGLLIFAGLTAYDTQKIKNTYIAMASNGQTDWLGKAAIMGAL 217

Query: 238 MLYMDFIQIFVHLLRFLGSR 257
            LY+DF+ +F+ LL F+G R
Sbjct: 218 SLYLDFLNMFMFLLHFMGGR 237


>gi|157369568|ref|YP_001477557.1| hypothetical protein Spro_1325 [Serratia proteamaculans 568]
 gi|157321332|gb|ABV40429.1| protein of unknown function UPF0005 [Serratia proteamaculans 568]
          Length = 236

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 93/254 (36%), Positives = 138/254 (54%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S        + G++AYM +VY  M  G+ +T  +S+        ++   +S I 
Sbjct: 1   MDRYPRSNGSIVERANSGIQAYMAQVYGWMTCGMLLTAFVSWYAANTPAILNFIFSSQIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G +   S                    ++ LS   A  +F+LYSAL GL+L
Sbjct: 61  FFGLIIAQLGLVFVISG------------------MVNRLSGTVATSLFMLYSALTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+ YT  SI  TF +TA  FG++SLYGYTTKRDL   GS + M   G+ L SLVN++
Sbjct: 103 SSIFIAYTYSSIASTFVVTAGMFGAMSLYGYTTKRDLSGFGSMLFMALIGIVLASLVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++SSA+   ++ +G+V+F  LTAYDTQK+K         D     + +++GAL LY+DFI
Sbjct: 163 LKSSALMWAITYIGVVVFVGLTAYDTQKLKAMGEQLNADDKDSFRKYAIVGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|332342118|gb|AEE55452.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 234

 Score =  123 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 92/238 (38%), Positives = 139/238 (58%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++     A  ++    + +   G+++          
Sbjct: 15  AGLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 65  --------AQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 117 VVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|312374513|gb|EFR22056.1| hypothetical protein AND_15831 [Anopheles darlingi]
          Length = 319

 Score =  123 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 52/253 (20%), Positives = 95/253 (37%), Gaps = 20/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y     S  GF        R ++ +VY+++ + L +T     L      T         +
Sbjct: 87  YDPETGSVKGFEFNDQSIRRGFIRKVYSILTVQLLITLGFISLFLYHRPTQLWVKNHPEM 146

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
               +      L+  +    +                    A    +   L++      L
Sbjct: 147 FWIALGVMIVTLISMACCGDVR-----------------RKAPMNFIFLTLFTLAQAFLL 189

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           +     + S+ ++    ITAA    L+L+ + TK D   +G  + +    L L  LV +F
Sbjct: 190 AVTSANFNSQEVMLAVGITAAVCLGLTLFAFQTKWDFTVMGGILFVAVLVLMLFGLVAIF 249

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
                I L  ++ G +IFS    YDTQ         +  + +  + +  AL LY+D + I
Sbjct: 250 FPGKTITLVYASAGALIFSIYLVYDTQL---MLGGSHKYSISPEEYIFAALNLYLDIVNI 306

Query: 247 FVHLLRFLGSRRD 259
           F+++L  +G+ RD
Sbjct: 307 FLYILTIIGASRD 319


>gi|15800537|ref|NP_286549.1| hypothetical protein Z1005 [Escherichia coli O157:H7 EDL933]
 gi|15830118|ref|NP_308891.1| hypothetical protein ECs0864 [Escherichia coli O157:H7 str. Sakai]
 gi|168752004|ref|ZP_02777026.1| putative membrane protein [Escherichia coli O157:H7 str. EC4113]
 gi|168757129|ref|ZP_02782136.1| putative membrane protein [Escherichia coli O157:H7 str. EC4401]
 gi|168764311|ref|ZP_02789318.1| putative membrane protein [Escherichia coli O157:H7 str. EC4501]
 gi|168767286|ref|ZP_02792293.1| putative membrane protein [Escherichia coli O157:H7 str. EC4486]
 gi|168777235|ref|ZP_02802242.1| putative membrane protein [Escherichia coli O157:H7 str. EC4196]
 gi|168779329|ref|ZP_02804336.1| putative membrane protein [Escherichia coli O157:H7 str. EC4076]
 gi|168786999|ref|ZP_02812006.1| putative membrane protein [Escherichia coli O157:H7 str. EC869]
 gi|168799941|ref|ZP_02824948.1| putative membrane protein [Escherichia coli O157:H7 str. EC508]
 gi|195936826|ref|ZP_03082208.1| hypothetical protein EscherichcoliO157_10240 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208808114|ref|ZP_03250451.1| putative membrane protein [Escherichia coli O157:H7 str. EC4206]
 gi|208815304|ref|ZP_03256483.1| putative membrane protein [Escherichia coli O157:H7 str. EC4045]
 gi|208822458|ref|ZP_03262777.1| putative membrane protein [Escherichia coli O157:H7 str. EC4042]
 gi|209400563|ref|YP_002269455.1| hypothetical protein ECH74115_0934 [Escherichia coli O157:H7 str.
           EC4115]
 gi|217325457|ref|ZP_03441541.1| putative membrane protein [Escherichia coli O157:H7 str. TW14588]
 gi|254791980|ref|YP_003076817.1| putative inner membrane protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|261225433|ref|ZP_05939714.1| predicted inner membrane protein [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261258598|ref|ZP_05951131.1| predicted inner membrane protein [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291281783|ref|YP_003498601.1| hypothetical protein G2583_1014 [Escherichia coli O55:H7 str.
           CB9615]
 gi|12513775|gb|AAG55157.1|AE005259_8 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|13360323|dbj|BAB34287.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|187767511|gb|EDU31355.1| putative membrane protein [Escherichia coli O157:H7 str. EC4196]
 gi|188014047|gb|EDU52169.1| putative membrane protein [Escherichia coli O157:H7 str. EC4113]
 gi|189002867|gb|EDU71853.1| putative membrane protein [Escherichia coli O157:H7 str. EC4076]
 gi|189355833|gb|EDU74252.1| putative membrane protein [Escherichia coli O157:H7 str. EC4401]
 gi|189363603|gb|EDU82022.1| putative membrane protein [Escherichia coli O157:H7 str. EC4486]
 gi|189365675|gb|EDU84091.1| putative membrane protein [Escherichia coli O157:H7 str. EC4501]
 gi|189373142|gb|EDU91558.1| putative membrane protein [Escherichia coli O157:H7 str. EC869]
 gi|189377780|gb|EDU96196.1| putative membrane protein [Escherichia coli O157:H7 str. EC508]
 gi|208727915|gb|EDZ77516.1| putative membrane protein [Escherichia coli O157:H7 str. EC4206]
 gi|208731952|gb|EDZ80640.1| putative membrane protein [Escherichia coli O157:H7 str. EC4045]
 gi|208737943|gb|EDZ85626.1| putative membrane protein [Escherichia coli O157:H7 str. EC4042]
 gi|209161963|gb|ACI39396.1| putative membrane protein [Escherichia coli O157:H7 str. EC4115]
 gi|209776018|gb|ACI86321.1| hypothetical protein ECs0864 [Escherichia coli]
 gi|209776020|gb|ACI86322.1| hypothetical protein ECs0864 [Escherichia coli]
 gi|209776022|gb|ACI86323.1| hypothetical protein ECs0864 [Escherichia coli]
 gi|209776024|gb|ACI86324.1| hypothetical protein ECs0864 [Escherichia coli]
 gi|209776026|gb|ACI86325.1| hypothetical protein ECs0864 [Escherichia coli]
 gi|217321678|gb|EEC30102.1| putative membrane protein [Escherichia coli O157:H7 str. TW14588]
 gi|254591380|gb|ACT70741.1| predicted inner membrane protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|290761656|gb|ADD55617.1| hypothetical protein G2583_1014 [Escherichia coli O55:H7 str.
           CB9615]
 gi|320192739|gb|EFW67380.1| Putative membrane protein [Escherichia coli O157:H7 str. EC1212]
 gi|320637648|gb|EFX07440.1| hypothetical protein ECO5101_22625 [Escherichia coli O157:H7 str.
           G5101]
 gi|320642774|gb|EFX11975.1| hypothetical protein ECO9389_02381 [Escherichia coli O157:H- str.
           493-89]
 gi|320648230|gb|EFX16885.1| hypothetical protein ECO2687_18486 [Escherichia coli O157:H- str. H
           2687]
 gi|320654067|gb|EFX22135.1| hypothetical protein ECO7815_07629 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320659690|gb|EFX27246.1| hypothetical protein ECO5905_24308 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320664160|gb|EFX31311.1| hypothetical protein ECOSU61_00978 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|326338328|gb|EGD62157.1| Putative membrane protein [Escherichia coli O157:H7 str. 1125]
 gi|326346306|gb|EGD70044.1| Putative membrane protein [Escherichia coli O157:H7 str. 1044]
          Length = 234

 Score =  123 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 91/238 (38%), Positives = 138/238 (57%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++     A  ++    + +   G+++          
Sbjct: 15  AGLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 65  --------AQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 117 VVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + S++ AL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNMGEQIDTRDASNLRKYSILCALTLYLDFINLFLMLLRIFGNRR 234


>gi|194376622|dbj|BAG57457.1| unnamed protein product [Homo sapiens]
          Length = 351

 Score =  123 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 40/239 (16%), Positives = 99/239 (41%), Gaps = 22/239 (9%)

Query: 22  DQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           D+ +R A++ +V+ ++ L L VT     +   +A        ++          F +L+ 
Sbjct: 134 DKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVRENVWTYYVSYAVFFISLIV 193

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S                              +   + +A +   +      Y +++++ 
Sbjct: 194 LSC-----------------CGDFRRKHPWNLVALSVLTASLSYMVGMIASFYNTEAVIM 236

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              IT A   ++ ++   T+ D       +++    LF+ +++ +F+R+  +++  +++G
Sbjct: 237 AVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLG 296

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++F+   A DTQ +         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 297 ALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 351


>gi|114622146|ref|XP_520009.2| PREDICTED: glutamate [NMDA] receptor-associated protein 1 isoform 4
           [Pan troglodytes]
          Length = 371

 Score =  123 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 40/239 (16%), Positives = 99/239 (41%), Gaps = 22/239 (9%)

Query: 22  DQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           D+ +R A++ +V+ ++ L L VT     +   +A        ++          F +L+ 
Sbjct: 154 DKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVRENVWTYYVSYAVFFISLIV 213

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S                              +   + +A +   +      Y +++++ 
Sbjct: 214 LSC-----------------CGDFRRKHPWNLVALSVLTASLSYMVGMIASFYNTEAVIM 256

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              IT A   ++ ++   T+ D       +++    LF+ +++ +F+R+  +++  +++G
Sbjct: 257 AVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLG 316

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++F+   A DTQ +         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 317 ALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 371


>gi|295096524|emb|CBK85614.1| Integral membrane protein, interacts with FtsH [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 235

 Score =  123 bits (307), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 96/252 (38%), Positives = 137/252 (54%), Gaps = 20/252 (7%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
                          GL+ YM +VY  M +GL +T  +++        +    +S I   
Sbjct: 2   DRFPRSDSIVQQTRSGLQTYMAQVYGWMTVGLLLTAFIAWYAANTPELMMFIFSSKITFF 61

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
           G+++                  A L +   L+  +H LSA  A  +F+LYSAL GL+LSS
Sbjct: 62  GLII------------------AQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSS 103

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            F+VYT  SI  TF +T   FG +SLYGYTTKRDL   G+ + MG  G+ L SLVNL+++
Sbjct: 104 IFIVYTYSSIASTFVVTGGMFGVMSLYGYTTKRDLSGFGNMLFMGLIGIVLASLVNLWLK 163

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQI 246
           S A+   ++ +G+VIF  LTAYDTQK+K         D +   + S++GAL LY+DFI +
Sbjct: 164 SDALMWAVTYIGVVIFVGLTAYDTQKLKNIGEQIDVRDSSNLRKYSILGALTLYLDFINL 223

Query: 247 FVHLLRFLGSRR 258
           F+ LLR  G+RR
Sbjct: 224 FLMLLRIFGNRR 235


>gi|242280577|ref|YP_002992706.1| hypothetical protein Desal_3116 [Desulfovibrio salexigens DSM 2638]
 gi|242123471|gb|ACS81167.1| protein of unknown function UPF0005 [Desulfovibrio salexigens DSM
           2638]
          Length = 243

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 91/246 (36%), Positives = 146/246 (59%), Gaps = 11/246 (4%)

Query: 14  GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
            +G  S   + L A+M  +Y+ M+ GL  T  ++++       ++   A       +  T
Sbjct: 6   AAGSVSARPEVLNAFMRGIYSWMSAGLLATAAVAWVTLSTPAVLNLVLAQNPETGAIAPT 65

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
                       W+     +G+  +L++R+  LS+ AA  +F+ YSAL GL+LS+  + Y
Sbjct: 66  ML---------FWVAAIGEIGLVFYLSMRISKLSSGAATGLFMAYSALNGLTLSTILIAY 116

Query: 134 TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAID 193
           T+ SI QTF +TA  FG++SLYG TT++DL  +G+FM+MG FG+ +  +VN FM+SSA+ 
Sbjct: 117 TAASIFQTFLVTAGMFGAMSLYGLTTRKDLTGMGAFMMMGLFGILIAMVVNFFMQSSALT 176

Query: 194 LTMSAMGLVIFSALTAYDTQKIKEA--YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLL 251
             +S +G+ IF+ LTAYD+QK+K+   Y    D     R +++GAL LY+DFI +F+ LL
Sbjct: 177 FAISVLGVFIFAGLTAYDSQKLKDMGEYIPADDATAVRRGTILGALTLYLDFINMFIFLL 236

Query: 252 RFLGSR 257
           R +G+R
Sbjct: 237 RLMGNR 242


>gi|261343452|ref|ZP_05971097.1| membrane protein [Providencia rustigianii DSM 4541]
 gi|282568598|gb|EFB74133.1| membrane protein [Providencia rustigianii DSM 4541]
          Length = 235

 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 88/252 (34%), Positives = 136/252 (53%), Gaps = 21/252 (8%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
           +              G++A+M +VY  M +GL +T  +++        V      ++   
Sbjct: 3   QFDQRNDSLVQNASTGVQAFMSQVYGWMTVGLLLTAFVAWYSLSSGLFVTIATNKVLFFG 62

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
            ++                   A LG+ + L+  L  +S   A  MF+LY+ L GL++S 
Sbjct: 63  MII-------------------AELGLVMGLSFLLPKMSGAIATGMFMLYALLTGLTISV 103

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
              VYT +S+V TF ITA  FG+LS YGYTTKR L  +G+F+ M   GL + SLVN++++
Sbjct: 104 ILAVYTGESVVGTFIITAVMFGALSFYGYTTKRSLTGMGNFLFMALIGLVVASLVNIWLQ 163

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQI 246
           SS +   ++  G+++F+ALTAYDTQK+KE      + D     + S++GAL LY+DFI +
Sbjct: 164 SSMMYWVITYGGVLLFAALTAYDTQKLKEMGEQINQDDRENMRKYSIMGALSLYLDFINL 223

Query: 247 FVHLLRFLGSRR 258
           F+ LLR  G RR
Sbjct: 224 FLMLLRIFGDRR 235


>gi|170680930|ref|YP_001742889.1| hypothetical protein EcSMS35_0809 [Escherichia coli SMS-3-5]
 gi|218699158|ref|YP_002406787.1| hypothetical protein ECIAI39_0762 [Escherichia coli IAI39]
 gi|170518648|gb|ACB16826.1| putative membrane protein [Escherichia coli SMS-3-5]
 gi|218369144|emb|CAR16899.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli IAI39]
          Length = 234

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 93/237 (39%), Positives = 139/237 (58%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++     A  ++    + I   G+++           
Sbjct: 16  GLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRIFLIGLVI----------- 64

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                  A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF 
Sbjct: 65  -------AQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++
Sbjct: 118 VTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIV 177

Query: 204 FSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 178 FVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|157825328|ref|YP_001493048.1| integral membrane protein [Rickettsia akari str. Hartford]
 gi|157799286|gb|ABV74540.1| Integral membrane protein [Rickettsia akari str. Hartford]
          Length = 236

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 97/247 (39%), Positives = 148/247 (59%), Gaps = 19/247 (7%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
           + +    T D+GLR YM++VYN MAL L +TGI +     +    +              
Sbjct: 9   TATSKNKTFDEGLRKYMLKVYNYMALALLLTGITAITTISVEPIYN-------------- 54

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
                LM+ +    + +FAPLG+ ++  +    ++   A+++F +Y+ L G+SL+   LV
Sbjct: 55  -----LMFQTGFGTVIMFAPLGIALYFFMGFGRMNLNTAQILFWVYAGLTGMSLAYLALV 109

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT  SI +TFFI ++ FG++SLYGY T RDL  +GSF  MG  GL + SLVNLF++SSAI
Sbjct: 110 YTGTSIARTFFICSSVFGAMSLYGYNTSRDLTSMGSFFAMGLMGLIIASLVNLFLKSSAI 169

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
               S +G+V+F  L A+DTQKIK  Y    +    ++ S++ A  LY+DFI +F++L++
Sbjct: 170 SFATSLIGIVVFMGLIAWDTQKIKSMYYMAGNDEVGQKFSIMAAFTLYLDFINLFLYLMK 229

Query: 253 FLGSRRD 259
           FLG+RRD
Sbjct: 230 FLGNRRD 236


>gi|30062271|ref|NP_836442.1| hypothetical protein S0777 [Shigella flexneri 2a str. 2457T]
 gi|56479729|ref|NP_706664.2| hypothetical protein SF0736 [Shigella flexneri 2a str. 301]
 gi|30040516|gb|AAP16248.1| hypothetical protein S0777 [Shigella flexneri 2a str. 2457T]
 gi|56383280|gb|AAN42371.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|313650316|gb|EFS14728.1| hypothetical protein SF2457T_1322 [Shigella flexneri 2a str. 2457T]
 gi|332760463|gb|EGJ90752.1| hypothetical protein SF274771_0892 [Shigella flexneri 2747-71]
 gi|332763276|gb|EGJ93518.1| hypothetical protein SFK671_0853 [Shigella flexneri K-671]
 gi|333021200|gb|EGK40456.1| hypothetical protein SFK304_0970 [Shigella flexneri K-304]
          Length = 234

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 92/238 (38%), Positives = 139/238 (58%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++     A  ++    + +   G+++          
Sbjct: 15  AGLQTYMAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 65  --------AQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 117 VVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|291415932|ref|XP_002724203.1| PREDICTED: glutamate receptor, ionotropic, N-methyl
           D-aspartate-associated protein 1 [Oryctolagus cuniculus]
          Length = 361

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 38/239 (15%), Positives = 97/239 (40%), Gaps = 22/239 (9%)

Query: 22  DQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           D+ +R A++ +V+ ++ L L VT     +   +         ++          F +L+ 
Sbjct: 144 DKSIRQAFIRKVFLVLTLQLSVTLSTVAVFTFVGNVKSFVRENVWTYYVSYAVFFVSLIV 203

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S                              +   + +  +   +      Y +++++ 
Sbjct: 204 LSC-----------------CGDFRRKHPWNLVALSILTISLSYMVGMIASFYNTEAVIM 246

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              IT A   ++ ++   T+ D       +++    LF+ +++ +F+R+  +++  +++G
Sbjct: 247 AVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFTILCIFIRNRILEIVYASLG 306

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++F+   A DTQ +         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 307 ALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 361


>gi|295112219|emb|CBL28969.1| Integral membrane protein, interacts with FtsH [Synergistetes
           bacterium SGP1]
          Length = 239

 Score =  122 bits (306), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 85/237 (35%), Positives = 127/237 (53%), Gaps = 21/237 (8%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           + A   RVY  MA+GL +T + ++ V    T +     S +    V +   G        
Sbjct: 21  VNALFRRVYQWMAIGLILTAVTAYGVASNGTLMRVFYGSPMPLIVVAVATLG-------- 72

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
                     +   L+  +  +SA AA  +F++YS L GL  S   L+Y  +S+   FF 
Sbjct: 73  ----------LVFALSAGIRRISAGAASALFVIYSVLNGLLCSGVLLIYAQESVYAAFFS 122

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TA  F  +S+YG  T+RDL  +GSF+ MG FGL + +LVNLF+RS+ ++   S +G+++F
Sbjct: 123 TAGMFAVMSVYGLYTRRDLTSLGSFLYMGLFGLIISALVNLFVRSTMVEFVSSIIGVIVF 182

Query: 205 SALTAYDTQKIKEAYSDRYDVAYA---ERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             LTAYDTQ I+    +  D        + +V+GAL LY+DFI IF++LLR  G RR
Sbjct: 183 LGLTAYDTQAIRRMGDEIEDGEDGVTIRKVAVLGALSLYLDFINIFLYLLRLFGKRR 239


>gi|281420936|ref|ZP_06251935.1| membrane protein [Prevotella copri DSM 18205]
 gi|281404854|gb|EFB35534.1| membrane protein [Prevotella copri DSM 18205]
          Length = 252

 Score =  122 bits (305), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 94/263 (35%), Positives = 141/263 (53%), Gaps = 23/263 (8%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLR----AYMIRVYNLMALGLGVTGIMSFLVNILATT 56
           M ++ N Q    S     +  ++G+     A M +VY  M L L +TG+ ++ V      
Sbjct: 6   MYNLINSQNNQESNGFAVNEKERGISGVFSALMRKVYTWMTLALLITGVTAYGVASSP-- 63

Query: 57  VDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFL 116
                           T    LM +  L +  I A L +   +   L  LS   A ++F+
Sbjct: 64  ----------------TLLMTLMTSRGLLFGLIIAELALVFIITGALQRLSLTTATLLFI 107

Query: 117 LYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFG 176
           +YS L G  LSS F+VYT  SI + FFITA +FG+++ YGYTTK+DL   G  + M   G
Sbjct: 108 VYSVLNGAMLSSVFVVYTMTSIAKVFFITAGTFGAMAFYGYTTKKDLTSFGKILFMALIG 167

Query: 177 LFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYD-VAYAERQSVIG 235
           L + ++VN+F++SS  D  +S  G+ IF  LTA+D+QKIK+    +YD    A++ ++IG
Sbjct: 168 LIIATVVNMFLKSSGFDYILSYAGVAIFVGLTAWDSQKIKQMLQTQYDMSEGAQKLALIG 227

Query: 236 ALMLYMDFIQIFVHLLRFLGSRR 258
           AL LY+DFI +F++LLR  G   
Sbjct: 228 ALTLYLDFINLFLYLLRIFGGSN 250


>gi|331646003|ref|ZP_08347106.1| inner membrane protein YbhL [Escherichia coli M605]
 gi|331044755|gb|EGI16882.1| inner membrane protein YbhL [Escherichia coli M605]
          Length = 234

 Score =  122 bits (305), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 92/238 (38%), Positives = 139/238 (58%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++     A  ++    + +   G+++          
Sbjct: 15  AGLQTYMAQVYGWMIVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 65  --------AQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 117 VVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|292487705|ref|YP_003530578.1| inner membrane protein YbhL [Erwinia amylovora CFBP1430]
 gi|292898942|ref|YP_003538311.1| membrane protein [Erwinia amylovora ATCC 49946]
 gi|291198790|emb|CBJ45899.1| putative membrane protein [Erwinia amylovora ATCC 49946]
 gi|291553125|emb|CBA20170.1| Inner membrane protein ybhL [Erwinia amylovora CFBP1430]
 gi|312171817|emb|CBX80074.1| Inner membrane protein ybhL [Erwinia amylovora ATCC BAA-2158]
          Length = 236

 Score =  122 bits (305), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 94/254 (37%), Positives = 137/254 (53%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S          G+  YM +VY  M  GL +T  +S+        +    A+ I 
Sbjct: 1   MDRYPRSQDSIVQRAGSGISVYMAQVYGWMTCGLLLTAFISWYAANTPAVMQLVFANRIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G                  +   L+  +H LS   A  +F+LYSAL GL++
Sbjct: 61  FFGLIIVQLG------------------LVFVLSGMVHKLSGAVATGLFMLYSALTGLTM 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           +S FLVYTS SI  TF +T   FG++SL+GYTTKRDL  +GS + M   G+ L SLVN++
Sbjct: 103 ASIFLVYTSSSIASTFVVTGGMFGAMSLWGYTTKRDLSGMGSMLFMALIGIVLASLVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++S+A+   ++ +G+V+F  LTAYDTQK+K         D     R S++GAL LY+DFI
Sbjct: 163 LKSTALMWAVTYIGVVVFVGLTAYDTQKLKNIGEGINVEDKENMRRYSIMGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|238897680|ref|YP_002923359.1| hypothetical protein HDEF_0457 [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465437|gb|ACQ67211.1| putative membrane protein [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 236

 Score =  122 bits (305), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 91/254 (35%), Positives = 139/254 (54%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S          G++ YM +VY  M  GL +T  +++        ++   +S I+
Sbjct: 1   MNRYSKSNGSIIEGRSTGIQVYMSQVYGWMTCGLLLTAFVAWYAANNPAILNLIFSSQIV 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G +   S                    +H LS   A  +F+LYSAL GL++
Sbjct: 61  FFGLIIVQLGLVFVISG------------------MIHKLSGAMATSLFMLYSALTGLTI 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F+VYT  SI  TF ITA  FG++S YGY TKRDL  +G+ + MG  G+ L S+VN++
Sbjct: 103 SSIFVVYTQSSIASTFVITAGMFGAMSFYGYVTKRDLTGLGNMLFMGVIGILLASIVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++SSA+   ++ +G+V+F  LTAYDTQK+K         D     + S++GAL LY+DFI
Sbjct: 163 LKSSALMWAVTYIGVVLFVGLTAYDTQKLKNMGEQLDSNDKEGFRKYSIVGALTLYIDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ L+R +G+RR
Sbjct: 223 NLFLMLIRIVGNRR 236


>gi|323699004|ref|ZP_08110916.1| protein of unknown function UPF0005 [Desulfovibrio sp. ND132]
 gi|323458936|gb|EGB14801.1| protein of unknown function UPF0005 [Desulfovibrio desulfuricans
           ND132]
          Length = 244

 Score =  122 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 82/252 (32%), Positives = 134/252 (53%), Gaps = 11/252 (4%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
               S     ++  + L A+M  VY  M+ GLG+T +++F    +             N 
Sbjct: 2   TQYPSMQRTETSRAEVLNAFMRGVYGWMSAGLGLTALVAFATLTVPALT---------NL 52

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
             +      +   + L  I + A  G+  F++ ++ +++   A  +F+ +SAL G SL+ 
Sbjct: 53  AFVYNPQTGMYAPTMLPMIALLAAFGMVFFMSFKISTMNPSTATGLFMAFSALNGFSLAP 112

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
               YT+ S+V TF  TA  FG++S+YG  TK+DL   GS + MG  G+ +  +VN+F++
Sbjct: 113 ILFAYTTASVVTTFITTAGMFGAMSVYGMVTKKDLTSWGSLLFMGLIGIIIAMVVNMFLQ 172

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFIQI 246
           S  +   +S +G++IF  LTAYDTQK+K         D A   R +++GAL LY+DF  +
Sbjct: 173 SPGMSFAISVLGVIIFVGLTAYDTQKLKTMGETVPLGDTAAVRRGTILGALTLYLDFYNL 232

Query: 247 FVHLLRFLGSRR 258
           F+ LLR +G RR
Sbjct: 233 FLMLLRLMGDRR 244


>gi|193213902|ref|YP_001995101.1| hypothetical protein Ctha_0183 [Chloroherpeton thalassium ATCC
           35110]
 gi|193087379|gb|ACF12654.1| protein of unknown function UPF0005 [Chloroherpeton thalassium ATCC
           35110]
          Length = 237

 Score =  122 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 89/234 (38%), Positives = 131/234 (55%), Gaps = 18/234 (7%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
              + +V+  MALGL +T   +F        +     + I+  G+++  FG ++  S   
Sbjct: 21  NRVINQVFVWMALGLALTAGTAFATASSEAMMQLVFGNPIVFFGLIIAEFGLVVGVS--- 77

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                            ++ LS  AA  +F LYSAL G++L+S F+VY+  SI   F +T
Sbjct: 78  ---------------AAINRLSLAAATGLFFLYSALNGVTLASIFMVYSLGSIGGVFLVT 122

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +FG++SLYG TTKRDL  IGS   M   G+ +  +VN+F+ SS + L +S +GLV+F 
Sbjct: 123 AGTFGAMSLYGLTTKRDLTKIGSLAFMALIGIIIAGVVNMFLHSSVLSLIVSLIGLVVFI 182

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYDTQKIKE  +   D     + +V+GAL LY+DFI +F+ LLR  G  +D
Sbjct: 183 GLTAYDTQKIKEMAAMTNDGESEGKVAVLGALSLYLDFINLFLILLRLFGGGKD 236


>gi|322833777|ref|YP_004213804.1| hypothetical protein Rahaq_3083 [Rahnella sp. Y9602]
 gi|321168978|gb|ADW74677.1| protein of unknown function UPF0005 [Rahnella sp. Y9602]
          Length = 236

 Score =  122 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 95/254 (37%), Positives = 139/254 (54%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S        + G++AYM +VY  M  GL +T  +++  +     +    +S I 
Sbjct: 1   MDRYPRSNGSIVERANTGIQAYMAQVYGWMFCGLLLTAFVAWYASGSEKIMSFVFSSQIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++                  A L +   ++  ++ LS   A  +F+LYSAL GL+L
Sbjct: 61  FFGLII------------------AQLALVFVISGMVNRLSGTVATGLFMLYSALTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS FLVYT  SI  TF + A  FG++S+YGY TKRDL  IGS + M   GL L SLVN++
Sbjct: 103 SSIFLVYTGDSIFGTFIVAAGMFGAMSVYGYVTKRDLTGIGSMLFMALIGLVLASLVNMW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++SS +   +S  G++IF  LTAYDTQK+K   +     D     + S++GAL LY+DFI
Sbjct: 163 LKSSGLANIISYAGVLIFVGLTAYDTQKLKNMGAQLSADDRDNFRKYSIVGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|183598220|ref|ZP_02959713.1| hypothetical protein PROSTU_01604 [Providencia stuartii ATCC 25827]
 gi|188020389|gb|EDU58429.1| hypothetical protein PROSTU_01604 [Providencia stuartii ATCC 25827]
          Length = 235

 Score =  121 bits (304), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 88/254 (34%), Positives = 134/254 (52%), Gaps = 21/254 (8%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R              G++ +M +VY  M +GL +T  +++              +++ 
Sbjct: 1   MDRFDQRNDSLVQRSSAGIQTFMSQVYGWMTVGLLLTAFVAWSTLNSGLFYTIATNNVLF 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
              ++                      G+ + L+  L  +S   A  MF+LYS L GL++
Sbjct: 61  FGLII-------------------VEFGLVLGLSFLLPRMSGMMATGMFMLYSVLTGLTI 101

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           S     YT +S+  TFFITAA FG+LS+YGYTTKR L  IG+F+ M   GL + S+VN+F
Sbjct: 102 SVVLAAYTMESVAGTFFITAAMFGALSVYGYTTKRSLSGIGNFLFMALIGLIIASIVNIF 161

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           M+SSA+   ++  G++IF+ LTAYDTQK+KE  +     D     + +++GAL LY+DFI
Sbjct: 162 MKSSALYWVITYAGVLIFAGLTAYDTQKLKEMGAQIDVEDKESMRKLAILGALNLYLDFI 221

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G RR
Sbjct: 222 NLFLMLLRIFGDRR 235


>gi|47225500|emb|CAG11983.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 370

 Score =  121 bits (304), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 86/230 (37%), Gaps = 21/230 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           RA++ +V+ +++  L VT     +   +    +    +           F ++   S   
Sbjct: 158 RAFIRKVFLVLSAQLLVTFAFVAVFTFVNEVKEFVRVNTWTYFVSYAVFFVSVCVISCCG 217

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +                         +   + +  +   +      + + S+V    IT
Sbjct: 218 NLR-----------------RKHPWNLVALSVLTLSMSYMVGMIASFHDTDSVVMAVGIT 260

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A    ++ L+   TK D       + +    L +  L+ +F+R+  + +  + +G ++F+
Sbjct: 261 AVVCFTVVLFSLQTKYDFTSCYGVLFVCLIVLIIFGLLCIFIRNQILQIVYAGLGALLFT 320

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
              A DTQ +         +A +  + V  AL LY D I IF+++L  +G
Sbjct: 321 CFLAVDTQLL----LGNKQLALSPEEYVFAALNLYTDIINIFLYILAIIG 366


>gi|37360156|dbj|BAC98056.1| mKIAA0950 protein [Mus musculus]
          Length = 345

 Score =  121 bits (304), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 84/238 (35%), Gaps = 25/238 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++ + L VT  +  L        D   A+           F          
Sbjct: 129 RLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWYWASYAVFFAT-------- 180

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      ++  +++  +          Y + S++    IT
Sbjct: 181 ---------YLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLVIT 231

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAMGL 201
           A    S++++ + TK D       + +    LF    LL+++  F     +    + +G 
Sbjct: 232 ALVCLSVTIFSFQTKFDFTSCQGVLFVLLMTLFFSGLLLAVLLPFQYVPWLHTVYAVLGA 291

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            +F+   A+DTQ +          + +  + + GAL +Y+D I IF   L+  G+ R+
Sbjct: 292 GVFTLFLAFDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE 345


>gi|258406254|ref|YP_003198996.1| hypothetical protein Dret_2134 [Desulfohalobium retbaense DSM 5692]
 gi|257798481|gb|ACV69418.1| protein of unknown function UPF0005 [Desulfohalobium retbaense DSM
           5692]
          Length = 235

 Score =  121 bits (304), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 89/261 (34%), Positives = 143/261 (54%), Gaps = 28/261 (10%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D RN     +S           + A+M  VY  M+ GL +T +++F V      +   
Sbjct: 1   MADFRNITATQSSAVA--------INAFMRGVYTWMSGGLLLTAVVAFGVINTPALIQTV 52

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
           A++  I                    + I A LG+ + ++  +  LS   A  +F+LYS 
Sbjct: 53  ASNPTIL------------------LVLILAELGLVLTISAGISKLSGTMATSLFMLYSG 94

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L G++L+   L+YT  S+  TF I A  FG++SLYG TTK+DL   GSF+ MG  G+ L 
Sbjct: 95  LNGVTLAPILLLYTGASVAGTFVICAGMFGAMSLYGLTTKKDLTSWGSFLFMGLIGIVLA 154

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALM 238
           ++VN+F++S+ I+  +S +G+++F+ LTA+DTQ++K     +   D     R +++GAL 
Sbjct: 155 AVVNMFLQSAMIEFVISGVGVLVFTGLTAWDTQQLKTMGETAPADDATAVRRGTILGALR 214

Query: 239 LYMDFIQIFVHLLRFLGSRRD 259
           LY+DFI +F+ LLRF G  R+
Sbjct: 215 LYLDFINLFLMLLRFFGQMRE 235


>gi|213583584|ref|ZP_03365410.1| hypothetical protein SentesTyph_21168 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 234

 Score =  121 bits (304), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 83/238 (34%), Positives = 124/238 (52%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++        +    +S I   G+++          
Sbjct: 15  SGLQTYMAQVYGWMTVGLLLTAFIAWYAANTPAVMMFVFSSKITFFGLII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L +   L+  +H LSA  A  +F+LYSAL G  +  +F         Q  
Sbjct: 65  --------AQLALVFVLSGLVHKLSAGMATTLFMLYSALTGFDVIQYFYRLHLFLHRQHV 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
                 FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V
Sbjct: 117 CGDGGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVV 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D A   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|290560657|ref|NP_001040129.2| glutamate [NMDA] receptor-associated protein 1 [Bombyx mori]
 gi|87248143|gb|ABD36124.1| glutamate receptor Gr1 [Bombyx mori]
          Length = 315

 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 51/234 (21%), Positives = 96/234 (41%), Gaps = 20/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           RA++ +VY ++   L VT     L      T    A +  +     +     L+  +   
Sbjct: 102 RAFIRKVYAILMCQLMVTMGFIALFLYHRPTKVWVAQNPFMFWVAFIVLIVCLIAMACCP 161

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +                    A    +   +++A     L     VY + +++    IT
Sbjct: 162 DVR-----------------RKAPTNFIFLAIFTAAQSFLLGISASVYQADAVLMAVGIT 204

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           AA    L+L+   TK D   +G  ++     L +  +V +F++   I L  +++G +IFS
Sbjct: 205 AAVCLGLTLFALQTKWDFTMMGGVLLCATIVLLVFGIVAIFVKGKVITLVYASLGALIFS 264

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
               YDTQ +      ++  + +  + +  AL LY+D I IF+ +L  +G+ RD
Sbjct: 265 IYLVYDTQLMM---GGKHKYSISPEEYIFAALNLYLDIINIFLFILTIIGASRD 315


>gi|87248145|gb|ABD36125.1| glutamate receptor Gr2 [Bombyx mori]
          Length = 321

 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 51/234 (21%), Positives = 96/234 (41%), Gaps = 20/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           RA++ +VY ++   L VT     L      T    A +  +     +     L+  +   
Sbjct: 108 RAFIRKVYAILMCQLMVTMGFIALFLYHRPTKVWVAQNPFMFWVAFIVLIVCLIAMACCP 167

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +                    A    +   +++A     L     VY + +++    IT
Sbjct: 168 DVR-----------------RKAPTNFIFLAIFTAAQSFLLGISASVYQADAVLMAVGIT 210

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           AA    L+L+   TK D   +G  ++     L +  +V +F++   I L  +++G +IFS
Sbjct: 211 AAVCLGLTLFALQTKWDFTMMGGVLLCATIVLLVFGIVAIFVKGKVITLVYASLGALIFS 270

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
               YDTQ +      ++  + +  + +  AL LY+D I IF+ +L  +G+ RD
Sbjct: 271 IYLVYDTQLMM---GGKHKYSISPEEYIFAALNLYLDIINIFLFILTIIGASRD 321


>gi|170769092|ref|ZP_02903545.1| putative membrane protein [Escherichia albertii TW07627]
 gi|170122164|gb|EDS91095.1| putative membrane protein [Escherichia albertii TW07627]
          Length = 234

 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 91/238 (38%), Positives = 138/238 (57%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++     A  ++    + +    +++          
Sbjct: 15  AGLQTYMAQVYGWMTVGLLLTAFVAWYAANSAALMELLFTNRVFLIALII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF
Sbjct: 65  --------AQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 117 VVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|146310936|ref|YP_001176010.1| hypothetical protein Ent638_1278 [Enterobacter sp. 638]
 gi|145317812|gb|ABP59959.1| protein of unknown function UPF0005 [Enterobacter sp. 638]
          Length = 235

 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 89/252 (35%), Positives = 133/252 (52%), Gaps = 20/252 (7%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
                          GL+ YM +VY  M  GL +T  +++        +    +S I   
Sbjct: 2   DRFPRSDSIVQQTRSGLQTYMAQVYGWMTCGLLLTAFIAWYAANTPAVMMFVFSSKITFF 61

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
           G+++                  A L +   L+  +  LSA  A  +F+LYSAL GL+LSS
Sbjct: 62  GLII------------------AQLALVFVLSGLVQKLSAGMATTLFMLYSALTGLTLSS 103

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            F+VYT  SI  TF +    FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++
Sbjct: 104 IFIVYTYSSIASTFVVAGGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLK 163

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQI 246
           S A+   ++ +G+++F  LTAYDTQK+K         D +   + +++GAL LY+DFI +
Sbjct: 164 SEALMWAVTYIGVIVFVGLTAYDTQKLKNIGEQIDVRDSSNLRKYAILGALTLYLDFINL 223

Query: 247 FVHLLRFLGSRR 258
           F+ LLR  G+RR
Sbjct: 224 FLMLLRIFGNRR 235


>gi|261341371|ref|ZP_05969229.1| putative membrane protein [Enterobacter cancerogenus ATCC 35316]
 gi|288316682|gb|EFC55620.1| putative membrane protein [Enterobacter cancerogenus ATCC 35316]
          Length = 235

 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 97/252 (38%), Positives = 139/252 (55%), Gaps = 20/252 (7%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
                          GL+ YM +VY  M +GL +T  +++        +    +S I   
Sbjct: 2   DRFPRSDSIVQQTRSGLQTYMAQVYGWMTVGLLLTAFIAWYAANTPELMMFIFSSKITFF 61

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
           G+++                  A L +   L+  +H LSA  A  +F+LYSAL GL+LSS
Sbjct: 62  GLII------------------AQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSS 103

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            F+VYT  SI  TF +    FG++SLYGYTTKRDL  +GS + MG  G+ L SLVNL+++
Sbjct: 104 IFIVYTYSSIASTFVVAGGMFGAMSLYGYTTKRDLSGLGSMLFMGLIGIVLASLVNLWLK 163

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALMLYMDFIQI 246
           S A+   ++ +G+V+F  LTAYDTQK+K      D  D     + S++GAL LY+DFI +
Sbjct: 164 SEALMWAVTYIGVVVFVGLTAYDTQKLKNIGNQIDVRDGTTLRKYSILGALTLYLDFINL 223

Query: 247 FVHLLRFLGSRR 258
           F+ LLR LG+RR
Sbjct: 224 FLMLLRILGNRR 235


>gi|73996716|ref|XP_534807.2| PREDICTED: similar to Fas apoptotic inhibitory molecule 2 [Canis
           familiaris]
          Length = 329

 Score =  121 bits (303), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 84/240 (35%), Gaps = 29/240 (12%)

Query: 26  RAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           R ++ +VY ++ + L VT G+++                              +      
Sbjct: 113 RVFIRKVYTILLIQLLVTLGVVALFTFCDPVKD-------------------YVQANPGW 153

Query: 85  RWIFIFAPL-GVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
            W                           ++  +++  +          Y + S++    
Sbjct: 154 YWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLG 213

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAM 199
           ITA    S++++ + TK D       + +    LF    +L+++  F     +    + +
Sbjct: 214 ITALVCLSVTVFSFQTKFDFTSCQGVIFVLLMTLFFSGLILAILLPFQYVPWLHAVYAVL 273

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           G  +F+   A+DTQ +          + +  + + GAL +Y+D I IF   L+  G+ RD
Sbjct: 274 GAGVFTLFLAFDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRD 329


>gi|311280334|ref|YP_003942565.1| hypothetical protein Entcl_3035 [Enterobacter cloacae SCF1]
 gi|308749529|gb|ADO49281.1| protein of unknown function UPF0005 [Enterobacter cloacae SCF1]
          Length = 234

 Score =  121 bits (303), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 90/238 (37%), Positives = 136/238 (57%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M  GL +T  +++        +    +S I   G+++          
Sbjct: 15  SGLQTYMAQVYGWMTCGLLLTAFVAWYAANTPEVMMFVFSSKITFFGLVI---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L +   L+  +  LSA  A  +F+LYSAL GL+L+S FLVYT  SI  TF
Sbjct: 65  --------AQLALVFVLSGMVQRLSAGLATTLFMLYSALTGLTLASIFLVYTYSSIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +TA  FG++SLYGYTTKRDL  +G  + M   G+ L SLVN++++S+ +   ++ +G++
Sbjct: 117 VVTAGMFGAMSLYGYTTKRDLSGVGKMLFMALIGIVLASLVNIWLKSTPLMWAVTYIGVL 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + +++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKAIGEQIDTRDSSTMRKYAILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|254420620|ref|ZP_05034344.1| Uncharacterized protein family UPF0005, putative [Brevundimonas sp.
           BAL3]
 gi|196186797|gb|EDX81773.1| Uncharacterized protein family UPF0005, putative [Brevundimonas sp.
           BAL3]
          Length = 249

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 86/260 (33%), Positives = 133/260 (51%), Gaps = 12/260 (4%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MSD  N             ++D GLR +M+ VYN +ALGL V   ++++   +       
Sbjct: 1   MSDFNN-GYARPLPQTADMSVDAGLRGFMLGVYNKLALGLVVAAALAYVTGNVPAVQQLL 59

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                  R          +  + L  I  F+PL +       + + +A    +++    A
Sbjct: 60  FGVTPDGR----------VGLTMLGMIVQFSPLVLLFGSMFFMKNPTAKGVNLLYWAVVA 109

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
            IG  L   FL YT  S+  TF +TAA+FG LSL GYTTK+DL  +G+F+I G  GL + 
Sbjct: 110 SIGAGLGVLFLRYTGASLASTFLVTAAAFGGLSLVGYTTKKDLTAMGTFLIFGVIGLIVA 169

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSV-IGALML 239
            +VN+FM+S  + L +S +G++IF+ L AYDTQ++K  Y        A   +   GAL L
Sbjct: 170 MIVNMFMQSGTLYLIISGLGVLIFAGLIAYDTQRLKMTYYALGGDQNAMGVATGFGALSL 229

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           +++F+ +F  LL F+G  R+
Sbjct: 230 FINFVNLFQFLLAFMGGNRN 249


>gi|161614955|ref|YP_001588920.1| hypothetical protein SPAB_02709 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161364319|gb|ABX68087.1| hypothetical protein SPAB_02709 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 234

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 95/238 (39%), Positives = 136/238 (57%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++        +    +S I   GV++          
Sbjct: 15  SGLQTYMAQVYGWMTVGLLLTAFIAWYAANTPAVMMFVFSSKITFFGVII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L +   L+  +H LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF
Sbjct: 65  --------AQLALVFALSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V
Sbjct: 117 VVTGGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVV 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D A   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|260593490|ref|ZP_05858948.1| membrane protein [Prevotella veroralis F0319]
 gi|260534606|gb|EEX17223.1| membrane protein [Prevotella veroralis F0319]
          Length = 242

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 89/258 (34%), Positives = 142/258 (55%), Gaps = 20/258 (7%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D  NY  VVN+       + +   A M +VY  MA+ L +TGI+++        +     
Sbjct: 4   DFNNYSNVVNNHD-RELEMSRAFPALMRKVYVWMAMALAITGIVAYGAGSSPALIQALYI 62

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
           S        L  FG                  +  +L+ R++ LS  +A + F+L+SA+ 
Sbjct: 63  SKGPILIAALVEFG------------------IVWYLSSRIYKLSLASATLWFILFSAIN 104

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GL+L   F VY    I +TFF+TA +FG+++L G TTK+DL  +G  + M   GL + SL
Sbjct: 105 GLTLGWIFAVYKIAIIAKTFFVTAGTFGAMALIGSTTKKDLTKMGGILFMALIGLIIASL 164

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYD-VAYAERQSVIGALMLYM 241
           VN+F++SS +D  +S +G+++F+ LTA+D Q IK       D    A++ +++G+L LY+
Sbjct: 165 VNMFLQSSTMDYIVSIIGVIVFTGLTAWDAQAIKRNLLMAPDAGESAQKIALLGSLSLYL 224

Query: 242 DFIQIFVHLLRFLGSRRD 259
           DFI +F++LLRF G+ RD
Sbjct: 225 DFINLFLYLLRFFGNNRD 242


>gi|157146579|ref|YP_001453898.1| hypothetical protein CKO_02340 [Citrobacter koseri ATCC BAA-895]
 gi|157083784|gb|ABV13462.1| hypothetical protein CKO_02340 [Citrobacter koseri ATCC BAA-895]
          Length = 249

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 94/238 (39%), Positives = 135/238 (56%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++        +    +S I   G+++          
Sbjct: 30  SGLQTYMAQVYGWMTVGLLLTAFIAWYAANTPAVMMFVFSSKITFFGLII---------- 79

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + I L+  +  LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF
Sbjct: 80  --------AQLALVIALSAMVQKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTF 131

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG +SLYGYTTKRDL   GS + M   G+ L SLVN +++S A+   ++ +G+V
Sbjct: 132 VVTGGMFGVMSLYGYTTKRDLSGWGSMLFMALIGIILASLVNFWLKSEALMWAVTYIGVV 191

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 192 VFVGLTAYDTQKLKNIGEQIDVRDSSTLRKYSILGALTLYLDFINLFLMLLRIFGNRR 249


>gi|284007128|emb|CBA72404.1| conserved hypothetical protein [Arsenophonus nasoniae]
          Length = 242

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 96/254 (37%), Positives = 140/254 (55%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R              G++AYM +VY  M +GL +T  +++     +  +   A    +
Sbjct: 7   MDRFERQNDSIVQRAGAGIQAYMAQVYGWMTVGLLLTAFVAWYAINNSNIIMYLATHGWV 66

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++                  A   + I L+  L  LSA  A  MF+LYSAL GL++
Sbjct: 67  LIGLII------------------AEFALVIGLSFLLPKLSAGLATAMFMLYSALTGLTI 108

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           S   + YT  S+  TFFITAA FG+LS YGYTTKR L  +GSF+ M   GL + SLVN++
Sbjct: 109 SLVLVAYTGASVASTFFITAAMFGALSFYGYTTKRSLSGMGSFLFMALIGLIIASLVNIW 168

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALMLYMDFI 244
           ++SS + L ++  G++IFS LTAYDTQK+K+     D  D     + +++GAL LY+DFI
Sbjct: 169 LQSSGLTLVITYAGVLIFSGLTAYDTQKLKDMGNQIDSRDQEGMRKYAILGALTLYLDFI 228

Query: 245 QIFVHLLRFLGSRR 258
            +F+ +LR LG RR
Sbjct: 229 NLFLMMLRILGDRR 242


>gi|283784546|ref|YP_003364411.1| hypothetical protein ROD_07871 [Citrobacter rodentium ICC168]
 gi|282948000|emb|CBG87564.1| putative membrane protein [Citrobacter rodentium ICC168]
          Length = 234

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 89/238 (37%), Positives = 138/238 (57%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++  +  A  ++    + +   G+++          
Sbjct: 15  SGLQTYMAQVYGWMTVGLLLTAFIAWYASHSAAFIELLYTNRLFFFGLVI---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L V   L+  ++ LSA     +F+LYSAL GL+LSS F++YT+ SI  TF
Sbjct: 65  --------AQLAVVFVLSGLINRLSAGVMTTLFMLYSALTGLTLSSIFIIYTASSIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            ++   FG +SL+GYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V
Sbjct: 117 VVSGGMFGVMSLWGYTTKRDLSSWGNILFMALIGIILASLVNFWLKSEALMWAVTYIGVV 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F ALTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVALTAYDTQKLKNIGEQIDVRDSSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|308274747|emb|CBX31346.1| Inner membrane protein ybhL [uncultured Desulfobacterium sp.]
          Length = 234

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 88/237 (37%), Positives = 143/237 (60%), Gaps = 21/237 (8%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           +  ++  VYN M +GL +TG++++ V+  A        + ++  G+++            
Sbjct: 16  VNEFIRSVYNWMGIGLALTGLVAYYVSNDAGLQSLIFGNRLVFFGLII------------ 63

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
                 A L +   ++ R++ + A  A  MF++Y+AL G +LS  FL+YT+ SI  TFFI
Sbjct: 64  ------AELALVFTISSRVNKMKASTATSMFIIYAALNGATLSVIFLIYTASSITSTFFI 117

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
            +A+F + S+YG TTKRDL  +G FM MG  G+ + S+VN+F+RSSA+++ +S +G+++F
Sbjct: 118 CSATFLACSIYGMTTKRDLTSMGGFMAMGLIGIIIASVVNIFIRSSAMNMIISYIGVIVF 177

Query: 205 SALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             LTAYDTQK+K     +    D     + +++GAL LY+DFI +F+ LLR LG RR
Sbjct: 178 VGLTAYDTQKLKNMAMTQPSGLDAGVVRKGAILGALSLYLDFINLFLMLLRILGDRR 234


>gi|329295982|ref|ZP_08253318.1| hypothetical protein Pstas_03774 [Plautia stali symbiont]
          Length = 235

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 93/247 (37%), Positives = 134/247 (54%), Gaps = 20/247 (8%)

Query: 14  GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
                     GL+ YM +VY  M  GL +T  +S+        ++   A+ I   G+++ 
Sbjct: 7   NGSIVQQASTGLQTYMAQVYGWMTCGLLLTAFVSWFAARTPAVMELVFANRITFFGLII- 65

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
                            A L +   L+  +  +S   A  +F+LYSAL GL+++S FLVY
Sbjct: 66  -----------------AQLALVFVLSGMVQRMSGAVATGLFMLYSALTGLTMASIFLVY 108

Query: 134 TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAID 193
           T  SI  TFF+TA  FG++S YGYTTKRDL   GS + M   G+ L SLVN +++S A+ 
Sbjct: 109 TYSSIASTFFVTAGMFGAMSFYGYTTKRDLSRFGSLLFMALIGILLASLVNFWLKSPALM 168

Query: 194 LTMSAMGLVIFSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFIQIFVHLL 251
             ++ +G+V+F  LTAYDTQK+K         D     R S++GAL LY+DFI +F+ LL
Sbjct: 169 WAITYIGVVVFVGLTAYDTQKLKAIGEGIDVNDKENLRRFSIMGALTLYLDFINLFLMLL 228

Query: 252 RFLGSRR 258
           R  G+RR
Sbjct: 229 RIFGNRR 235


>gi|34189346|gb|AAH26693.1| TMBIM1 protein [Homo sapiens]
          Length = 343

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 52/256 (20%), Positives = 105/256 (41%), Gaps = 26/256 (10%)

Query: 8   QRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           +R V+   G G   D+ +R  ++ +VY+++++ L +T  +  +     T V+P +A +  
Sbjct: 109 ERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIF----TFVEPVSAFVRR 164

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           N  V    +   + T               I    +          ++  L++  +G   
Sbjct: 165 NVAVYYVSYAVFVVT-------------YLILACCQGPRRRFPWNIILLTLFTFAMGFMT 211

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSL 182
            +   +Y +K+++    ITA    S++++ + TK D         +    L     + S+
Sbjct: 212 GTISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLLVTGIVTSI 271

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           V  F     + +  +A+G + F+   AYDTQ +            +    + GAL +Y D
Sbjct: 272 VLYFQYVYWLHMLYAALGAICFTLFLAYDTQLV----LGNRKHTISPEDYITGALQIYTD 327

Query: 243 FIQIFVHLLRFLGSRR 258
            I IF  +L+ +G R 
Sbjct: 328 IIYIFTFVLQLMGDRN 343


>gi|268590292|ref|ZP_06124513.1| putative membrane protein [Providencia rettgeri DSM 1131]
 gi|291314200|gb|EFE54653.1| putative membrane protein [Providencia rettgeri DSM 1131]
          Length = 235

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 86/252 (34%), Positives = 135/252 (53%), Gaps = 21/252 (8%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
           +            + G++A+M +VY  M +GL +T  +++               I+   
Sbjct: 3   QFDQRNDSLVQGANTGVQAFMSQVYGWMTVGLLLTAFVAWYSVSSGLYYTIATNKILFFG 62

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
            ++                   A LG+ + ++  L  +S  AA  MF+LYS L GL++S 
Sbjct: 63  MII-------------------AELGLVMGISFLLQKISGMAATGMFMLYSLLTGLTISV 103

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
               YT +S+  TF ITA  FG+LS YGYTTKR L  +G+F+ M   G+ + SLVN++++
Sbjct: 104 ILAAYTGESVAGTFVITAVMFGALSFYGYTTKRSLTGMGNFLFMALIGIVVASLVNIWLQ 163

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQI 246
           S+ +   ++  G+++F+ALTAYDTQK+KE  S     D     + S++GAL LY+DFI +
Sbjct: 164 STMMYWVITYGGVLLFAALTAYDTQKLKEMGSQIDEDDRETMRKYSIMGALSLYLDFINL 223

Query: 247 FVHLLRFLGSRR 258
           F+ LLR  G RR
Sbjct: 224 FLMLLRIFGDRR 235


>gi|260909707|ref|ZP_05916401.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260636132|gb|EEX54128.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 238

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 85/234 (36%), Positives = 131/234 (55%), Gaps = 20/234 (8%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A M +VY  M L L +TG+ ++ V      +     S                    + W
Sbjct: 23  ALMRKVYVWMTLALIITGVTAYGVAHSEVLMQSVYES------------------RGIFW 64

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
             + A LG+   ++  +  LS   A ++F+LYSAL G +LS  FL Y++  I + FFITA
Sbjct: 65  ALLLAELGLVYGISRFIDRLSLTTATLLFILYSALNGATLSVIFLAYSADVITKVFFITA 124

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM-RSSAIDLTMSAMGLVIFS 205
            +FG ++ +GY TK DL  +G  +IM   GL + SLVNL + +SS+ DL +S +G+++F 
Sbjct: 125 GTFGVMAAFGYFTKADLTGLGKLLIMALVGLIIASLVNLLLLKSSSFDLILSYIGVLVFV 184

Query: 206 ALTAYDTQKIKEAYSDRYD-VAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            LTAYD+QKIK   +   D    A++ +++G+L LY+DFI +F++LLR  G  R
Sbjct: 185 GLTAYDSQKIKRMLAQAEDMGEGAQKTALMGSLTLYLDFINLFLYLLRIFGRER 238


>gi|332662975|ref|YP_004445763.1| hypothetical protein Halhy_0991 [Haliscomenobacter hydrossis DSM
           1100]
 gi|332331789|gb|AEE48890.1| protein of unknown function UPF0005 [Haliscomenobacter hydrossis
           DSM 1100]
          Length = 235

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 86/253 (33%), Positives = 133/253 (52%), Gaps = 19/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
                  G      I      +M +V+  M++ L +TG++++ V+     +     +  I
Sbjct: 1   MNDFPFVGDQRQDAIAAEQARFMTKVFGWMSVALAITGVVAYFVSNSPQILQFVFGNRFI 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++                    L +  +L+  +  +SA  A M+FLLYS L GL+L
Sbjct: 61  FFGLLI------------------GELLLVGYLSAAVMRMSADMATMVFLLYSVLNGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           S  FL+YTS SI  TF ITA +F ++S YGY TK DL   GS + M   GL + S+VN+F
Sbjct: 103 SFVFLIYTSTSIAGTFLITAGTFAAMSAYGYFTKNDLTKAGSLLFMALIGLVIASIVNIF 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEA-YSDRYDVAYAERQSVIGALMLYMDFIQ 245
           +RS  +   ++  G++IF  LTAYDTQKIK              +++++GAL LY+DFI 
Sbjct: 163 LRSPLMYWIITYAGILIFVGLTAYDTQKIKNMNIIGNEGTEEDHKEAIMGALTLYLDFIN 222

Query: 246 IFVHLLRFLGSRR 258
           +F+ LLR  G+R+
Sbjct: 223 LFIMLLRLFGNRK 235


>gi|259909028|ref|YP_002649384.1| membrane protein [Erwinia pyrifoliae Ep1/96]
 gi|224964650|emb|CAX56164.1| membrane protein [Erwinia pyrifoliae Ep1/96]
 gi|283479044|emb|CAY74960.1| Inner membrane protein ybhL [Erwinia pyrifoliae DSM 12163]
 gi|310767074|gb|ADP12024.1| membrane protein [Erwinia sp. Ejp617]
          Length = 236

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 93/254 (36%), Positives = 136/254 (53%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S          G+  YM +VY  M  GL +T  +S+        +    A+ I 
Sbjct: 1   MDRYPRSDDSIVQRAGSGISVYMAQVYGWMTCGLLLTAFISWYAANTPAVMQLVFANRIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G                  +   L+  +H LS   A  +F+LYSAL GL++
Sbjct: 61  FFGLIIFQLG------------------LVFVLSGMVHKLSGAVATGLFMLYSALTGLTM 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           +S FLVYT  SI  TF +T   FG++SL+GYTTKRDL  +GS + M   G+ L SLVN++
Sbjct: 103 ASIFLVYTYSSIASTFVVTGGMFGAMSLWGYTTKRDLSGMGSMLFMALIGIVLASLVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++S+A+   ++ +G+V+F  LTAYDTQK+K         D     R S++GAL LY+DFI
Sbjct: 163 LKSTALMWAVTYIGVVVFVGLTAYDTQKLKNIGEGINVEDKENMRRYSIMGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|188534380|ref|YP_001908177.1| hypothetical protein ETA_22530 [Erwinia tasmaniensis Et1/99]
 gi|188029422|emb|CAO97299.1| Putative membrane protein [Erwinia tasmaniensis Et1/99]
          Length = 236

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 92/254 (36%), Positives = 136/254 (53%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S          G+  YM +VY  M  GL +T  +++        +    A+ I 
Sbjct: 1   MDRYPRSNDSIVQRAGSGISVYMAQVYGWMTCGLLLTAFIAWYAANTPAVMQLVFANRIT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++                  A L +   L+  +H LS   A  +F+LYSAL GL++
Sbjct: 61  FFGLII------------------AQLALVFVLSGMVHKLSGTVATGLFMLYSALTGLTM 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           +S FL YT  SI  TF +T   FG++SL+GYTTKRDL  +GS + M   G+ L SLVN++
Sbjct: 103 ASIFLAYTYSSIASTFVVTGGMFGAMSLWGYTTKRDLSGMGSMLFMALIGIVLASLVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFI 244
           ++S+A+   ++ +G+V+F  LTAYDTQK+K         D     R S++GAL LY+DFI
Sbjct: 163 LKSTALMWAVTYIGVVVFVGLTAYDTQKLKNIGEGIDVSDKENLRRYSIMGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|256093006|ref|XP_002582168.1| z-protein (S1r protein) [Schistosoma mansoni]
 gi|238804811|emb|CAZ39268.1| z-protein (S1r protein), putative [Schistosoma mansoni]
          Length = 727

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 98/228 (42%), Gaps = 27/228 (11%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY ++   L +T + +  + +L   +  +    I    V++              
Sbjct: 34  RFLRKVYGILFTQLLLTSLCAGTMMMLKPVLLDNLQQNIWLPIVLIVS------------ 81

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                   + I L +           ++  L++    + +    + Y++  ++Q F +T 
Sbjct: 82  -------TIGILLGLMWKRQETPTNFILLYLFTICESILVGYAVITYSATVVLQAFILTT 134

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
               SL LY   +K+D    G+ + +    L L+  +NLF+ SS ++L M+A G  +FS 
Sbjct: 135 IVVMSLMLYTLNSKKDFSKWGAGLSVAFLILLLVGPINLFLGSSLLELCMAAGGACLFSL 194

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
              YDT +I            +  + ++  + LY+D + +F+++LRFL
Sbjct: 195 FIVYDTWRIMH--------HCSPEEYIMACVDLYLDILNLFMYILRFL 234


>gi|238893837|ref|YP_002918571.1| putative transport protein [Klebsiella pneumoniae NTUH-K2044]
 gi|238546153|dbj|BAH62504.1| putative transport protein [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 234

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 95/237 (40%), Positives = 137/237 (57%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++        +    +S I   G+++           
Sbjct: 16  GLQTYMAQVYGWMTVGLLLTAFIAWFAANTPAVMMFVFSSKITFFGLII----------- 64

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                  A L +   L+  +  LSA  A  +F+LYSAL GL+LSS F+ YT  SI  TF 
Sbjct: 65  -------AQLALVFVLSGMVQRLSARMATTLFMLYSALTGLTLSSIFIAYTYSSIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +T   FG++SLYGYTTKRDL   GS + MG  G+ L SLVNL+++S A+   ++ +G+V+
Sbjct: 118 VTGGMFGAMSLYGYTTKRDLSGFGSMLFMGLIGIVLASLVNLWLKSEALMWAVTYIGVVL 177

Query: 204 FSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K         D A   + S++GAL LY+DFI +F+ LLR +G+RR
Sbjct: 178 FVGLTAYDTQKLKNIGEQIDTRDSATLRKYSILGALTLYLDFINLFLMLLRIMGNRR 234


>gi|212712162|ref|ZP_03320290.1| hypothetical protein PROVALCAL_03244 [Providencia alcalifaciens DSM
           30120]
 gi|212685209|gb|EEB44737.1| hypothetical protein PROVALCAL_03244 [Providencia alcalifaciens DSM
           30120]
          Length = 235

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 86/252 (34%), Positives = 135/252 (53%), Gaps = 21/252 (8%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
           +              G++A+M +VY  M +GL +T  +++               ++   
Sbjct: 3   QFDQRNDSLVQNASTGVQAFMSQVYGWMTVGLLLTAFVAWYSLSSGLFFTIATNKVLFFG 62

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
            ++                   A LG+ + L+  L  +S   A  MF+LY+ L GL++S 
Sbjct: 63  MII-------------------AELGLVMGLSFLLPKMSGAIATGMFMLYALLTGLTISV 103

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
              VYT +S+V TF ITA  FG+LS +GYTTKR L  +G+F+ M   GL + SLVN++++
Sbjct: 104 ILAVYTGESVVGTFIITAVMFGALSFFGYTTKRSLTGMGNFLFMALIGLVVASLVNIWLQ 163

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQI 246
           SS +   ++  G+++F+ALTAYDTQK+KE      + D     + S++GAL LY+DFI +
Sbjct: 164 SSMMYWVITYGGVLLFAALTAYDTQKLKEMGEQINQDDRENMRKYSIMGALSLYLDFINL 223

Query: 247 FVHLLRFLGSRR 258
           F+ LLR  G RR
Sbjct: 224 FLMLLRIFGDRR 235


>gi|16764170|ref|NP_459785.1| permease [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|167550516|ref|ZP_02344273.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167992038|ref|ZP_02573136.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168230693|ref|ZP_02655751.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168236735|ref|ZP_02661793.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168240669|ref|ZP_02665601.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168263695|ref|ZP_02685668.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168466396|ref|ZP_02700258.1| membrane protein [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|168820050|ref|ZP_02832050.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194444921|ref|YP_002040042.1| membrane protein [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194470070|ref|ZP_03076054.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194738102|ref|YP_002113899.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197247740|ref|YP_002145762.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197262226|ref|ZP_03162300.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198244079|ref|YP_002214771.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200389380|ref|ZP_03215991.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204929976|ref|ZP_03220997.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205352065|ref|YP_002225866.1| hypothetical protein SG0786 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207856244|ref|YP_002242895.1| hypothetical protein SEN0753 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|238913366|ref|ZP_04657203.1| hypothetical protein SentesTe_19876 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|16419313|gb|AAL19744.1| putative permease [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|194403584|gb|ACF63806.1| membrane protein [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194456434|gb|EDX45273.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194713604|gb|ACF92825.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195630993|gb|EDX49579.1| membrane protein [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197211443|gb|ACH48840.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197240481|gb|EDY23101.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197290215|gb|EDY29572.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197938595|gb|ACH75928.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199601825|gb|EDZ00371.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204320970|gb|EDZ06171.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205271846|emb|CAR36681.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205324506|gb|EDZ12345.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205329610|gb|EDZ16374.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205334708|gb|EDZ21472.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205340211|gb|EDZ26975.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205343192|gb|EDZ29956.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205347790|gb|EDZ34421.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206708047|emb|CAR32338.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261246065|emb|CBG23867.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992547|gb|ACY87432.1| putative permease [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301157392|emb|CBW16881.1| putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312911829|dbj|BAJ35803.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320085078|emb|CBY94865.1| Glutamate [NMDA] receptor-associated protein 1 NMDA receptor
           glutamate-binding subunit; putative MAPK-activating
           protein PM02 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321226380|gb|EFX51431.1| Putative membrane protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322613845|gb|EFY10783.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322620344|gb|EFY17211.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322622770|gb|EFY19615.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322628682|gb|EFY25469.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631620|gb|EFY28376.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322637146|gb|EFY33849.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322641654|gb|EFY38290.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322648035|gb|EFY44505.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322648483|gb|EFY44935.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322654220|gb|EFY50543.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658135|gb|EFY54402.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322663609|gb|EFY59811.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670345|gb|EFY66485.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322671581|gb|EFY67703.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676937|gb|EFY73004.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322682862|gb|EFY78881.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686541|gb|EFY82523.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323129114|gb|ADX16544.1| putative permease [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323194562|gb|EFZ79755.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323199107|gb|EFZ84203.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202063|gb|EFZ87122.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208912|gb|EFZ93849.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323213448|gb|EFZ98242.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323215251|gb|EFZ99996.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323220830|gb|EGA05268.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323227113|gb|EGA11291.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229929|gb|EGA14052.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233154|gb|EGA17250.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323240889|gb|EGA24931.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323243206|gb|EGA27226.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323248745|gb|EGA32673.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323251749|gb|EGA35616.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323258759|gb|EGA42416.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323260696|gb|EGA44301.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323267868|gb|EGA51347.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323268748|gb|EGA52208.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326622526|gb|EGE28871.1| putative permease [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
 gi|326627107|gb|EGE33450.1| putative permease [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
 gi|332987738|gb|AEF06721.1| putative permease [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 234

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 94/238 (39%), Positives = 136/238 (57%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++        +    +S I   G+++          
Sbjct: 15  SGLQTYMAQVYGWMTVGLLLTAFIAWYAANTPAVMMFVFSSKITFFGLII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L +   L+  +H LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF
Sbjct: 65  --------AQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V
Sbjct: 117 VVTGGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVV 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D A   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|320354923|ref|YP_004196262.1| hypothetical protein Despr_2837 [Desulfobulbus propionicus DSM
           2032]
 gi|320123425|gb|ADW18971.1| protein of unknown function UPF0005 [Desulfobulbus propionicus DSM
           2032]
          Length = 237

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 88/235 (37%), Positives = 131/235 (55%), Gaps = 23/235 (9%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++ +V++ MA+GL +TG ++             A                    SPL +I
Sbjct: 23  FLAKVFHWMAIGLAITGGVALFTAESGLVKPLIA--------------------SPLFFI 62

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
            + A LG+  +L+ R+  L    A  +F+ YS L G++LS+ FL YT  SI  TF +TA 
Sbjct: 63  LVLAELGMVFYLSARIDKLQPGTATGLFVGYSVLNGVTLSTIFLAYTHASIGATFLVTAG 122

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
            F ++++YG  TKRDL  +GSFM MG  G+ L S+VN+F +S A+   +SA+G+++F  L
Sbjct: 123 MFAAMAVYGMVTKRDLSGMGSFMFMGLIGILLASIVNIFFKSPALYWAISAIGVLVFVGL 182

Query: 208 TAYDTQKIKEAYSDR---YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           TAYD QKIK    +           + ++IGAL LY+DFI +F+ LLRF G  RD
Sbjct: 183 TAYDVQKIKTIGEEGIMEQGEVAIRKGAIIGALALYLDFINLFLMLLRFFGGSRD 237


>gi|167648948|ref|YP_001686611.1| hypothetical protein Caul_4993 [Caulobacter sp. K31]
 gi|167351378|gb|ABZ74113.1| protein of unknown function UPF0005 [Caulobacter sp. K31]
          Length = 248

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 100/259 (38%), Positives = 151/259 (58%), Gaps = 12/259 (4%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D          G+G   ++D GLR++M+ VYN +ALGL ++  +++L +      D  
Sbjct: 1   MNDFNRDYARPLPGAGADMSVDAGLRSFMLGVYNKVALGLLLSAALAWLTSSYPPVRD-- 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                    +M    G  +  + L  I  FAPLG+ +F    + S++A  A +++    +
Sbjct: 59  ---------LMFQVTGNRVGYTMLGTIIAFAPLGILLFSGFLMKSITARTAGVIYWSIVS 109

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           LIG SL +  L+YT  S+ QTF ITA +FG LSL GYTTK+DL   GSF+I+G +GL L 
Sbjct: 110 LIGASLGTVVLLYTGASVFQTFLITAIAFGGLSLVGYTTKKDLTGFGSFLIVGLWGLILA 169

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSV-IGALML 239
           S+V++F  S  +   ++A+G++IF+ L AYDTQK+K  Y +      A+  +   GAL L
Sbjct: 170 SIVSIFFPSGPLVFAINAIGVLIFAGLIAYDTQKLKMTYYEVGGDETAKAVATNFGALNL 229

Query: 240 YMDFIQIFVHLLRFLGSRR 258
           Y+DFI +F  LL F+GSRR
Sbjct: 230 YLDFINLFRFLLYFMGSRR 248


>gi|307294288|ref|ZP_07574132.1| protein of unknown function UPF0005 [Sphingobium chlorophenolicum
           L-1]
 gi|306880439|gb|EFN11656.1| protein of unknown function UPF0005 [Sphingobium chlorophenolicum
           L-1]
          Length = 245

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 107/248 (43%), Positives = 153/248 (61%), Gaps = 18/248 (7%)

Query: 12  NSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVM 71
            +    G   D GLR+YM+ VYN MA G+ +TG+++ L           A   I+     
Sbjct: 16  GTTVARGEAYDAGLRSYMLSVYNYMASGVLLTGVVAMLFASSGLAHQILAGPGIL----- 70

Query: 72  LTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFL 131
                        +++ +FAPL   + ++  ++ LS +A + MF  Y+A++GLSLSS  L
Sbjct: 71  -------------KYVIMFAPLLFVMTMSFGINRLSTFAMQAMFWAYAAVMGLSLSSVLL 117

Query: 132 VYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSA 191
           VYT  S+ QTFF TAA+F  LSL+GYTTKRDL   G+F+IMG  GL + SL+NLF RSSA
Sbjct: 118 VYTGTSVAQTFFATAAAFAGLSLWGYTTKRDLSAFGTFLIMGVVGLLVASLINLFFRSSA 177

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLL 251
           + + +S +G+++F+ LTAYDTQKIK  Y+         +  V+GAL LY+DFI +F+ LL
Sbjct: 178 MSMVISFIGVLLFAGLTAYDTQKIKSIYAYVAGTDMMGKSVVMGALNLYLDFINMFLFLL 237

Query: 252 RFLGSRRD 259
           RF+GS+RD
Sbjct: 238 RFMGSQRD 245


>gi|302381646|ref|YP_003817469.1| hypothetical protein Bresu_0531 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192274|gb|ADK99845.1| protein of unknown function UPF0005 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 249

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 94/260 (36%), Positives = 141/260 (54%), Gaps = 12/260 (4%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MSD RN      + +     +D GLR++M+ VYN +ALGL V G +++L   +       
Sbjct: 1   MSDFRN-GYSTPAPAHADMAVDAGLRSFMLGVYNKLALGLLVAGGLAYLTGNVPAVQQLF 59

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A     R  M          + L  I  F P+ +       + + +A    M++    A
Sbjct: 60  FAPTPDGRIGM----------TMLGMIVQFLPIVLLFGSMFFMKNPTARGVNMLYWAVVA 109

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
            IG  +   FL YT  S+  TFF+TAASFG+LSL GYTTK+DL  +GSF+IMG  GL + 
Sbjct: 110 SIGAGMGILFLRYTGGSLASTFFVTAASFGALSLVGYTTKKDLTAMGSFLIMGVIGLIIA 169

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSV-IGALML 239
           S+VN+FM+S  + L +S +G++IF+ L A+DTQ++K  Y        A   +   GAL L
Sbjct: 170 SIVNIFMQSGTLYLIISGLGVLIFAGLIAFDTQRLKMTYYQLGGNEAAMGVATGFGALSL 229

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           +++F+ +F  LL F+G  R+
Sbjct: 230 FINFVNLFQFLLAFMGGNRN 249


>gi|149757632|ref|XP_001496061.1| PREDICTED: similar to glutamate receptor, ionotropic, N-methyl
           D-aspartate-associated protein 1 [Equus caballus]
          Length = 366

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 37/239 (15%), Positives = 96/239 (40%), Gaps = 22/239 (9%)

Query: 22  DQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           D+ +R A++ +V+ ++ L L VT     +   +    D    ++          F +L+ 
Sbjct: 149 DKSIRQAFIRKVFLVLTLQLSVTLSTVAVFTFVGKVKDFVRENVWTYYVSYAVFFTSLIV 208

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S                              +   + +  +   +      Y +++++ 
Sbjct: 209 LSC-----------------CGDFRRKHPWNLVALSILTVSLSYMVGMIASFYNTEAVIM 251

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              IT     ++ ++   T+ D       +++    L + +++ +F+R+  +++  +++G
Sbjct: 252 AVGITTTVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLLIFAILCIFIRNRILEIVYASLG 311

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++F+   A DTQ +         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 312 ALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 366


>gi|307213107|gb|EFN88629.1| Glutamate [NMDA] receptor-associated protein 1 [Harpegnathos
           saltator]
          Length = 324

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 43/236 (18%), Positives = 97/236 (41%), Gaps = 24/236 (10%)

Query: 26  RAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
             ++ +VY+++   L +T G+++  V    T     +   +                   
Sbjct: 111 NGFIRKVYSILMCQLLITLGMITLFVYHTPTQRWVHSHRELF------------------ 152

Query: 85  RWIFIFAPLGVFIFLNVRLH-SLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
            W+     + + I +    +    A    +   L++      L++    Y   +++    
Sbjct: 153 -WVCFVVTIVLIICMACCTNVRRKAPMNFIFLFLFTVAEAFLLATAASSYEPDAVMLAVG 211

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           ITAA    L+++ + TK D   + + + +    L +  ++ +      + L  +++G +I
Sbjct: 212 ITAAICLGLTIFAFQTKIDFTGLSTVLFVAVLVLLIFGIIAMIWHGKIMTLVYASLGALI 271

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           FS    YDTQ        ++  + +  + +  AL LY+D I IF+++L  +G+ RD
Sbjct: 272 FSLYLIYDTQM---MIGGKHKYSISPEEYIFAALSLYLDVINIFIYILTIIGASRD 324


>gi|195027181|ref|XP_001986462.1| GH20515 [Drosophila grimshawi]
 gi|193902462|gb|EDW01329.1| GH20515 [Drosophila grimshawi]
          Length = 331

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/254 (17%), Positives = 93/254 (36%), Gaps = 22/254 (8%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASII 65
           Y         F        R ++ +VY ++   L VT G ++       T       S +
Sbjct: 99  YDDPEGQPKNFSFDDQSIRRGFIRKVYIILMGQLLVTFGAVALFTFHEGTKRFVQKNSYL 158

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
               + +                    + +                 +   L++      
Sbjct: 159 FWVALAV------------------VIVTMLCMACCESVRRQTPTNFIFLGLFTVAQSFL 200

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L      +  + ++    ITAA   +L+++   TK D   +G  ++       +  +V +
Sbjct: 201 LGVSASRFGQQEVLMAVGITAAVCLALTIFATQTKVDFTMMGGILVACMVVFIIFGIVAI 260

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F++   I L  +++G ++FS    YDTQ +       +  + +  + +  AL LY+D I 
Sbjct: 261 FVKGKIITLVYASIGALLFSVYLIYDTQLMM---GGDHKYSISPEEYIFAALNLYLDIIN 317

Query: 246 IFVHLLRFLGSRRD 259
           IF+++L  +G+ RD
Sbjct: 318 IFIYILTIIGASRD 331


>gi|116748356|ref|YP_845043.1| hypothetical protein Sfum_0912 [Syntrophobacter fumaroxidans MPOB]
 gi|116697420|gb|ABK16608.1| protein of unknown function UPF0005 [Syntrophobacter fumaroxidans
           MPOB]
          Length = 232

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 89/231 (38%), Positives = 131/231 (56%), Gaps = 19/231 (8%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++ RVYN M +GL  T +++ L    +TT    A    +  G++L   G ++  S     
Sbjct: 19  FVRRVYNWMGIGLATTAVVAMLTFSSSTTSRLLAQYPGLMLGLVLAELGLVIAIS----- 73

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
                          ++   A +A +MF +YSAL G++LS  FLVY   SI  TFF+TA 
Sbjct: 74  -------------AGINRFRASSATLMFFIYSALNGVTLSVIFLVYAHSSIANTFFVTAG 120

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
            F  +S+YGYTT+ DL  +G+F+ MG  G+ L S+VN+F+ S ++D  +S +G++IF  L
Sbjct: 121 MFAIMSVYGYTTRTDLTSLGNFLFMGLIGIILASVVNIFLGSQSLDWIISCLGVIIFVGL 180

Query: 208 TAYDTQKIKEAYSDR-YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           TAYDTQ IK        D    ++ +VIGAL LY+DFI +F+ LLR  G R
Sbjct: 181 TAYDTQSIKAMAHGGFADAETEQKAAVIGALRLYLDFINLFLMLLRLFGRR 231


>gi|161504025|ref|YP_001571137.1| hypothetical protein SARI_02118 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865372|gb|ABX21995.1| hypothetical protein SARI_02118 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 234

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 92/238 (38%), Positives = 134/238 (56%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++        +    +S I   G+++          
Sbjct: 15  SGLQTYMAQVYGWMTVGLLLTAFIAWYAANTPAVMMFVFSSKITFFGLII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L +   L+  +H LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF
Sbjct: 65  --------AQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFVVYTYSSIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG +SLYGYTTKRDL   G+ + M   G+ L SLVN +++S  +   ++ +G++
Sbjct: 117 VVTGGMFGVMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSETLMWIVTYIGVI 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D A   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|148697591|gb|EDL29538.1| glutamate receptor, ionotropic, N-methyl D-asparate-associated
           protein 1 (glutamate binding), isoform CRA_c [Mus
           musculus]
          Length = 378

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/234 (15%), Positives = 94/234 (40%), Gaps = 21/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           +A++ +V+ ++ L L VT     +   +         ++          F +L+  S   
Sbjct: 166 QAFIRKVFLVLTLQLSVTLSTVAIFTFVGEVKGFVRENVWTYYVSYAIFFISLIVLSC-- 223

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      +   + +  +   +      Y +++++    IT
Sbjct: 224 ---------------CGDFRRKHPWNLVALSILTVSLSYMVGMIASFYNTEAVIMAVGIT 268

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
            A   ++ ++   T+ D       +++    LF+ +++ +F+R+  +++  +++G ++F+
Sbjct: 269 TAVCFTVVIFSMQTRYDFTSCMGVLLVSVVVLFIFAILCIFIRNRILEIVYASLGALLFT 328

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
              A DTQ +         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 329 CFLAVDTQLL----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 378


>gi|159046210|ref|YP_001541882.1| hypothetical protein Dshi_3668 [Dinoroseobacter shibae DFL 12]
 gi|157913969|gb|ABV95401.1| protein of unknown function UPF0005 [Dinoroseobacter shibae DFL 12]
          Length = 244

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 85/246 (34%), Positives = 140/246 (56%), Gaps = 25/246 (10%)

Query: 20  TIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALM 79
             D GLR Y+  V+  M  GL ++ +++F V  +A                      AL+
Sbjct: 17  QYDVGLRKYLTGVFAYMGGGLVLSALVAFAVANVAPVT-------------------ALI 57

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIV 139
           + +PL+W+ IFAPL + +F + R   LS  A + +F  ++AL+G+SL+S  LV+T  SIV
Sbjct: 58  FGTPLKWVAIFAPLALVMFASFRFERLSVGALQGLFWGFAALMGVSLASALLVFTGTSIV 117

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
           Q F   +  F +++L+GYTTKRDL   GSF+++G  G+   S+VNLF+ S A+ + +S +
Sbjct: 118 QAFLSASIIFLTMALWGYTTKRDLSGWGSFLMIGLIGVIGASIVNLFLASGALAMAVSVI 177

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQS------VIGALMLYMDFIQIFVHLLRF 253
           G+++F+ LTA D Q+++  Y    +      Q+      ++GAL LY++ I +F  LL  
Sbjct: 178 GVIVFTGLTASDMQRLRNEYLAHCEQGGVATQANLGKLQIMGALSLYLNLINLFQMLLSL 237

Query: 254 LGSRRD 259
            G R++
Sbjct: 238 FGQRQE 243


>gi|152969372|ref|YP_001334481.1| putative transport protein [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|206581124|ref|YP_002239576.1| inner membrane protein YbhL [Klebsiella pneumoniae 342]
 gi|262041130|ref|ZP_06014347.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288936419|ref|YP_003440478.1| hypothetical protein Kvar_3566 [Klebsiella variicola At-22]
 gi|290510525|ref|ZP_06549895.1| inner membrane protein ybhL [Klebsiella sp. 1_1_55]
 gi|330014479|ref|ZP_08307919.1| hypothetical protein HMPREF9538_05639 [Klebsiella sp. MS 92-3]
 gi|150954221|gb|ABR76251.1| putative transport protein [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|206570182|gb|ACI11958.1| inner membrane protein YbhL [Klebsiella pneumoniae 342]
 gi|259041504|gb|EEW42558.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288891128|gb|ADC59446.1| protein of unknown function UPF0005 [Klebsiella variicola At-22]
 gi|289777241|gb|EFD85239.1| inner membrane protein ybhL [Klebsiella sp. 1_1_55]
 gi|328533006|gb|EGF59780.1| hypothetical protein HMPREF9538_05639 [Klebsiella sp. MS 92-3]
          Length = 234

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 95/237 (40%), Positives = 137/237 (57%), Gaps = 20/237 (8%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL+ YM +VY  M +GL +T  +++        +    +S I   G+++           
Sbjct: 16  GLQTYMAQVYGWMTVGLLLTAFIAWFAANTPAVMMFVFSSKITFFGLII----------- 64

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                  A L +   L+  +  LSA  A  +F+LYSAL GL+LSS F+ YT  SI  TF 
Sbjct: 65  -------AQLALVFVLSGMVQRLSAGMATTLFMLYSALTGLTLSSIFIAYTYSSIASTFV 117

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +T   FG++SLYGYTTKRDL   GS + MG  G+ L SLVNL+++S A+   ++ +G+V+
Sbjct: 118 VTGGMFGAMSLYGYTTKRDLSGFGSMLFMGLIGIVLASLVNLWLKSEALMWAVTYIGVVL 177

Query: 204 FSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           F  LTAYDTQK+K         D A   + S++GAL LY+DFI +F+ LLR +G+RR
Sbjct: 178 FVGLTAYDTQKLKNIGEQIDTRDSATLRKYSILGALTLYLDFINLFLMLLRIMGNRR 234


>gi|85058888|ref|YP_454590.1| hypothetical protein SG0910 [Sodalis glossinidius str. 'morsitans']
 gi|84779408|dbj|BAE74185.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 236

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 85/254 (33%), Positives = 139/254 (54%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S        +  ++ +M +VY  M  GL +T  +++        +    +S + 
Sbjct: 1   MDRFPRSQGSIVERANSAVQPFMAQVYGWMTCGLLLTAFVAWYAARTPALLQFIFSSQLT 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++                  A L +   ++  ++ LS   A  +F+LYS L GL+L
Sbjct: 61  FFGLII------------------AQLALVFVISGMVNRLSGAVATSLFMLYSVLTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           +S F+VYT+ SI  TF +TA  FG+++LYGYTTKRDL   G+ + M   G+ L SLVN++
Sbjct: 103 ASIFIVYTASSIASTFVVTAGMFGAMTLYGYTTKRDLSSFGNLLFMALIGIVLASLVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           ++S+A+   ++ +G+V+F  LTAYDTQK+K   +     +     + S++GAL LY+DFI
Sbjct: 163 LKSTALMWAVTYIGVVVFVGLTAYDTQKLKNMGAQLSLDNKDQFRKYSIVGALSLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR  G+RR
Sbjct: 223 NLFLMLLRIFGNRR 236


>gi|295133948|ref|YP_003584624.1| hypothetical protein ZPR_2103 [Zunongwangia profunda SM-A87]
 gi|294981963|gb|ADF52428.1| membrane protein [Zunongwangia profunda SM-A87]
          Length = 242

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 83/243 (34%), Positives = 132/243 (54%), Gaps = 19/243 (7%)

Query: 17  FGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFG 76
             + + QG  AY+ +V+N M L L +TG+ +F        ++   ++ ++  G+++    
Sbjct: 18  SDAQLKQGQTAYINKVFNWMCLALLITGVTAFFAAGSQELMNLIFSNKLVFYGLLI---- 73

Query: 77  ALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSK 136
                           + +  ++   +  LS   A  +F+LYS L G++LS   LV+TS 
Sbjct: 74  --------------GEVLLVGYIGANIQKLSTATATALFILYSVLNGVTLSFILLVFTSA 119

Query: 137 SIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTM 196
           SI  TFF+TA +FG++S YGY TKRDL  IG+   M   G+ + S+VN+F  +  +   +
Sbjct: 120 SIATTFFVTAGTFGAMSAYGYFTKRDLTSIGNLCFMALIGIIIASIVNIFFFNEILYWVI 179

Query: 197 SAMGLVIFSALTAYDTQKIKEAYSDR-YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           +  G++IF  LTAYDTQKIK  Y     D       +++GAL LY+DFI +F+ LLR  G
Sbjct: 180 TYAGVLIFVGLTAYDTQKIKRMYRAGMEDSDIGHNLALMGALRLYLDFINMFLFLLRIFG 239

Query: 256 SRR 258
            R+
Sbjct: 240 DRK 242


>gi|226330873|ref|ZP_03806391.1| hypothetical protein PROPEN_04794 [Proteus penneri ATCC 35198]
 gi|225201668|gb|EEG84022.1| hypothetical protein PROPEN_04794 [Proteus penneri ATCC 35198]
          Length = 236

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 97/254 (38%), Positives = 145/254 (57%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S          GL+ +M +VY  M +GL +T  ++  V      +    +S I+
Sbjct: 1   MDRFSRSNDSIVQRTGSGLQTFMAQVYGWMTVGLLLTAFVALYVASSEALLSMIFSSKIV 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G                  +   L+  +H +S   A  +F+LYS L G+++
Sbjct: 61  FFGLIIAQLG------------------LVFVLSGMVHKMSGAMATSLFMLYSVLTGVTI 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS  LVYT+ SI  TFFI AA FG+LS+YGYTTKR L  +GSF+ MG  G+ + S+VN+F
Sbjct: 103 SSVLLVYTASSIASTFFICAAMFGALSIYGYTTKRSLTGMGSFLFMGLIGIIIASIVNIF 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           M+SS + + +S  G++IF+ LTAYDTQK+K+  ++  + D     R S++GAL LY+DFI
Sbjct: 163 MQSSMMSMVISYAGVLIFAGLTAYDTQKLKDMGNEINQEDKENMRRYSIMGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR LG RR
Sbjct: 223 NLFLMLLRILGDRR 236


>gi|303325473|ref|ZP_07355916.1| putative membrane protein [Desulfovibrio sp. 3_1_syn3]
 gi|302863389|gb|EFL86320.1| putative membrane protein [Desulfovibrio sp. 3_1_syn3]
          Length = 235

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 83/250 (33%), Positives = 136/250 (54%), Gaps = 20/250 (8%)

Query: 12  NSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVM 71
            + S   S +   + AYM +VY  M  GL +T ++++ V       D    + ++   ++
Sbjct: 4   TTRSVAQSGVTSAVSAYMRQVYQWMTAGLALTTVVAYGVANSPAIRDAILGNSLVMILLI 63

Query: 72  LTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFL 131
           +  FG ++  S                    +H +SA  A  +FLLYSAL G  LSS F+
Sbjct: 64  VAQFGMVIALS------------------AAIHKMSAGTATGLFLLYSALTGAMLSSIFV 105

Query: 132 VYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSA 191
           +Y   SI   F +T  +F ++S+YG  TKRDL  +G+F+ MG  G+ +  +VN+F++S+ 
Sbjct: 106 IYPIASIANAFLVTTGTFLAMSVYGTVTKRDLTTMGNFLFMGLIGIIIAMVVNIFLKSTM 165

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFIQIFVH 249
           +D  +S +G++IF+ LTAYDTQK++         D     R +++GAL LY+DFI +F+ 
Sbjct: 166 MDFIISCLGVLIFTGLTAYDTQKLRRFGEAAPLDDGTAVRRGAIMGALTLYLDFINLFLM 225

Query: 250 LLRFLGSRRD 259
           +LR  G  R+
Sbjct: 226 MLRLFGGNRN 235


>gi|114622144|ref|XP_001154339.1| PREDICTED: similar to Glutamate receptor, ionotropic, N-methyl
           D-asparate-associated protein 1 (glutamate binding)
           isoform 3 [Pan troglodytes]
          Length = 352

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 96/234 (41%), Gaps = 21/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           +A++ +V+ ++ L L VT     +   +A        ++          F +L+  S   
Sbjct: 140 QAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVRENVWTYYVSYAVFFISLIVLSC-- 197

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      +   + +A +   +      Y +++++    IT
Sbjct: 198 ---------------CGDFRRKHPWNLVALSVLTASLSYMVGMIASFYNTEAVIMAVGIT 242

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
            A   ++ ++   T+ D       +++    LF+ +++ +F+R+  +++  +++G ++F+
Sbjct: 243 TAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLGALLFT 302

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
              A DTQ +         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 303 CFLAVDTQLL----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 352


>gi|310822412|ref|YP_003954770.1| hypothetical protein STAUR_5171 [Stigmatella aurantiaca DW4/3-1]
 gi|309395484|gb|ADO72943.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 236

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 85/250 (34%), Positives = 130/250 (52%), Gaps = 22/250 (8%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
           +  +S     + + +  RA+M RVY  M  GL +TG+ +         ++          
Sbjct: 9   QTTSSSEVNNALVQESQRAFMSRVYGWMFAGLMLTGVTALYTVSNEALLNQVLQ------ 62

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
                           R   + A LGV + L+     LS   A  +FL YSAL G++LS 
Sbjct: 63  ---------------WRMGLLLAELGVVLALSFLAPRLSGPVAAALFLGYSALTGMTLSI 107

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
           +FL+YT+ SI Q   +T   FG+LSLYG  TK+DL    +F+ MG  G+ L  + N+F+R
Sbjct: 108 YFLIYTAGSIGQALLLTGGVFGALSLYGTLTKKDLSAWAAFLFMGLVGVLLAGVANIFIR 167

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFV 248
           S  +    +   +++F+ LTAYDTQK+++ ++     + A   SV+GAL LY+DFI +F+
Sbjct: 168 SEGMSFVTACACVIVFAGLTAYDTQKLRQMHAATG-YSSAATISVVGALTLYLDFINLFL 226

Query: 249 HLLRFLGSRR 258
            LLR  G RR
Sbjct: 227 ALLRLFGRRR 236


>gi|62179375|ref|YP_215792.1| putative permease [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62127008|gb|AAX64711.1| putative permease [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322713846|gb|EFZ05417.1| putative permease [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 234

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 93/238 (39%), Positives = 135/238 (56%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++        +    +S I   G+++          
Sbjct: 15  SGLQTYMAQVYGWMTVGLLLTAFIAWYAANTPAVMMFVFSSKITFFGLII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L +   L+  +H LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF
Sbjct: 65  --------AQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V
Sbjct: 117 VVTGGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVV 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D A   + S++G L LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGTLTLYLDFINLFLMLLRIFGNRR 234


>gi|282881074|ref|ZP_06289761.1| inner membrane family protein [Prevotella timonensis CRIS 5C-B1]
 gi|281304878|gb|EFA96951.1| inner membrane family protein [Prevotella timonensis CRIS 5C-B1]
          Length = 238

 Score =  119 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 88/233 (37%), Positives = 132/233 (56%), Gaps = 20/233 (8%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A M +VY  M L L +TGI ++ V      +                    L+    + W
Sbjct: 23  ALMRKVYVWMTLALVITGITAYGVASSPNIM------------------MWLVQKPAILW 64

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
             I A L + + ++  ++ LS   A ++F+LYS L G++LS  F+ YT  SI   FFITA
Sbjct: 65  GLIIAELALVLTVSAAINRLSLTTATLLFVLYSVLNGVTLSLIFMAYTLTSIASVFFITA 124

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM-RSSAIDLTMSAMGLVIFS 205
            +FG ++ YGY TKRDL  +G  ++M   GL + S+VN+F  +SS  DL +S +G++IF 
Sbjct: 125 GTFGVMAAYGYFTKRDLTSLGKLLLMALIGLIIASVVNIFFVKSSGFDLIVSYIGVLIFV 184

Query: 206 ALTAYDTQKIKEAYS-DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            LTAYDTQKIK+  +        A++ +++GAL LY+DFI +F++LLR  G R
Sbjct: 185 GLTAYDTQKIKQMLALQTDMGEGAQKIALMGALSLYLDFINLFLYLLRIFGKR 237


>gi|113671354|ref|NP_001038775.1| glutamate [NMDA] receptor-associated protein 1 [Danio rerio]
 gi|108742072|gb|AAI17621.1| Zgc:136572 [Danio rerio]
          Length = 363

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 88/234 (37%), Gaps = 21/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           RA++ +V+ ++ + L VT     +             +           F +L+  S   
Sbjct: 151 RAFIRKVFMVLTVQLLVTFSFVTVFTFAKDAKVFVRRNQWTYYVSYAIFFVSLIVLSCCG 210

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +                         +   + +  +   +      Y + +++    IT
Sbjct: 211 EVR-----------------RKHPWNLVALSILTLSLSYLVGMIASFYDTDAVIMAVGIT 253

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
                ++ ++   TK D       +++    L +  ++ +F+R+  + +  +++G ++F+
Sbjct: 254 VVVCFAVVVFSLQTKYDFTSCYGVLLVCTIVLLVACILCIFIRNKILHIVYASLGALLFT 313

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
              A DTQ +         +A +  + V  AL LY D I IF+++L  +G  RD
Sbjct: 314 CFLAVDTQLL----LGNKKLAISPEEYVFAALNLYTDIINIFLYILAIVGRTRD 363


>gi|56414092|ref|YP_151167.1| permease [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|197363014|ref|YP_002142651.1| permease [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|56128349|gb|AAV77855.1| putative permease [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197094491|emb|CAR60009.1| putative permease [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
          Length = 234

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 93/238 (39%), Positives = 136/238 (57%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++        +    +S I   G+++          
Sbjct: 15  SGLQTYMAQVYGWMTVGLLLTAFIAWYAANTPAVMMFVFSSKITFFGLII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L +   L+  +H LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF
Sbjct: 65  --------AQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 117 VVTGEMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVM 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D A   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|73976235|ref|XP_852305.1| PREDICTED: similar to CG3814-PB, isoform B [Canis familiaris]
          Length = 301

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 95/233 (40%), Gaps = 19/233 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           RA++I+V+ +++  L VTG +  +             +      ++   F  L+      
Sbjct: 88  RAFIIKVFLILSAQLVVTGAIVSVFLFWKGLKAWVLVNAWFTYAILPAFFVVLI------ 141

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                      +            A  ++  L++ L GL L +  + Y ++ ++     T
Sbjct: 142 -----------VLACCGKLRRQVPANYILLGLFTVLQGLLLGAVSVFYNAEEVLWATAAT 190

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A    SL+L+   TK D   +   + +  F L +  ++ LF+RS  + L  + +G ++FS
Sbjct: 191 ALVTLSLTLFALQTKWDFTMLNGMLFVLLFVLIIYGILLLFIRSYWLHLLYAGLGTIVFS 250

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
                D Q +       +       + V  AL +Y+D I +F+ +L+ +G  R
Sbjct: 251 LYLVMDVQLMVG--GRHHHSDLDPEEYVFAALNIYLDIINLFLFILQLVGLGR 301


>gi|237730763|ref|ZP_04561244.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226906302|gb|EEH92220.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 234

 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 90/238 (37%), Positives = 133/238 (55%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M  GL +T  +++        +    +S I   G+++          
Sbjct: 15  SGLQTYMAQVYGWMTCGLLLTAFIAWYAANTPAVMMFVFSSKITFFGLII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L +   L+  +  LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF
Sbjct: 65  --------AQLALVFVLSGMVQRLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG +SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G++
Sbjct: 117 VVTGGMFGIMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVI 176

Query: 203 IFSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D +   + +++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 177 VFVGLTAYDTQKLKNIGEQIDLRDSSNLRKYAILGALTLYLDFINLFLMLLRIFGNRR 234


>gi|301780088|ref|XP_002925460.1| PREDICTED: glutamate [NMDA] receptor-associated protein 1-like
           [Ailuropoda melanoleuca]
          Length = 301

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 50/256 (19%), Positives = 103/256 (40%), Gaps = 20/256 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           I +     +S +      D  +R A++I+V+ +++  L VTG +  +     +       
Sbjct: 65  ISDETTPNDSSNLANPFSDASVRRAFIIKVFLILSAQLVVTGAIVSMFIFWKSLKAWVLV 124

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
           +      ++   F  L+                 +            A  ++   ++ L 
Sbjct: 125 NAWFTYAILPAFFVVLI-----------------VLACCGKLRRKVPANYILLGFFTVLQ 167

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GL L +  + Y ++ ++     TA    SL+L+   TK D   +   + +  F L +  +
Sbjct: 168 GLLLGAVSVFYNAEEVLWATAATALVTLSLTLFALQTKWDFTMLNGMLFVLLFVLIIYGI 227

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           + LF+RS  + L  + +G ++FS     D Q +        D+     + V  AL +Y+D
Sbjct: 228 LLLFIRSYWLHLLYAGLGTIVFSLYLVMDVQLMVGGRHHHSDLD--PEEYVFAALNIYLD 285

Query: 243 FIQIFVHLLRFLGSRR 258
            I +F+ +L+ +G  R
Sbjct: 286 IINLFLFILQLIGLAR 301


>gi|302337819|ref|YP_003803025.1| protein of unknown function UPF0005 [Spirochaeta smaragdinae DSM
           11293]
 gi|301635004|gb|ADK80431.1| protein of unknown function UPF0005 [Spirochaeta smaragdinae DSM
           11293]
          Length = 234

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 84/236 (35%), Positives = 130/236 (55%), Gaps = 21/236 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R  +  VY  M  GL +TG+++  V+                     +    L+    L 
Sbjct: 17  RNIIRNVYLWMTAGLALTGVVAMAVSSSR------------------SMIATLVGNPVLF 58

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           +  I   L +   L+ R++ +SA +A + F  Y+ L G++LS  FL YT ++I   FF T
Sbjct: 59  FALIIGELVLVSVLSARINKMSASSATLAFAGYAVLNGITLSIVFLAYTGQTIALAFFTT 118

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           AA+FG +SL+  TTKRDL  +G +++MG +G+ + +L+N F++S  +   +S +G+ +F 
Sbjct: 119 AATFGGMSLWALTTKRDLSGLGHYLMMGLWGVLIATLINFFLKSPTVYYMISYIGIAVFL 178

Query: 206 ALTAYDTQKIKE---AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            LTAYDTQ IK    AY +  D     + S++GAL LY+DFI IF+ LLR  G RR
Sbjct: 179 GLTAYDTQIIKRWNAAYGNSVDEEGYVKISIMGALKLYLDFINIFLFLLRIFGRRR 234


>gi|147904118|ref|NP_001080331.1| glutamate receptor, ionotropic, N-methyl D-aspartate-associated
           protein 1 (glutamate binding) [Xenopus laevis]
 gi|27503256|gb|AAH42223.1| Grina-prov protein [Xenopus laevis]
          Length = 378

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 90/234 (38%), Gaps = 21/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           RA++ +V+ ++   L VT     +   +         ++          F +L+  S   
Sbjct: 166 RAFIRKVFLVLTAQLLVTFAFVAVFTFVDEAKLYVRRNVWTYYLSYAIFFVSLITLSC-- 223

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      +   + +  +   +      Y + +++    IT
Sbjct: 224 ---------------CGDFRRRHPWNLVALSILTLSLSYMVGMIASFYDTDAVIMAIGIT 268

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A    ++ L+   TK D       +++    L + S++ +F+R+  + +  +++G ++F+
Sbjct: 269 AGVCFTVVLFSMQTKYDFTSCMGVLLVSLIVLLIFSILCIFIRNKILQIVYASLGALLFT 328

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
              A DTQ I         ++ +  + +  AL LY D I IF+++L  +G  ++
Sbjct: 329 CFLAVDTQMI----LGNKQLSLSPEEYIFAALNLYTDIINIFLYILAIIGKAKE 378


>gi|332703207|ref|ZP_08423295.1| protein of unknown function UPF0005 [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332553356|gb|EGJ50400.1| protein of unknown function UPF0005 [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 235

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 88/258 (34%), Positives = 139/258 (53%), Gaps = 25/258 (9%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + NY  +  + +       + + A+M  VY  M  GLGVT +++FLV    T       +
Sbjct: 1   MANYGSMPRTQARA-----EVMNAFMRGVYGWMTAGLGVTAVLAFLVATSPTLAQLFWGN 55

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
            I+  G+++   G +   S                    +H +SA  A  +FLLYSAL G
Sbjct: 56  SILLIGIIIAEVGLVFAISGA------------------IHRMSAGTATSLFLLYSALNG 97

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           ++LS  F  Y   +I + F  TA  FG++S+YG TTK+DL   GSF+ MG  G+F+  +V
Sbjct: 98  ITLSVIFAAYAPAAIFKAFVTTAGMFGAMSIYGLTTKKDLTSWGSFLFMGLIGVFIAMIV 157

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALMLYM 241
           N+F++S  +   +S +G+++F+ LTAYDTQ+++     +   D     R S++GAL LY+
Sbjct: 158 NIFLQSPVMHFVISLVGVIVFTGLTAYDTQQLRVMGESAPYGDATAIRRGSILGALRLYL 217

Query: 242 DFIQIFVHLLRFLGSRRD 259
           DFI +F+ LLR  G  R+
Sbjct: 218 DFINLFLMLLRLFGGSRE 235


>gi|58040340|ref|YP_192304.1| hypothetical protein GOX1910 [Gluconobacter oxydans 621H]
 gi|58002754|gb|AAW61648.1| Hypothetical transmembrane protein [Gluconobacter oxydans 621H]
          Length = 256

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 98/262 (37%), Positives = 154/262 (58%), Gaps = 12/262 (4%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+   N+ R          ++D GLRAYM RV+N MALGL +TG++++ V   +      
Sbjct: 1   MAFNTNFSRTGVQAGA--GSLDAGLRAYMCRVFNWMALGLVITGLVAYGVAQTSLRALFF 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
             + + N  ++L         + L  I IFAPL   + L+  ++ LS  A + +FLL+SA
Sbjct: 59  HLAEMPNGAIVL-------RPTLLGGISIFAPLVFVMVLSFGVNRLSRPAVQGIFLLFSA 111

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
            +G S++S  L YT  S+ +TFF+TA +F  +SL+GYTT  +L  +GSF+ MG  G+ L 
Sbjct: 112 AMGASMASLLLSYTGVSVARTFFVTAITFAGMSLWGYTTGANLARLGSFLFMGLIGIILA 171

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE---RQSVIGAL 237
           S+VN+F+ SS + + +S +G+ +F+ L AYDTQ+IK  Y      A  E   + SV  AL
Sbjct: 172 SVVNIFLHSSPLAMLVSIIGVGLFTLLAAYDTQRIKITYQQYMAYAGPEEVAKLSVYDAL 231

Query: 238 MLYMDFIQIFVHLLRFLGSRRD 259
            +Y++F+ +F  L++F+G R D
Sbjct: 232 TMYLNFVNLFQFLIQFMGVRSD 253


>gi|197284511|ref|YP_002150383.1| hypothetical protein PMI0614 [Proteus mirabilis HI4320]
 gi|227356691|ref|ZP_03841077.1| protein of hypothetical function UPF0005 [Proteus mirabilis ATCC
           29906]
 gi|194681998|emb|CAR41461.1| putative membrane protein [Proteus mirabilis HI4320]
 gi|227163199|gb|EEI48130.1| protein of hypothetical function UPF0005 [Proteus mirabilis ATCC
           29906]
          Length = 236

 Score =  119 bits (297), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 99/254 (38%), Positives = 147/254 (57%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S          GL+ +M +VY  M +GL +T  ++  V   AT ++    + I 
Sbjct: 1   MDRFSRSNDSIVQRTGTGLQTFMAQVYGWMTVGLLLTAFVALYVASSATLIEMIFTNKIF 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++                  A L +   L+  +H +S   A  +F+LYSAL G+++
Sbjct: 61  FFGLII------------------AQLALVFILSGMVHKMSGALATTLFMLYSALTGVTI 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS  +VYT  S+  TFFI AA FG+LS+YGYTTKR L  +GSF+ MG  G+ + S+VN+F
Sbjct: 103 SSVLIVYTYSSVASTFFICAAMFGALSVYGYTTKRSLTGMGSFLFMGLIGIIIASIVNIF 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFI 244
           M+SS + + +S  G++IF+ LTAYDTQK+K+  S+  + D     R S++GAL LY+DFI
Sbjct: 163 MQSSMMSMVISYAGVLIFAGLTAYDTQKLKDMGSEINQEDKENMRRYSIMGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ LLR LG RR
Sbjct: 223 NLFLMLLRILGDRR 236


>gi|4589544|dbj|BAA76794.1| KIAA0950 protein [Homo sapiens]
          Length = 343

 Score =  119 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 84/238 (35%), Gaps = 25/238 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++ + L VT  +  L        D   A+           F          
Sbjct: 127 RVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFAT-------- 178

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      ++  +++  +          Y + S++    IT
Sbjct: 179 ---------YLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGIT 229

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAMGL 201
           A    S++++ + TK D       + +    LF    +L+++  F     +    +A+G 
Sbjct: 230 ALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGA 289

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            +F+   A DTQ +          + +  + + GAL +Y+D I IF   L+  G+ R+
Sbjct: 290 GVFTLFLALDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE 343


>gi|228226|prf||1718347A NMDA receptor:SUBUNIT=Glu-binding
          Length = 516

 Score =  119 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 43/258 (16%), Positives = 100/258 (38%), Gaps = 27/258 (10%)

Query: 6   NYQRVVNSGSGFGSTI-----DQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           NYQ                  D+ +R A++ +V+ ++ L L VT     +   +      
Sbjct: 107 NYQEEGPPSYYDNQDFPSVNWDKSIRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGEVKGF 166

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
             A++          F +L+  S         P  +                     + +
Sbjct: 167 VRANVWTYYVSYAIFFISLIVLSCCGDFRKKHPWNLVAL-----------------SILT 209

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
             +   +      Y +++++    IT A   ++ ++   T+ D       +++    LF+
Sbjct: 210 ISLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSVVVLFI 269

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            +++ +F+R+  +++  +++G ++F+   A DTQ +         ++ +  + V  AL L
Sbjct: 270 FAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAALNL 325

Query: 240 YMDFIQIFVHLLRFLGSR 257
           Y D I IF+++L  +G  
Sbjct: 326 YTDIINIFLYILTIIGRS 343


>gi|296532709|ref|ZP_06895397.1| secY stabilizing membrane protein [Roseomonas cervicalis ATCC
           49957]
 gi|296266962|gb|EFH12899.1| secY stabilizing membrane protein [Roseomonas cervicalis ATCC
           49957]
          Length = 262

 Score =  118 bits (296), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 87/237 (36%), Positives = 139/237 (58%), Gaps = 10/237 (4%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GLR+YM+RVYN MA GL VT I+++++     +             V+          + 
Sbjct: 30  GLRSYMLRVYNWMASGLLVTAIVAYVIANTGLSELFYTVGRSPRGFVVT-------QPTI 82

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
           L +  + APL   + L+  ++ +S   A+ +F L+   +G S+++ F+VY   S+  TFF
Sbjct: 83  LGFAAMLAPLAFVLVLSFGINRMSKTTAQGLFWLFCTAMGASMANIFVVYVGASVASTFF 142

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           +TA+ F ++SLYGYTTKRDL  +G+FM+MG  G+ + SLVN+F+ S  +   +S +G+V+
Sbjct: 143 VTASMFAAISLYGYTTKRDLTKLGAFMMMGLIGIIIASLVNMFVGSGMMAFVISVIGVVV 202

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQS---VIGALMLYMDFIQIFVHLLRFLGSR 257
           F  LTAYDTQ+IK  Y +       +  +   V  AL LY++FI +F  +L+F+G R
Sbjct: 203 FVGLTAYDTQRIKADYVEFAYAEGTDEAAKRSVFDALGLYLNFINLFQLMLQFMGVR 259


>gi|329891283|ref|ZP_08269626.1| conserved hypothetical UPF0005 family protein [Brevundimonas
           diminuta ATCC 11568]
 gi|328846584|gb|EGF96148.1| conserved hypothetical UPF0005 family protein [Brevundimonas
           diminuta ATCC 11568]
          Length = 248

 Score =  118 bits (296), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 95/258 (36%), Positives = 139/258 (53%), Gaps = 12/258 (4%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MSD  N             ++D GLRA+M+ VYN +A+GL V G ++++   +       
Sbjct: 1   MSDFNN-GYARPLPQSADMSVDAGLRAFMLGVYNKLAIGLVVAGALAYVTGNVPAVQQLL 59

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            A +   R          +  + L  I  F+PL +       + + SA    M++    A
Sbjct: 60  FARMDDGR----------IGLTMLGMIVQFSPLVMLFGSMFFMKNPSAKGVNMLYWAVVA 109

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
            IG  L   FL YT+ S+  TFF+TAA+F  LSL GYTTK+DL  +G+F+IMG  GL + 
Sbjct: 110 TIGAGLGVLFLRYTNGSLASTFFVTAAAFAGLSLVGYTTKKDLTGMGTFLIMGVIGLVIA 169

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSV-IGALML 239
           S+VN+FM+S  + L +S  G++IFS L AYDTQ++K  Y        A   +   GAL L
Sbjct: 170 SIVNIFMQSGVMYLIISGAGVLIFSGLIAYDTQRLKMTYYALGGDKNAMGVATGFGALSL 229

Query: 240 YMDFIQIFVHLLRFLGSR 257
           +++FI +F  LL F+GSR
Sbjct: 230 FINFINLFQFLLAFMGSR 247


>gi|8248741|gb|AAB20211.2| NMDA receptor glutamate-binding subunit [Rattus sp.]
          Length = 516

 Score =  118 bits (296), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 43/258 (16%), Positives = 100/258 (38%), Gaps = 27/258 (10%)

Query: 6   NYQRVVNSGSGFGSTI-----DQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           NYQ                  D+ +R A++ +V+ ++ L L VT     +   +      
Sbjct: 107 NYQEEGPPSYYDNQDFPSVNWDKSIRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGEVKGF 166

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
             A++          F +L+  S         P  +                     + +
Sbjct: 167 VRANVWTYYVSYAIFFISLIVLSCCGDFRKKHPWNLVAL-----------------SILT 209

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
             +   +      Y +++++    IT A   ++ ++   T+ D       +++    LF+
Sbjct: 210 ISLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSVVVLFI 269

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            +++ +F+R+  +++  +++G ++F+   A DTQ +         ++ +  + V  AL L
Sbjct: 270 FAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAALNL 325

Query: 240 YMDFIQIFVHLLRFLGSR 257
           Y D I IF+++L  +G  
Sbjct: 326 YTDIINIFLYILTIIGRS 343


>gi|103486304|ref|YP_615865.1| hypothetical protein Sala_0813 [Sphingopyxis alaskensis RB2256]
 gi|98976381|gb|ABF52532.1| protein of unknown function UPF0005 [Sphingopyxis alaskensis
           RB2256]
          Length = 242

 Score =  118 bits (296), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 103/261 (39%), Positives = 153/261 (58%), Gaps = 24/261 (9%)

Query: 1   MSDIRNYQRVVNS----GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATT 56
           M++  +     +      +     +D GLR+YM+ VYN MA G+ +TGI++ L       
Sbjct: 1   MANWNDPNMAASGFGAGANAMDQAVDAGLRSYMLSVYNYMASGVLLTGIVALLAFQSG-- 58

Query: 57  VDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFL 116
                             F A +  SPL W+ + APL   + L+  ++ LS  AA+ +F 
Sbjct: 59  ------------------FTASLIGSPLMWVVMLAPLAFVLVLSFGINKLSTPAAQAIFW 100

Query: 117 LYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFG 176
           +Y+A++GLS+S+ FL +T+ SI  TFF TAA+F  LSLYGYTTK+DL   G+F+IMG  G
Sbjct: 101 VYAAVMGLSMSTIFLAFTATSIATTFFATAAAFLGLSLYGYTTKKDLSGFGTFLIMGVVG 160

Query: 177 LFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGA 236
           + +  L+N F++SSA+   +S +G++IF+ LTAYDTQKIK  Y       +  +  V+GA
Sbjct: 161 ILVAMLINFFVQSSALATAISVIGVLIFAGLTAYDTQKIKSMYFYVRGTDFVGKSVVMGA 220

Query: 237 LMLYMDFIQIFVHLLRFLGSR 257
           L LY+DF+ +F  LL  LGSR
Sbjct: 221 LSLYLDFVNMFTFLLNLLGSR 241


>gi|220904012|ref|YP_002479324.1| hypothetical protein Ddes_0738 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219868311|gb|ACL48646.1| protein of unknown function UPF0005 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 234

 Score =  118 bits (296), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 88/252 (34%), Positives = 137/252 (54%), Gaps = 20/252 (7%)

Query: 10  VVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRG 69
           + N  S   S +      YM +VY  M LGLG+T +M++ V            + +I  G
Sbjct: 1   MTNPRSVAHSGVSSVTSLYMRQVYQWMTLGLGITTVMAWFVASTPAVQQVIFGNSLIMIG 60

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
           +++  FG ++  S                    +H +S   A  +FLLYSAL G +LSS 
Sbjct: 61  LIVAQFGLVIAIS------------------AAVHKMSGSTATGLFLLYSALTGATLSSI 102

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
           F+VY   SI   F +T  +F ++++YG  TKRDL  +GSF+ MG  G+ +  +VN+F++S
Sbjct: 103 FVVYPVASITNAFLVTTGTFLAMTVYGTVTKRDLTAMGSFLFMGLIGIIIAMVVNIFLKS 162

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFIQIF 247
           + +D  +S +G++IF+ LTAYDTQK++         D     R +++GAL LY+DFI +F
Sbjct: 163 AMMDFVVSCLGVLIFTGLTAYDTQKLRRFGESAPLDDATALRRGAILGALTLYLDFINLF 222

Query: 248 VHLLRFLGSRRD 259
           + LLR  G  R+
Sbjct: 223 LMLLRLFGGNRN 234


>gi|194333989|ref|YP_002015849.1| hypothetical protein Paes_1173 [Prosthecochloris aestuarii DSM 271]
 gi|194311807|gb|ACF46202.1| protein of unknown function UPF0005 [Prosthecochloris aestuarii DSM
           271]
          Length = 240

 Score =  118 bits (295), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 86/250 (34%), Positives = 145/250 (58%), Gaps = 18/250 (7%)

Query: 10  VVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRG 69
             +  +   S +       + +VY  M+LGL +T  + +         +   ++ ++  G
Sbjct: 8   NRSVAAPSASVLQDTQTRVINQVYTWMSLGLALTATVGYYTAGTEALRNIIFSNGMVLIG 67

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
           +++   G                  +   L+  ++ LSA AA  +F+LY+AL GL+ S+ 
Sbjct: 68  LVVAQLG------------------IVFALSAAINRLSAAAATGLFILYAALTGLTFSAI 109

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
           FLVYTS SI  TFF+TA +F +++++G+TTKRDL  +GS   M   G+ L ++VN+F+++
Sbjct: 110 FLVYTSVSIASTFFVTAGTFAAMTVFGHTTKRDLTKLGSIAFMALIGIILATVVNMFLQN 169

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
           S ++L +SA+G+++F+ALTAYD Q+IK+  +         + +V+GAL LY+DFI +F+ 
Sbjct: 170 SLLELIVSAVGVLLFTALTAYDAQRIKDMAATVSGGESEAKVAVMGALALYLDFINLFLM 229

Query: 250 LLRFLGSRRD 259
           LLRFLG  RD
Sbjct: 230 LLRFLGVSRD 239


>gi|332031584|gb|EGI71056.1| Glutamate [NMDA] receptor-associated protein 1 [Acromyrmex
           echinatior]
          Length = 326

 Score =  118 bits (295), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 90/234 (38%), Gaps = 20/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +VY+++   L +T  M  L+     T         +           L+  +   
Sbjct: 113 NGFIRKVYSILMCQLLITLGMITLLLYHRPTQLWVKNHSELFWIAFALTLVLLICMTCCT 172

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +                    A    +   L++      LS     Y S+ ++    IT
Sbjct: 173 NVR-----------------RKAPMNFIFLFLFTFAEAFLLSVAASTYESQEVMLAVGIT 215

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           AA    L+++ + TK D   + S + +    L +  ++ +      I L  +++G  IFS
Sbjct: 216 AAVCLGLTIFAFQTKIDFTGLHSVLFVAVLILLIFGIIAVIWHGKVITLVYASLGAFIFS 275

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
               YDTQ +      ++  + +  + +  AL LY+D + IF+++L  +G  RD
Sbjct: 276 LYLIYDTQMMI---GGKHKYSISPEEYIFAALSLYLDVVNIFLYILTIIGVSRD 326


>gi|315607413|ref|ZP_07882411.1| protein of hypothetical function UPF0005 [Prevotella buccae ATCC
           33574]
 gi|315250913|gb|EFU30904.1| protein of hypothetical function UPF0005 [Prevotella buccae ATCC
           33574]
          Length = 244

 Score =  118 bits (295), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 86/252 (34%), Positives = 144/252 (57%), Gaps = 19/252 (7%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
                        ++    A M +VY  MAL L +TGI ++ V      +     + ++ 
Sbjct: 11  NAAEGRTDTRSKELNLAFPALMRKVYTWMALALAITGITAYGVATSPALLTAIFTNKLLF 70

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
            G+++   G + YT+                   RL  LS   A ++F+L+S + G +L+
Sbjct: 71  YGLIIAELGIVFYTT------------------ARLAKLSLSTATLLFILFSVINGATLA 112

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
           S F++YT  SI  TFF+TA +FG+++  GYTTKRDL  +G  ++M   GL + ++VN+F+
Sbjct: 113 SVFVIYTMSSIATTFFVTAGTFGAMAFIGYTTKRDLTKMGGILMMALIGLIIAAVVNMFL 172

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYD-VAYAERQSVIGALMLYMDFIQI 246
            +S  DL +S +G++IF+ LTA+D+Q IK    ++YD    A++ +++G+L LY+DFI +
Sbjct: 173 HNSTFDLIVSGLGVLIFTGLTAWDSQAIKRMLQEQYDMSEGAQKVALLGSLSLYLDFINM 232

Query: 247 FVHLLRFLGSRR 258
           F++LLRFLG R+
Sbjct: 233 FLYLLRFLGDRK 244


>gi|118786613|ref|XP_001237680.1| AGAP005528-PA [Anopheles gambiae str. PEST]
 gi|116126408|gb|EAU76465.1| AGAP005528-PA [Anopheles gambiae str. PEST]
          Length = 287

 Score =  118 bits (295), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 54/234 (23%), Positives = 96/234 (41%), Gaps = 20/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY+++ L L +T +    V     T      +  +     L   G ++  S   
Sbjct: 74  RGFIKKVYSILTLQLSITFVFVAFVMNHEPTQLFIRRNPSLFWIAFLVMIGTMIAISC-- 131

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                 A A  +   L++      +S     Y S+ ++  F IT
Sbjct: 132 ---------------CGELRRKAPANFIFLGLFTFAESFLVSMVAATYKSEEVLLAFGIT 176

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           AA    L+L+ + TK D   +G  +      LFL  L+ +F     + +  S+ G ++FS
Sbjct: 177 AAVCLGLTLFAFQTKWDFTMMGGILFTAVVVLFLFGLIAMFFPGKTMQIVYSSCGALLFS 236

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
               YDTQ +       +  + +  + V  AL LY+D I IF+H+L  +G+ R+
Sbjct: 237 FYLVYDTQIMM---GGSHKFSISPEEYVFAALCLYLDVINIFLHILSIIGASRN 287


>gi|302345908|ref|YP_003814261.1| hypothetical protein HMPREF0659_A6203 [Prevotella melaninogenica
           ATCC 25845]
 gi|302149169|gb|ADK95431.1| putative membrane protein [Prevotella melaninogenica ATCC 25845]
          Length = 240

 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 81/252 (32%), Positives = 138/252 (54%), Gaps = 19/252 (7%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
             V S       + +   + M +VY  MA+ L +TG++++                    
Sbjct: 7   TNVTSSQERDLEMSRVFPSLMRKVYVWMAMALAITGVIAYGAGNSPAL------------ 54

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
                    L        +     +G+  +L+ R+  LS  AA + F+ ++AL GL+L  
Sbjct: 55  ------IQLLYMGRGPLLVAGLVEVGIVWYLSSRIDRLSLVAATVWFIAFAALNGLTLGW 108

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            F  ++S +I +TFFITA +FG+++L G TTK+DL  +G  + M   GL +  LVN+F++
Sbjct: 109 IFAAFSSAAIAKTFFITAGTFGAMALIGSTTKKDLTKMGGILFMALIGLIIAGLVNIFLK 168

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYD-VAYAERQSVIGALMLYMDFIQIF 247
           S+  DL +S +G+++F+ LTA+D QKIK+      D    A++ +++G+L LY+DFI +F
Sbjct: 169 STMFDLIVSGIGVLVFTGLTAWDAQKIKQNLRMAPDAGEGAQKVALLGSLSLYLDFINLF 228

Query: 248 VHLLRFLGSRRD 259
           ++LLRFLG+ R+
Sbjct: 229 LYLLRFLGNNRN 240


>gi|156230115|gb|AAI52279.1| Zgc:64102 protein [Danio rerio]
          Length = 337

 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 39/233 (16%), Positives = 86/233 (36%), Gaps = 21/233 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +V+++++L L +T     +             +        L             
Sbjct: 125 RVFIRKVFSVLSLQLAITTAFVAIFTFEPHVKLFVMQNSWTYWVGYLVFL---------- 174

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                  +  F+ L             +   + +  +  ++      Y +  ++    IT
Sbjct: 175 -------VPYFVILCCGEFRRKHPWNLICLSVLTLAMSYTVGVISSFYDTDIVIMAIGIT 227

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
                 + ++   TK D       + +    LF+  ++ +   S  +DL  S +G ++F+
Sbjct: 228 VVVCFIVIIFSMQTKYDFTSCYGVLFVCGIVLFVFGILCIIFYSKIMDLIYSTLGALLFT 287

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
              A DTQ +        +++ +  + +  +L LY+D IQIF+ +LR LG  R
Sbjct: 288 CFLAVDTQLL----LGNKNLSLSPEEYIFASLNLYLDIIQIFLFILRILGRSR 336


>gi|325268681|ref|ZP_08135311.1| protein of hypothetical function UPF0005 [Prevotella multiformis
           DSM 16608]
 gi|324989209|gb|EGC21162.1| protein of hypothetical function UPF0005 [Prevotella multiformis
           DSM 16608]
          Length = 242

 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 86/260 (33%), Positives = 142/260 (54%), Gaps = 19/260 (7%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+   +    V S       + +     M +VY  MA+ L +TG++++            
Sbjct: 1   MNMNFDNFTNVASSHEHDLEMSRAFPTLMRKVYVWMAMALAITGVVAYGAGNSPAL---- 56

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                            L  +     I   A LG+  +++ R++ LS  +A + F+++SA
Sbjct: 57  --------------IQMLYMSRGPLLIAGLAELGIVWYVSARINRLSLVSATVWFIVFSA 102

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L GL+L   F  +TS +I +TFFITA +FG+++L G TTK+DL  +G  + M   GL + 
Sbjct: 103 LNGLTLGWIFAAFTSAAISKTFFITAGTFGAMALIGSTTKKDLTRMGGILFMALIGLIIA 162

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYD-VAYAERQSVIGALML 239
            LVN+F+RS+ +DL +S +G+++F+ LTA+D Q IK       D    A++ +++GAL L
Sbjct: 163 GLVNVFLRSTMMDLIVSGIGVLVFTGLTAWDAQTIKRNLLMAPDAGESAQKVALLGALSL 222

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y+DFI +F++LLRF G+ RD
Sbjct: 223 YLDFINLFLYLLRFFGNSRD 242


>gi|281356793|ref|ZP_06243284.1| protein of unknown function UPF0005 [Victivallis vadensis ATCC
           BAA-548]
 gi|281316920|gb|EFB00943.1| protein of unknown function UPF0005 [Victivallis vadensis ATCC
           BAA-548]
          Length = 239

 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 78/262 (29%), Positives = 132/262 (50%), Gaps = 27/262 (10%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D R+Y+R   +          G   ++ RV+  M  GL +T  +S+ +          
Sbjct: 1   MND-RSYERAPAAIGQEAQLTQAG---FVNRVFGWMTGGLALTAGISYAIANS------- 49

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                       T    ++         +   + + I L+  ++ +S++ A + F L++A
Sbjct: 50  ------------TMQDFVIQNRGAFLGLLIVEVLLVIGLSAAINKISSFVAGLGFALFAA 97

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L G++LS  F+ Y   +I +TFF T+  FG +  +GY TK+DL  IG    M  +GL + 
Sbjct: 98  LNGVTLSWIFMAYEPAAIYRTFFTTSLMFGGVGAFGYVTKKDLSGIGGMCGMALWGLIVA 157

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEA----YSDRYDVAYAERQSVIGA 236
            L+N+F  +S   L +S  G+V+F+ LTA+D QKIK         ++D    ++ ++ GA
Sbjct: 158 MLINMFWANSTFSLLISICGVVLFTGLTAWDMQKIKLMSLAVGEGQFDAETGKKVAIFGA 217

Query: 237 LMLYMDFIQIFVHLLRFLGSRR 258
           L LY+DFI +F+ LLR  G+RR
Sbjct: 218 LELYLDFINLFLFLLRIFGNRR 239


>gi|301059643|ref|ZP_07200552.1| conserved hypothetical protein [delta proteobacterium NaphS2]
 gi|300446289|gb|EFK10145.1| conserved hypothetical protein [delta proteobacterium NaphS2]
          Length = 221

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 87/235 (37%), Positives = 136/235 (57%), Gaps = 21/235 (8%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++  VYN M +GL +T +++  V+   + +                    +   S +  +
Sbjct: 5   FVRSVYNWMGIGLALTAVVALYVSGNESLM------------------RLIFGNSMIFIL 46

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
            I A LG+   ++  +  LS+  A ++FL+YSAL G++LS  FL YT  SIV TFFI A 
Sbjct: 47  LIVAELGLVFAISGMVQKLSSGTATLLFLIYSALNGVTLSFIFLAYTQTSIVSTFFICAG 106

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
           +F + S+YG+ TKRDL  +G F++MG  G+ + SLVN+F+RS  + + +S +G+++F  L
Sbjct: 107 TFVACSIYGWITKRDLTSMGGFLMMGLIGIIIASLVNMFLRSPGMSMVISYIGVIVFVGL 166

Query: 208 TAYDTQKIKEAYSD---RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           TAYDTQK+K          D A   + +++GAL LY+DFI +F+ LLR  G  RD
Sbjct: 167 TAYDTQKLKNMARTQPVDADGAVVRKGAILGALSLYLDFINLFLMLLRIFGQGRD 221


>gi|224369658|ref|YP_002603822.1| putative cold-shock inducible membrane protein [Desulfobacterium
           autotrophicum HRM2]
 gi|223692375|gb|ACN15658.1| putative cold-shock inducible membrane protein [Desulfobacterium
           autotrophicum HRM2]
          Length = 235

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 89/238 (37%), Positives = 138/238 (57%), Gaps = 21/238 (8%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           + +++  VYN MA+GL +TG  +F V+   T +     + ++  G++    G        
Sbjct: 16  VNSFIRSVYNWMAIGLALTGFTAFYVSGNETLMRAIFGNPVLLFGLIFGELG-------- 67

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
                     +  +L+ R+  + A  A  +F++YS L G++LSS F+VYTS SIV TFFI
Sbjct: 68  ----------LVFYLSARVQKIQASTATALFVVYSILNGVTLSSIFMVYTSTSIVSTFFI 117

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
            A +F   S+YG  TKRDL  +G FM+MG  G+ + +LVN+F RS A+ + +S +G+++F
Sbjct: 118 CALTFSVCSVYGMVTKRDLTSMGGFMMMGLIGIIVATLVNMFFRSPAMSMLISYVGVIVF 177

Query: 205 SALTAYDTQKIKEAYSDRY---DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
             LTAYDTQK+K     +      A   + +++GAL LY+DFI +F+ LLR  G  RD
Sbjct: 178 VGLTAYDTQKLKNMAMTQPADLSGAVVRKGAIMGALTLYLDFINLFLMLLRIFGGSRD 235


>gi|194754515|ref|XP_001959540.1| GF11997 [Drosophila ananassae]
 gi|190620838|gb|EDV36362.1| GF11997 [Drosophila ananassae]
          Length = 323

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 46/253 (18%), Positives = 98/253 (38%), Gaps = 20/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y    +    F        R ++ +VY ++   L +T     L      T      ++ +
Sbjct: 91  YDDPESQPKNFSFDDQSIRRGFIRKVYLILMGQLLITFGAVALFVFHDGTKQFARNNMWL 150

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
               +   F  ++  +    +                   +     +   L++A     +
Sbjct: 151 FWVSLGVLFVTMICMACCESVR-----------------RTFPTNFIFLGLFTAAQSFLM 193

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                 Y  + ++    ITAA   +L+L+ + TK D   +G  ++       +  +V +F
Sbjct: 194 GVSASRYAPQEVLLAVGITAAVCLALTLFAWQTKYDFTMMGGILVACMVVFLIFGIVAIF 253

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           ++   I L  +++G ++FS    YDTQ +       +  + +  + +  AL LY+D I I
Sbjct: 254 IKGKIITLVYASIGALLFSVYLIYDTQLMM---GGEHKYSISPEEYIFAALNLYLDIINI 310

Query: 247 FVHLLRFLGSRRD 259
           F+++L  +G+ RD
Sbjct: 311 FMYILTIIGASRD 323


>gi|148240975|ref|YP_001220476.1| hypothetical protein BBta_p0129 [Bradyrhizobium sp. BTAi1]
 gi|146411351|gb|ABQ39804.1| putative membrane protein of unknown function with BL1 family,
           ybhL-like domain [Bradyrhizobium sp. BTAi1]
          Length = 241

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 90/223 (40%), Positives = 137/223 (61%), Gaps = 19/223 (8%)

Query: 18  GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
           G+ ID GLR +++ VYN M  GL +TG++++                          + +
Sbjct: 19  GAEIDAGLRQFLLSVYNYMGAGLVLTGVVAYGAAETGL-------------------YAS 59

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           L+ T  L W+ + APL     L+ R+  +   AA+  F  Y+ L+GLSL+  FL+YT  S
Sbjct: 60  LVQTPLLFWVIVLAPLAPVFLLSFRIEKMGLGAAQTAFWTYAGLVGLSLAGIFLMYTGVS 119

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           I +TFFITAA+F ++SLYGYTT+ DL   GSF+++G FG+ +  +VNLF+ SSA+ L +S
Sbjct: 120 IARTFFITAATFLAMSLYGYTTRADLARFGSFLMLGLFGIIIAGVVNLFLASSALQLAIS 179

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +G+++F  LTAYDTQ+IKE Y    + A A +++++GAL LY
Sbjct: 180 VIGVIVFVGLTAYDTQRIKEIYLASDNSAVAGKKAIMGALALY 222


>gi|218886029|ref|YP_002435350.1| hypothetical protein DvMF_0927 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756983|gb|ACL07882.1| protein of unknown function UPF0005 [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 235

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 90/250 (36%), Positives = 136/250 (54%), Gaps = 20/250 (8%)

Query: 12  NSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVM 71
            + S       + + A+M  VYN M +GL VT   ++        +     +  +  G++
Sbjct: 4   RTVSAPTRARAETVNAFMRGVYNWMFVGLAVTAGAAWFTASSPAMLQLVFGNSFVLIGLI 63

Query: 72  LTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFL 131
           L   G +M  S                    +  LS  AA  +F+LYSAL G++LS+  L
Sbjct: 64  LAELGLVMGIS------------------AGIARLSGGAATGLFVLYSALNGITLSAVLL 105

Query: 132 VYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSA 191
            YTS ++ Q F   A  FG++SLYG TTK+DL   GSF+ MG  G+ + S+VN+F+ SSA
Sbjct: 106 AYTSGTVFQAFATAAGMFGAMSLYGLTTKKDLTSWGSFLFMGLIGILIASVVNIFVGSSA 165

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFIQIFVH 249
           + L +SA+G+++F+ LTAYD+QK++         D     R +++GAL LY+DFI +F+ 
Sbjct: 166 MSLVISAIGVIVFTGLTAYDSQKLRMMGETAPMDDATAIRRGTILGALTLYLDFINLFLM 225

Query: 250 LLRFLGSRRD 259
           LLR  GS RD
Sbjct: 226 LLRLFGSSRD 235


>gi|83035045|ref|NP_001032682.1| glutamate [NMDA] receptor-associated protein 1 [Bos taurus]
 gi|122138710|sp|Q32L53|GRINA_BOVIN RecName: Full=Glutamate [NMDA] receptor-associated protein 1;
           AltName: Full=NMDA receptor glutamate-binding subunit
 gi|81674071|gb|AAI09762.1| Glutamate receptor, ionotropic, N-methyl D-aspartate-associated
           protein 1 (glutamate binding) [Bos taurus]
 gi|296480739|gb|DAA22854.1| glutamate [NMDA] receptor-associated protein 1 [Bos taurus]
          Length = 366

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 38/239 (15%), Positives = 95/239 (39%), Gaps = 22/239 (9%)

Query: 22  DQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           D+ +R A++ +V+ ++ L L VT     +   +         ++          F +L+ 
Sbjct: 149 DKSIRQAFIRKVFLVLTLQLSVTLSTVAVFTFVGEVKGFVRENVWTYYVSYAIFFVSLIV 208

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S                              +   + +  +   +      Y +++++ 
Sbjct: 209 LSC-----------------CGDFRRKHPWNLVALSILTVSLSYMVGMIASFYNTEAVIM 251

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              IT     ++ ++   T+ D       +++    L L +++ +F+RS  +++  +++G
Sbjct: 252 AVGITTTVCFTVVIFSMQTRYDFTSCVGVLLVSVVVLILFAILCIFIRSRVLEIVYASLG 311

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++F+   A DTQ +         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 312 ALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 366


>gi|149066128|gb|EDM16001.1| glutamate receptor, ionotropic, N-methyl D-asparate-associated
           protein 1 (glutamate binding), isoform CRA_c [Rattus
           norvegicus]
          Length = 373

 Score =  117 bits (293), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 42/260 (16%), Positives = 101/260 (38%), Gaps = 27/260 (10%)

Query: 6   NYQRVVNSGSGFGSTI-----DQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           NYQ                  D+ +R A++ +V+ ++ L L VT     +   +      
Sbjct: 135 NYQEEGPPSYYDNQDFPSVNWDKSIRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGEVKGF 194

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
             A++          F +L+  S                              +   + +
Sbjct: 195 VRANVWTYYVSYAIFFISLIVLSC-----------------CGDFRRKHPWNLVALSILT 237

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
             +   +      Y +++++    IT A   ++ ++   T+ D       +++    LF+
Sbjct: 238 ISLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSVVVLFI 297

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
            +++ +F+R+  +++  +++G ++F+   A DTQ +         ++ +  + V  AL L
Sbjct: 298 FAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAALNL 353

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y D I IF+++L  +G  ++
Sbjct: 354 YTDIINIFLYILTIIGRAKE 373


>gi|307171709|gb|EFN63444.1| Glutamate [NMDA] receptor-associated protein 1 [Camponotus
           floridanus]
          Length = 325

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 45/236 (19%), Positives = 101/236 (42%), Gaps = 24/236 (10%)

Query: 26  RAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
             ++ +VY+++   L +T G++++ +    T +                    +   + L
Sbjct: 112 NGFIRKVYSILMCQLLITLGMITWFLYHQPTQL-------------------WVRRHTEL 152

Query: 85  RWIFIFAPLGVFIFLNVRLH-SLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
            W+     + + I +    +    A    +   L++      L++    Y S+ ++    
Sbjct: 153 FWVAFAITIVLIICMACCTNVRRKAPMNFIFLFLFTFAEAFLLATASSTYHSEEVMLAVG 212

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           ITAA    L+L+ + TK D   + S + +    L +  ++ +      + L  +++G +I
Sbjct: 213 ITAAICLGLTLFAFQTKIDFTGLHSVLFVAVLVLLIFGIIAMIWPGKIMTLVYASLGALI 272

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           FS    YDTQ        ++  + +  + +  AL LY+D + IF+++L  +G+ RD
Sbjct: 273 FSFYLIYDTQM---MIGGKHKYSVSPEEYIFAALSLYLDVVNIFIYILTIIGASRD 325


>gi|288803983|ref|ZP_06409405.1| membrane protein [Prevotella melaninogenica D18]
 gi|288333553|gb|EFC72006.1| membrane protein [Prevotella melaninogenica D18]
          Length = 232

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 81/250 (32%), Positives = 139/250 (55%), Gaps = 19/250 (7%)

Query: 11  VNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGV 70
           + S       + +   + M +VY  MA+ L +TG++++        +             
Sbjct: 1   MTSSQERDLEMSRVFPSLMRKVYVWMAMALAITGVIAYGAGNSPALIQF----------- 49

Query: 71  MLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFF 130
                  L        +     +G+  +L+ R+  LS  AA + F+ ++AL GL+L   F
Sbjct: 50  -------LYMGRGPLLVAGLVEVGIVWYLSSRIDRLSLVAATIWFIAFAALNGLTLGWIF 102

Query: 131 LVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSS 190
             ++S +I +TFFITA +FG+++L G TTK+DL  +G  + M   GL +  LVN+F++SS
Sbjct: 103 AAFSSAAIAKTFFITAGTFGAMALIGSTTKKDLTKMGGILFMALIGLIIAGLVNIFLKSS 162

Query: 191 AIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYD-VAYAERQSVIGALMLYMDFIQIFVH 249
             DL +S +G+++F+ LTA+D QKIK+      D    A++ +++G+L LY+DFI +F++
Sbjct: 163 MFDLIVSGIGVLVFTGLTAWDAQKIKQNLRMAPDAGEGAQKVALLGSLSLYLDFINLFLY 222

Query: 250 LLRFLGSRRD 259
           LLRFLG+ R+
Sbjct: 223 LLRFLGNNRN 232


>gi|84500275|ref|ZP_00998541.1| hypothetical protein OB2597_10044 [Oceanicola batsensis HTCC2597]
 gi|84392209|gb|EAQ04477.1| hypothetical protein OB2597_10044 [Oceanicola batsensis HTCC2597]
          Length = 220

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 85/232 (36%), Positives = 139/232 (59%), Gaps = 16/232 (6%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M +VY  M++G+ +T ++++ V      +        +   ++              WI 
Sbjct: 1   MNKVYGTMSVGMVLTFLVAWAVGSSPELLSVFRDPATLQPNIL-------------GWIV 47

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           +FAPL +    +  ++ +SA AA++ F  ++A++GLSLS  F+ +T  SI Q F +TA +
Sbjct: 48  MFAPLIMVFAFSAMINRMSAAAAQLFFYAFAAVMGLSLSWIFVAFTGFSIAQVFLVTAIA 107

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           F  LSLYGY TKRDL  +G+F++MG  GL + S++NLF+ SSA+   ++ +G++IF+ LT
Sbjct: 108 FAGLSLYGYVTKRDLSGMGTFLMMGVIGLIVASIINLFIASSALHFAITIIGVLIFAGLT 167

Query: 209 AYDTQKIKEAYSD---RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           AYDTQ IK  Y       D  +  + +++GAL LY+DFI +F+ LL+ LG+R
Sbjct: 168 AYDTQSIKNEYVQHAHHGDSEWLGKSAIMGALRLYLDFINMFMFLLQLLGNR 219


>gi|218777992|ref|YP_002429310.1| hypothetical protein Dalk_0132 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218759376|gb|ACL01842.1| protein of unknown function UPF0005 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 235

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 80/249 (32%), Positives = 134/249 (53%), Gaps = 21/249 (8%)

Query: 14  GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
                  +   + A++  VYN M +GL +TG++++    +         +  +  G+++ 
Sbjct: 5   TYQSPEQVQARVNAFVASVYNWMFIGLTLTGVLAYATFQVPALTKLIFNTPGVFIGLII- 63

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
                            A L +   L+ R+ ++ A  A  MF++YSAL GL++S  F VY
Sbjct: 64  -----------------AELALVFILSSRITTMKAGTATGMFVVYSALNGLTMSFIFAVY 106

Query: 134 TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAID 193
              +I   FF TA +F + S+YG+ TK+DL  +G FM MG  G+ + S+VN+F+ S+A+ 
Sbjct: 107 AKTAIFGAFFATAGTFAACSVYGWVTKKDLTSMGGFMFMGLIGVIIASVVNIFLASTALY 166

Query: 194 LTMSAMGLVIFSALTAYDTQKIKEAYSDRYD---VAYAERQSVIGALMLYMDFIQIFVHL 250
             ++ + + IF  LTAYDTQKIKE    + +    +   + +++GAL LY+DFI +F+ +
Sbjct: 167 WAITYLTIAIFVGLTAYDTQKIKEMALTQPEDIGASAVRKGAIMGALHLYLDFINLFLMM 226

Query: 251 LRFLGSRRD 259
           LR  G  RD
Sbjct: 227 LRLFGGGRD 235


>gi|297183712|gb|ADI19837.1| integral membrane protein, interacts with ftsh [uncultured alpha
           proteobacterium EB000_37G09]
          Length = 239

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 99/250 (39%), Positives = 162/250 (64%), Gaps = 15/250 (6%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
            R  +  +   + +D GLR+YM+ VYN M   LG+TG  +F + +               
Sbjct: 4   NRFASPAAAQSAAVDAGLRSYMLGVYNHMTTALGITGFAAFGMKLA-------------- 49

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
             +     G +++T+P+ ++ +FAP G+ ++L++R++++SA  A+ +F +Y+ ++G+SL+
Sbjct: 50  -VMANPALGQVLFTAPMIYVLMFAPFGMVMWLSMRINTMSATKARSLFYIYAVMMGVSLT 108

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
           +    YT  S+ + FFITA +F +LS+YGYTTKRDL  +G+F+I+G  GL L S+VN+F+
Sbjct: 109 TVLFAYTGASVARAFFITAGAFAALSIYGYTTKRDLTALGAFLIVGLVGLILASVVNMFV 168

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIF 247
            SS  +  +S +G+++F+ LTAYDTQKIK  YS R D   A R+S+ GAL LY+DFI +F
Sbjct: 169 ASSQFEFLISIVGVLLFAGLTAYDTQKIKSMYSARDDKTTAARKSIFGALTLYLDFINMF 228

Query: 248 VHLLRFLGSR 257
           + +LR  G+R
Sbjct: 229 LMMLRLFGNR 238


>gi|225712854|gb|ACO12273.1| Transmembrane BAX inhibitor motif-containing protein 1
           [Lepeophtheirus salmonis]
          Length = 351

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 43/246 (17%), Positives = 104/246 (42%), Gaps = 22/246 (8%)

Query: 12  NSGSGFGSTIDQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGV 70
           N+G    S  D+ +R  ++ +V+ ++++ L +T I+  +   +         + ++    
Sbjct: 121 NAGISPSSFGDKAVRRGFIKKVFGILSVQLIITTIVIAMFMKIEPLRMFAYKNPVLMYVA 180

Query: 71  MLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFF 130
               F  L   +    +                    +    ++ ++++    + LS+  
Sbjct: 181 FGIVFMTLCAMACSESLR-----------------RKSPINLILLVIFTLAESIMLSTVT 223

Query: 131 LVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRS 189
           + Y +++++    I A     L+++ + TK D    G+ +++    LFL  L  +F   +
Sbjct: 224 VHYKTEAVLLAAGICAVVTFGLTIFAFQTKIDFTKCGACLMVCVLILFLAGLAMIFLPTN 283

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
               +  S++G +IFS    YD Q +       +  + +  + ++ AL LY+D I +F+ 
Sbjct: 284 KYASIAYSSVGALIFSLYIVYDVQMMM---GGNHRYSISPEEYIMAALNLYIDIINLFMF 340

Query: 250 LLRFLG 255
           +L  +G
Sbjct: 341 ILSIIG 346


>gi|194448564|ref|YP_002044834.1| hypothetical protein SeHA_C0933 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194406868|gb|ACF67087.1| inner membrane protein YbhL [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
          Length = 237

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 93/238 (39%), Positives = 134/238 (56%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++        +    +S I   G+++          
Sbjct: 15  SGLQTYMAQVYGWMTVGLLLTAFIAWYAANTPAVMMFVFSSKITFFGLII---------- 64

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L +   L+  +H LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF
Sbjct: 65  --------AQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTF 116

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V
Sbjct: 117 VVTGGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVV 176

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D A   + S++GAL LY+DFI +F+ LLR  G  R
Sbjct: 177 VFVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGKVR 234


>gi|313203021|ref|YP_004041678.1| hypothetical protein Palpr_0534 [Paludibacter propionicigenes WB4]
 gi|312442337|gb|ADQ78693.1| protein of unknown function UPF0005 [Paludibacter propionicigenes
           WB4]
          Length = 232

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 80/233 (34%), Positives = 128/233 (54%), Gaps = 19/233 (8%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            + +RVY+ M++ L +TG++++        +        +  G+M+              
Sbjct: 18  RFFVRVYSWMSMALIITGLVAYRTANSPEILSLIFGERFVFYGLMI-------------- 63

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                 L +   L   ++ +SA  A ++F+LYS L G++LS+ F V+T+ SI   FFI A
Sbjct: 64  ----LELVLVGVLVGAINKMSAITATIVFILYSVLNGVTLSAIFFVFTADSIANVFFIAA 119

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
            +F ++S YGY TK DL  IG+ + M   GL + SLVN+F++S  +    S  G++IF  
Sbjct: 120 GTFAAMSAYGYFTKSDLTKIGNILFMALIGLVIASLVNMFLKSEMLYWISSYAGVLIFVG 179

Query: 207 LTAYDTQKIKEA-YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           L AYDTQK+K+       D    ++ ++IGAL LY+DFI +F++LLR  G RR
Sbjct: 180 LIAYDTQKLKKLNIIGNEDTDEGKKVAIIGALTLYLDFINLFLYLLRIFGKRR 232


>gi|317154422|ref|YP_004122470.1| hypothetical protein Daes_2728 [Desulfovibrio aespoeensis Aspo-2]
 gi|316944673|gb|ADU63724.1| protein of unknown function UPF0005 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 243

 Score =  116 bits (291), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 89/248 (35%), Positives = 143/248 (57%), Gaps = 11/248 (4%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
             +       + + A+M  VY  M+ GL +T ++S++V              ++    ++
Sbjct: 5   PSASGQMAKTEVVNAFMRGVYGWMSGGLALTALVSYIVINS---------QALMQMFFVV 55

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
                    S L +I +FA LG+  +L+ R+ +++   A  +F+LYS L GL+L+   L 
Sbjct: 56  DPATGTASMSTLVFILLFAELGIVFYLSARISTMNPATATGLFMLYSGLNGLTLTPILLA 115

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT++S+  TFFI+A  FG++S YG  TK+DL   GS + MG  G+ +  +VN+FM+SSA+
Sbjct: 116 YTAESVASTFFISAGMFGAMSAYGLLTKKDLTSWGSLLFMGLIGIIIAMVVNMFMQSSAM 175

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHL 250
              +S +G++IF  LTAYDTQK+K    +    D A   R +++GAL LY+DFI +F+ L
Sbjct: 176 AFAISVIGVIIFLGLTAYDTQKLKTMGENVPVGDTAAIRRGTILGALTLYLDFINLFLML 235

Query: 251 LRFLGSRR 258
           LR +G RR
Sbjct: 236 LRLMGDRR 243


>gi|17647735|ref|NP_523722.1| N-methyl-D-aspartate receptor-associated protein, isoform C
           [Drosophila melanogaster]
 gi|24653225|ref|NP_725239.1| N-methyl-D-aspartate receptor-associated protein, isoform D
           [Drosophila melanogaster]
 gi|45551091|ref|NP_725241.2| N-methyl-D-aspartate receptor-associated protein, isoform E
           [Drosophila melanogaster]
 gi|7303388|gb|AAF58446.1| N-methyl-D-aspartate receptor-associated protein, isoform C
           [Drosophila melanogaster]
 gi|21627290|gb|AAM68614.1| N-methyl-D-aspartate receptor-associated protein, isoform D
           [Drosophila melanogaster]
 gi|25010005|gb|AAN71168.1| GH11283p [Drosophila melanogaster]
 gi|45445571|gb|AAM68616.2| N-methyl-D-aspartate receptor-associated protein, isoform E
           [Drosophila melanogaster]
 gi|220950614|gb|ACL87850.1| Nmda1-PC [synthetic construct]
 gi|220959330|gb|ACL92208.1| Nmda1-PC [synthetic construct]
          Length = 324

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 47/253 (18%), Positives = 95/253 (37%), Gaps = 20/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y    +    F        R ++ +VY ++   L VT     L      T      ++ +
Sbjct: 92  YDDPESQPKNFSFDDQSIRRGFIRKVYLILMGQLIVTFGAVALFVYHEGTKTFARNNMWL 151

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
               +      ++  +    +                         +   L++A     +
Sbjct: 152 FWVALGVMLVTMLSMACCESVR-----------------RQTPTNFIFLGLFTAAQSFLM 194

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                 Y  K ++    ITAA   +L+++   TK D   +G  +I       +  +V +F
Sbjct: 195 GVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIF 254

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           ++   I L  +++G ++FS    YDTQ +       +  + +  + +  AL LY+D I I
Sbjct: 255 VKGKIITLVYASIGALLFSVYLIYDTQLMM---GGEHKYSISPEEYIFAALNLYLDIINI 311

Query: 247 FVHLLRFLGSRRD 259
           F+++L  +G+ RD
Sbjct: 312 FMYILTIIGASRD 324


>gi|194883506|ref|XP_001975842.1| GG22542 [Drosophila erecta]
 gi|190659029|gb|EDV56242.1| GG22542 [Drosophila erecta]
          Length = 324

 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 48/253 (18%), Positives = 95/253 (37%), Gaps = 20/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y    +    F        R ++ +VY ++   L VT     L      T      ++ +
Sbjct: 92  YDDPESQPKNFSFDDQSIRRGFIRKVYLILMGQLIVTFGAVALFVYHDGTKTFARNNMWL 151

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
               +      ++  +    +                         +   L++A     +
Sbjct: 152 FWVALGVMLVTMLSMACCESVR-----------------RQTPTNFIFLGLFTAAQSFLM 194

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                 Y  + ++    ITAA   +L+L+   TK D   IG  +I       +  +V +F
Sbjct: 195 GVSATKYAPEEVLLAVGITAAVCLALTLFALQTKYDFTMIGGILIACMVVFLIFGIVTIF 254

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           ++   I L  +++G ++FS    YDTQ +       +  + +  + +  AL LY+D I I
Sbjct: 255 VKGRTITLVYASIGALLFSVYLIYDTQLMM---GGEHKYSISPEEYIFAALNLYLDIINI 311

Query: 247 FVHLLRFLGSRRD 259
           F+++L  +G+ RD
Sbjct: 312 FMYILTIIGASRD 324


>gi|282879267|ref|ZP_06288014.1| inner membrane family protein [Prevotella buccalis ATCC 35310]
 gi|281298611|gb|EFA91033.1| inner membrane family protein [Prevotella buccalis ATCC 35310]
          Length = 238

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 90/233 (38%), Positives = 132/233 (56%), Gaps = 20/233 (8%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A M +VY  M L L +TGI ++ V    + +                    +  T  + W
Sbjct: 23  ALMRKVYVWMTLALVLTGITAYGVASSPSLM------------------MTIFQTPAIMW 64

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
             I A L + I ++  ++ LS   A ++F+LYS L G + S  F VYT  SI   FFITA
Sbjct: 65  GLIIAELAIVIAISAAINRLSLTTATLLFVLYSVLNGATFSLIFAVYTMSSIANVFFITA 124

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMSAMGLVIFS 205
            +FG ++ YGY TKRDL   G  ++M   GL + +LVN+F ++SS  DL +S  G++IF 
Sbjct: 125 GTFGVMAAYGYFTKRDLSSWGKLLLMALIGLIIATLVNVFLVKSSGFDLILSYAGVLIFV 184

Query: 206 ALTAYDTQKIKEAYSDRYD-VAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            LTAYDTQKIK+  + + D    A++ +++GAL LY+DFI +F++LLR  G R
Sbjct: 185 GLTAYDTQKIKQMLAMQTDMGEGAQKVALLGALSLYLDFINLFLYLLRIFGRR 237


>gi|224582620|ref|YP_002636418.1| permease [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|224467147|gb|ACN44977.1| putative permease [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
          Length = 224

 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 94/238 (39%), Positives = 136/238 (57%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL+ YM +VY  M +GL +T  +++        +    +S I   G+++          
Sbjct: 5   SGLQTYMAQVYGWMTVGLLLTAFIAWYAANTPAVMMFVFSSKITFFGLII---------- 54

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L +   L+  +H LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF
Sbjct: 55  --------AQLALVFVLSGLVHKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTF 106

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V
Sbjct: 107 VVTGGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVV 166

Query: 203 IFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F  LTAYDTQK+K         D A   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 167 VFVGLTAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR 224


>gi|195333906|ref|XP_002033627.1| GM20327 [Drosophila sechellia]
 gi|194125597|gb|EDW47640.1| GM20327 [Drosophila sechellia]
          Length = 324

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 47/253 (18%), Positives = 95/253 (37%), Gaps = 20/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y    +    F        R ++ +VY ++   L VT     L      T      ++ +
Sbjct: 92  YDDPESQPKNFSFDDQSIRRGFIRKVYLILMGQLIVTFGAVALFVYHEGTKTFARNNMWL 151

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
               +      ++  +    +                         +   L++A     +
Sbjct: 152 FWVALGVMLVTMLSMACCESVR-----------------RQTPTNFIFLGLFTAAQSFLM 194

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                 Y  K ++    ITAA   +L+++   TK D   +G  +I       +  +V +F
Sbjct: 195 GVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIF 254

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           ++   I L  +++G ++FS    YDTQ +       +  + +  + +  AL LY+D I I
Sbjct: 255 VKGKIITLVYASIGALLFSVYLIYDTQLMM---GGEHKYSISPEEYIFAALNLYLDIINI 311

Query: 247 FVHLLRFLGSRRD 259
           F+++L  +G+ RD
Sbjct: 312 FMYILTIIGASRD 324


>gi|322802267|gb|EFZ22663.1| hypothetical protein SINV_04200 [Solenopsis invicta]
          Length = 299

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 96/235 (40%), Gaps = 22/235 (9%)

Query: 26  RAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
             ++ +VY+++   L +T G++S  +    T     +   +      +T           
Sbjct: 86  NGFIRKVYSILMCQLVITLGMISLFLYHQPTQRWVQSHREVFWIAFAMT----------- 134

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
                   + +            A    +   L++      L++    Y S+ ++    I
Sbjct: 135 -------IVLIICMACCTSVRRKAPMNFIFLFLFTIAEAFLLATAASTYQSQEVMLAVGI 187

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TAA    L+++ + TK D   + S + +    L +  ++ +F     I L  +++G +IF
Sbjct: 188 TAAVCLGLTIFAFQTKIDFTGLHSVLFVAVLILMIFGIITIFWHGKVITLVYASLGALIF 247

Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           S    YDTQ        ++  + +  + +  AL LY+D I IF+++L  +G+ RD
Sbjct: 248 SLYLIYDTQM---MIGGKHKYSVSPEEYIFAALSLYLDVINIFLYILTIIGATRD 299


>gi|171683199|ref|XP_001906542.1| hypothetical protein [Podospora anserina S mat+]
 gi|170941559|emb|CAP67211.1| unnamed protein product [Podospora anserina S mat+]
          Length = 355

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 42/255 (16%), Positives = 89/255 (34%), Gaps = 29/255 (11%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N       G        +    ++ +VY ++ + +  T ++S L  +     +    +  
Sbjct: 128 NIPDDFKFGGSVAEATLEIRNQFIRKVYTILTVQILATTLVSSLSFMSDGYRNWIQNNPT 187

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           +    +    G ++ T                         S     +    ++ L   +
Sbjct: 188 VLWLSLFGSMGFMILTYW--------------------KRHSYPTNLLFLSGFTLLEAYT 227

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           +S     Y S  ++    +T   F  L+ +   +K D      ++    +GL L   ++ 
Sbjct: 228 ISVIVSFYDSSIVLNAVVLTGGIFIFLTAFACQSKYDFTSWMPYLFGALWGLVLFGFMSF 287

Query: 186 F-MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
           F   +S  +L    +  +IFS     DTQ +   +    +        +  AL LY+D I
Sbjct: 288 FLPHTSTTELIYGLLAALIFSGYILVDTQLVMRKHHVEEE--------IAAALSLYLDII 339

Query: 245 QIFVHLLRFLGSRRD 259
            +F+ +LR L S+ +
Sbjct: 340 NLFLAILRILNSQNN 354


>gi|291389107|ref|XP_002711170.1| PREDICTED: Fas apoptotic inhibitory molecule 2 isoform 1
           [Oryctolagus cuniculus]
          Length = 316

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 84/239 (35%), Gaps = 27/239 (11%)

Query: 26  RAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           R ++ +VY ++ + L VT G+++             A          +     L      
Sbjct: 100 RVFIRKVYTILLIQLLVTLGVVALFTFCDPVKDYVQANPGWYWASYAVFFVTYL------ 153

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
                                       ++  +++  +          Y + S++    I
Sbjct: 154 ------------TLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGI 201

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAMG 200
           TA    S++++ + TK D       + +    L     +L+++  F     +    + +G
Sbjct: 202 TALVCLSVTIFSFQTKFDFTSCQGVIFVLLMTLLFSGLILAILLPFQYVPWLHAIYAVLG 261

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
             +F+   A+DTQ +          + +  + + GAL +Y+D I IF   L+  G+ RD
Sbjct: 262 AGVFTLFLAFDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRD 316


>gi|213511350|ref|NP_001133606.1| glutamate receptor, ionotropic, N-methyl D-aspartate-associated
           protein 1 (glutamate binding) [Salmo salar]
 gi|209154658|gb|ACI33561.1| Glutamate receptor-associated protein 1 [Salmo salar]
          Length = 390

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 43/234 (18%), Positives = 89/234 (38%), Gaps = 21/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           RA++ +V+ ++ + L VT     L   +        A+           F +L+  S   
Sbjct: 178 RAFIRKVFMVLTVQLMVTFFFVALFTFVEEIKVFVRANTWTYWASYGVFFVSLITISC-- 235

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      +   + +  +   +      Y + S++    IT
Sbjct: 236 ---------------CGEFRRKHPWNLIALSILTLAMSYMVGMIASFYDTDSVIMAVGIT 280

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A    ++ ++   TK D       +++    L L   + +F+R+  ++L  +++G ++F+
Sbjct: 281 AVVCFTVVIFSLQTKYDFTSCHGVLLVCLIVLVLFGFLCIFIRNKILELVYASLGALLFT 340

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
              A DTQ +        + A +    V  AL LY D I IF+++L  +G  R+
Sbjct: 341 CFLAVDTQLL----LGNKENALSPEDYVFAALSLYTDIINIFLYILAIVGRARN 390


>gi|291389109|ref|XP_002711171.1| PREDICTED: Fas apoptotic inhibitory molecule 2 isoform 2
           [Oryctolagus cuniculus]
          Length = 304

 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 84/239 (35%), Gaps = 27/239 (11%)

Query: 26  RAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           R ++ +VY ++ + L VT G+++             A          +     L      
Sbjct: 88  RVFIRKVYTILLIQLLVTLGVVALFTFCDPVKDYVQANPGWYWASYAVFFVTYL------ 141

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
                                       ++  +++  +          Y + S++    I
Sbjct: 142 ------------TLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGI 189

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAMG 200
           TA    S++++ + TK D       + +    L     +L+++  F     +    + +G
Sbjct: 190 TALVCLSVTIFSFQTKFDFTSCQGVIFVLLMTLLFSGLILAILLPFQYVPWLHAIYAVLG 249

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
             +F+   A+DTQ +          + +  + + GAL +Y+D I IF   L+  G+ RD
Sbjct: 250 AGVFTLFLAFDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRD 304


>gi|332298561|ref|YP_004440483.1| protein of unknown function UPF0005 [Treponema brennaborense DSM
           12168]
 gi|332181664|gb|AEE17352.1| protein of unknown function UPF0005 [Treponema brennaborense DSM
           12168]
          Length = 230

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 75/238 (31%), Positives = 126/238 (52%), Gaps = 18/238 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           +   + +M  VY+ M L L ++   +++       +     +  +   ++L         
Sbjct: 11  ESARKKFMTGVYSWMVLALAISAACAYVTATNTVLLSFIFGNAFVFPILVL--------- 61

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
                      L +  +L+ R+  +SA AA   F+ YS L G++LSS  LVY+  SIV+ 
Sbjct: 62  ---------GELALVFWLSARIGKMSAGAAAAAFVAYSVLNGITLSSVVLVYSGASIVRV 112

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F ITA  F  +S+YG  TK DL   G +++M  FG+ + S+VN+F RSS +D  +S + +
Sbjct: 113 FLITAGMFACMSVYGRVTKSDLRSAGRYLMMAVFGILIASVVNVFTRSSGLDWILSLVTV 172

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            +F+ LTAYDTQK+    +   +     + ++IGAL LY+DF+ +F+ LLR  G  ++
Sbjct: 173 GVFTGLTAYDTQKLYRISAQADESELFAKVAIIGALELYLDFVNVFLALLRLFGKSKN 230


>gi|328956668|ref|YP_004374054.1| putative integral inner membrane protein [Carnobacterium sp. 17-4]
 gi|328672992|gb|AEB29038.1| putative integral inner membrane protein [Carnobacterium sp. 17-4]
          Length = 239

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 79/255 (30%), Positives = 116/255 (45%), Gaps = 18/255 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +            S    GL  +   +Y+ MA+GL +TGI +F  +  A  ++    +  
Sbjct: 2   DNMNTPRKEVSNQSINTAGLSKFFASIYSYMAVGLTITGITAFYASQSAFILNLVFGTRF 61

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                 +     +M  S        A   +  F+                  ++ + G+ 
Sbjct: 62  GFLAFFIAEIALVMKLSANGAKLKSAGASIVGFI-----------------AFAIINGII 104

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN- 184
           LSS FL+Y   SI   F  TAASF  +SL G+TTK+DL  +G  +     GL +  LVN 
Sbjct: 105 LSSIFLMYDLGSIGAAFISTAASFAGMSLVGFTTKKDLTSLGGQLRGALIGLIIAMLVNG 164

Query: 185 LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
            F++S   D+ +S + +VIF   TAYDTQK+KE Y            ++ GAL LY+DFI
Sbjct: 165 FFLQSGPADMVLSFITVVIFIGFTAYDTQKLKELYVHHSGEENLGALAISGALSLYLDFI 224

Query: 245 QIFVHLLRFLGSRRD 259
            IF+ LLR  G  RD
Sbjct: 225 NIFLGLLRIFGGGRD 239


>gi|300726238|ref|ZP_07059691.1| membrane protein [Prevotella bryantii B14]
 gi|299776435|gb|EFI72992.1| membrane protein [Prevotella bryantii B14]
          Length = 238

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 80/234 (34%), Positives = 134/234 (57%), Gaps = 19/234 (8%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A M +VY  M L L +T + ++ V      +     + I+  G+++              
Sbjct: 23  ALMRKVYIWMTLALVITAVTAYGVATSPALMTTIFTNKILFFGLII-------------- 68

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
               A L +   ++  ++ LS   A +MF+ YS + G +LS  F  +++ +IV+TF +TA
Sbjct: 69  ----AELALVWGISGAINRLSLATATLMFIAYSVINGATLSVIFAAFSTTAIVKTFVVTA 124

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
            +FG++SL GY TK+DL  +G  + M   G+ + ++VN+F+ SS +DL +S +G++IF  
Sbjct: 125 GTFGTMSLVGYFTKKDLTSMGKLLFMALIGIIIATIVNMFIASSGLDLIISYLGVLIFVG 184

Query: 207 LTAYDTQKIKEAYSDRYDV-AYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           LTAYDTQKIK   S   D     ++ +++G+L LY+DFI +F++LLR  GS R+
Sbjct: 185 LTAYDTQKIKHMLSMAPDASEQMQKYALLGSLTLYLDFINLFLYLLRIFGSNRN 238


>gi|114762989|ref|ZP_01442419.1| hypothetical protein 1100011001344_R2601_20956 [Pelagibaca
           bermudensis HTCC2601]
 gi|114544313|gb|EAU47321.1| hypothetical protein R2601_20956 [Roseovarius sp. HTCC2601]
          Length = 220

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 83/232 (35%), Positives = 135/232 (58%), Gaps = 16/232 (6%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M +VY  M++G+ +T  +++ V      +        +   ++              WI 
Sbjct: 1   MNKVYGTMSIGMLLTFAVAWAVGTSPELLAVFRDPATLQPNIL-------------GWIV 47

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           +FAPL +       L+ +SA  A++ F  ++A++GLSLS  F+ +T  SI Q F +T+ +
Sbjct: 48  MFAPLIMAFAFGAILNRISAAGAQLFFFGFAAVMGLSLSWIFVAFTGFSIAQVFLVTSIA 107

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           F  LSL+GYTTK+D+   GSF+IMG  G+ + S++N+F+ S AI   +S +G++IF+ LT
Sbjct: 108 FAGLSLWGYTTKKDISGWGSFLIMGVIGILVASIINIFLASPAIYFAISILGVLIFAGLT 167

Query: 209 AYDTQKIKEAYSD---RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           AYDTQ IK  Y       D  +  + +++GAL LY+DFI +F+ LL+ LG+R
Sbjct: 168 AYDTQNIKNTYLQHAAHSDSEWLGKAAIMGALQLYLDFINMFMFLLQLLGNR 219


>gi|330718753|ref|ZP_08313353.1| integral membrane protein, interacts with FtsH [Leuconostoc fallax
           KCTC 3537]
          Length = 238

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 70/249 (28%), Positives = 122/249 (48%), Gaps = 17/249 (6%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
                 +     + +D+G+RA+  + Y+ MAL + +TGI  ++V                
Sbjct: 1   MNNYDFNTRRDVTGVDEGMRAFFKQTYSYMALAVLITGITGYIV---------------- 44

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
            +        +L+Y + +  I +     + IF+  R    +   A  + + ++ + GL+ 
Sbjct: 45  -KSFFWEQIASLIYGNAVGVIGLIGVQFLLIFMIGRNTLKNTANAFGLLMTFAVVEGLTT 103

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                +YT+ SI+  F  TAA FG +S YG  TKR+LG +   +     GL + SL+N+F
Sbjct: 104 GVLLGLYTTASILGVFAATAAVFGGMSAYGLMTKRNLGGLRQALFGLLVGLIVASLINMF 163

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
             +  ++L +S + +V+FS  TAYD Q++K  Y+           ++ GAL LY+DFI +
Sbjct: 164 FPNGIVNLLISYVAVVVFSLYTAYDNQRLKLMYAQTAGQMDTTGLAINGALSLYLDFINL 223

Query: 247 FVHLLRFLG 255
           F +LLR  G
Sbjct: 224 FFYLLRLFG 232


>gi|34328312|ref|NP_082500.2| fas apoptotic inhibitory molecule 2 isoform 1 [Mus musculus]
 gi|38503039|sp|Q8K097|FAIM2_MOUSE RecName: Full=Fas apoptotic inhibitory molecule 2; AltName:
           Full=Protein lifeguard
 gi|21619018|gb|AAH32278.1| Faim2 protein [Mus musculus]
 gi|74186504|dbj|BAE34742.1| unnamed protein product [Mus musculus]
 gi|148672179|gb|EDL04126.1| Fas apoptotic inhibitory molecule 2, isoform CRA_a [Mus musculus]
          Length = 317

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 84/238 (35%), Gaps = 25/238 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++ + L VT  +  L        D   A+           F          
Sbjct: 101 RLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWYWASYAVFFAT-------- 152

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      ++  +++  +          Y + S++    IT
Sbjct: 153 ---------YLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLVIT 203

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAMGL 201
           A    S++++ + TK D       + +    LF    LL+++  F     +    + +G 
Sbjct: 204 ALVCLSVTIFSFQTKFDFTSCQGVLFVLLMTLFFSGLLLAVLLPFQYVPWLHAVYAVLGA 263

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            +F+   A+DTQ +          + +  + + GAL +Y+D I IF   L+  G+ R+
Sbjct: 264 GVFTLFLAFDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE 317


>gi|332375911|gb|AEE63096.1| unknown [Dendroctonus ponderosae]
          Length = 302

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 50/253 (19%), Positives = 105/253 (41%), Gaps = 20/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y        GF  +     R ++ +VY+++ + L +T     L+     T      +  +
Sbjct: 70  YDAEDPEVKGFDFSDQSIRRGFIRKVYSILMVQLAITMGFIALLCYEPKTKAFVHNTPSL 129

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
               ++    A++  +    +                    A    +M  +++   G  L
Sbjct: 130 FIVALVVMIVAMITLACCGEVR-----------------RKAPINYVMLFIFTIAEGFLL 172

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                 Y   +++    ITAA   +L+L+ + TK D   +G  +++    L +  +V +F
Sbjct: 173 GVSASTYKQDAVLMAVGITAAVCLALTLFAFQTKYDFTMMGGVLLVAVIILLVFGIVAMF 232

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           + +  + L  +++G +IFS    YDTQ +      ++  + +  + V  AL LY+D + I
Sbjct: 233 VHNKIVQLVYASLGALIFSIYLVYDTQLMM---GGKHKYSISPEEYVFAALNLYLDIVNI 289

Query: 247 FVHLLRFLGSRRD 259
           F+++L  +G  RD
Sbjct: 290 FMYILAIIGHARD 302


>gi|297465792|ref|XP_002704084.1| PREDICTED: transmembrane Bax inhibitor motif containing 1B-like
           isoform 1 [Bos taurus]
 gi|297465794|ref|XP_002704085.1| PREDICTED: transmembrane Bax inhibitor motif containing 1B-like
           isoform 2 [Bos taurus]
 gi|296488709|gb|DAA30822.1| transmembrane Bax inhibitor motif containing 1B [Bos taurus]
          Length = 301

 Score =  115 bits (288), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 94/233 (40%), Gaps = 19/233 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           RA++++V  L+++ L +TG +  L             +      ++   F   +  +   
Sbjct: 88  RAFIVKVLFLLSIQLLITGAIVSLFVFWKALRSWVVKNPWFTYTLLPAFFVVFIVLACCG 147

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +                      A  ++  L++ L GL L +  + Y  + ++     T
Sbjct: 148 NLR-----------------RQVPANYILLGLFTVLQGLLLGTVSVFYHVEEVLWATAAT 190

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A    SLSL+   TK D   +   + +  F L +  ++ +F+R+  + L  + +G VIFS
Sbjct: 191 ALVTLSLSLFALQTKWDFTLLNGMLFVLLFVLIIYGIILIFIRAYWLHLLYAGLGTVIFS 250

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
                D Q +       +       + V  AL +YMD I +F+ +L+ +G  R
Sbjct: 251 LYLVMDVQLMVG--GRHHHSDLDPEEYVFAALNIYMDIINLFLFILQLIGMGR 301


>gi|327313132|ref|YP_004328569.1| hypothetical protein HMPREF9137_0849 [Prevotella denticola F0289]
 gi|326944414|gb|AEA20299.1| putative membrane protein [Prevotella denticola F0289]
          Length = 242

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 86/260 (33%), Positives = 141/260 (54%), Gaps = 19/260 (7%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+   +    V S       + +   A M +VY  MA+ L +TG++++            
Sbjct: 1   MNMNFDNFTNVASSHERNLEMSRTFPALMRKVYVWMAMALAITGVVAYGAGSSPAL---- 56

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                            L   +    I   A LG+  ++  R+  LS  +A M F+++SA
Sbjct: 57  --------------IQMLYMNNGPLLIAGLAELGIVWYVTARISRLSLVSATMWFIVFSA 102

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           + GL+L   F+VY   +I +TFFITA +FG+++L G TTK+DL  +G  + M   GL + 
Sbjct: 103 VNGLTLGWIFVVYKIAAISKTFFITAGTFGAMALIGSTTKKDLTRMGGILFMALIGLIIA 162

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYD-VAYAERQSVIGALML 239
            LVN+F+RS+ +D  +S +G+++F+ LTA+D Q IK       D    A++ +++G+L L
Sbjct: 163 GLVNIFLRSTMMDFIVSGIGVLVFTGLTAWDAQAIKRNLLMAPDAGESAQKIALLGSLSL 222

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y+DFI +F++LLRF GS+RD
Sbjct: 223 YLDFINLFLYLLRFFGSKRD 242


>gi|295390756|ref|NP_695220.4| glutamate [NMDA] receptor-associated protein 1 [Rattus norvegicus]
 gi|81885264|sp|Q6P6R0|GRINA_RAT RecName: Full=Glutamate [NMDA] receptor-associated protein 1;
           AltName: Full=NMDA receptor glutamate-binding subunit
 gi|38303820|gb|AAH62074.1| Grina protein [Rattus norvegicus]
 gi|149066125|gb|EDM15998.1| glutamate receptor, ionotropic, N-methyl D-asparate-associated
           protein 1 (glutamate binding), isoform CRA_a [Rattus
           norvegicus]
 gi|149066127|gb|EDM16000.1| glutamate receptor, ionotropic, N-methyl D-asparate-associated
           protein 1 (glutamate binding), isoform CRA_a [Rattus
           norvegicus]
 gi|149066129|gb|EDM16002.1| glutamate receptor, ionotropic, N-methyl D-asparate-associated
           protein 1 (glutamate binding), isoform CRA_a [Rattus
           norvegicus]
          Length = 348

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 98/239 (41%), Gaps = 22/239 (9%)

Query: 22  DQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           D+ +R A++ +V+ ++ L L VT     +   +        A++          F +L+ 
Sbjct: 131 DKSIRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGEVKGFVRANVWTYYVSYAIFFISLIV 190

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            S                              +   + +  +   +      Y +++++ 
Sbjct: 191 LSC-----------------CGDFRRKHPWNLVALSILTISLSYMVGMIASFYNTEAVIM 233

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              IT A   ++ ++   T+ D       +++    LF+ +++ +F+R+  +++  +++G
Sbjct: 234 AVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSVVVLFIFAILCIFIRNRILEIVYASLG 293

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++F+   A DTQ +         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 294 ALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 348


>gi|281348553|gb|EFB24137.1| hypothetical protein PANDA_011393 [Ailuropoda melanoleuca]
          Length = 311

 Score =  115 bits (287), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 37/240 (15%), Positives = 83/240 (34%), Gaps = 29/240 (12%)

Query: 26  RAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           R ++ +VY ++ + L VT G+++                              +      
Sbjct: 95  RVFIRKVYTILLIQLLVTLGVVALFTFCDPVKD-------------------YVQANPGW 135

Query: 85  RWIFIFAPL-GVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
            W                           ++  +++  +          Y + S++    
Sbjct: 136 YWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLG 195

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAM 199
           ITA    S++++ + TK D       + +    LF    +L+++        +    + +
Sbjct: 196 ITALVCLSVTVFSFQTKFDFTSCQGVIFVLLMTLFFSGLILAILLPLQYVPWLHAVYAVL 255

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           G  +F+   A+DTQ +          + +  + + GAL +Y+D I IF   L+  G+ R+
Sbjct: 256 GAGVFTLFLAFDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE 311


>gi|301774006|ref|XP_002922429.1| PREDICTED: fas apoptotic inhibitory molecule 2-like isoform 2
           [Ailuropoda melanoleuca]
          Length = 316

 Score =  115 bits (287), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 37/240 (15%), Positives = 83/240 (34%), Gaps = 29/240 (12%)

Query: 26  RAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           R ++ +VY ++ + L VT G+++                              +      
Sbjct: 100 RVFIRKVYTILLIQLLVTLGVVALFTFCDPVKD-------------------YVQANPGW 140

Query: 85  RWIFIFAPL-GVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
            W                           ++  +++  +          Y + S++    
Sbjct: 141 YWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLG 200

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAM 199
           ITA    S++++ + TK D       + +    LF    +L+++        +    + +
Sbjct: 201 ITALVCLSVTVFSFQTKFDFTSCQGVIFVLLMTLFFSGLILAILLPLQYVPWLHAVYAVL 260

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           G  +F+   A+DTQ +          + +  + + GAL +Y+D I IF   L+  G+ R+
Sbjct: 261 GAGVFTLFLAFDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE 316


>gi|301774004|ref|XP_002922428.1| PREDICTED: fas apoptotic inhibitory molecule 2-like isoform 1
           [Ailuropoda melanoleuca]
          Length = 315

 Score =  115 bits (287), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 37/240 (15%), Positives = 83/240 (34%), Gaps = 29/240 (12%)

Query: 26  RAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           R ++ +VY ++ + L VT G+++                              +      
Sbjct: 99  RVFIRKVYTILLIQLLVTLGVVALFTFCDPVKD-------------------YVQANPGW 139

Query: 85  RWIFIFAPL-GVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
            W                           ++  +++  +          Y + S++    
Sbjct: 140 YWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLG 199

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAM 199
           ITA    S++++ + TK D       + +    LF    +L+++        +    + +
Sbjct: 200 ITALVCLSVTVFSFQTKFDFTSCQGVIFVLLMTLFFSGLILAILLPLQYVPWLHAVYAVL 259

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           G  +F+   A+DTQ +          + +  + + GAL +Y+D I IF   L+  G+ R+
Sbjct: 260 GAGVFTLFLAFDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE 315


>gi|295691510|ref|YP_003595203.1| hypothetical protein Cseg_4175 [Caulobacter segnis ATCC 21756]
 gi|295433413|gb|ADG12585.1| protein of unknown function UPF0005 [Caulobacter segnis ATCC 21756]
          Length = 250

 Score =  115 bits (287), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 91/259 (35%), Positives = 138/259 (53%), Gaps = 10/259 (3%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D                ++D GLR++M+ VYN +ALGL ++  ++FL +         
Sbjct: 1   MNDFNRGYARSIPADRADMSVDAGLRSFMLGVYNKVALGLLLSAGLAFLTS--------- 51

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
           A   + +   +LT  G L   + L  +  FAPL + +     + + +A ++ +++    A
Sbjct: 52  AYQPVASLLYVLTPDGRLAGFTMLGTVIRFAPLAMMLVAMFAMRNPTARSSGILYWALVA 111

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
            +G  L  + L YT  S+  TF ITA +FG LSL+GYTTK+DL   GSF+IMG  GL L 
Sbjct: 112 SMGAGLGVWLLAYTGASVAATFLITAIAFGGLSLFGYTTKKDLTGFGSFLIMGLIGLVLA 171

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALML 239
           SLV +F     +   +S +G+ IF+ L AYDTQ++K  Y     D       +  GAL L
Sbjct: 172 SLVQMFFPMPGLGFIISILGVFIFAGLIAYDTQRLKMTYYQLGGDQQSMAVATNYGALSL 231

Query: 240 YMDFIQIFVHLLRFLGSRR 258
           Y++FI +F  LL  +GSRR
Sbjct: 232 YLNFINLFQFLLSIMGSRR 250


>gi|12963551|ref|NP_075657.1| glutamate [NMDA] receptor-associated protein 1 [Mus musculus]
 gi|81881873|sp|Q9ESF4|GRINA_MOUSE RecName: Full=Glutamate [NMDA] receptor-associated protein 1;
           AltName: Full=NMDA receptor glutamate-binding subunit
 gi|10441000|gb|AAG16897.1|AF182040_1 LAG protein [Mus musculus]
 gi|37589939|gb|AAH37667.2| Glutamate receptor, ionotropic, N-methyl D-aspartate-associated
           protein 1 (glutamate binding) [Mus musculus]
 gi|54035157|gb|AAH10802.1| Glutamate receptor, ionotropic, N-methyl D-aspartate-associated
           protein 1 (glutamate binding) [Mus musculus]
 gi|54311310|gb|AAH19157.1| Glutamate receptor, ionotropic, N-methyl D-aspartate-associated
           protein 1 [Mus musculus]
 gi|148697589|gb|EDL29536.1| glutamate receptor, ionotropic, N-methyl D-asparate-associated
           protein 1 (glutamate binding), isoform CRA_a [Mus
           musculus]
 gi|148697592|gb|EDL29539.1| glutamate receptor, ionotropic, N-methyl D-asparate-associated
           protein 1 (glutamate binding), isoform CRA_a [Mus
           musculus]
          Length = 345

 Score =  115 bits (287), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 36/234 (15%), Positives = 94/234 (40%), Gaps = 21/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           +A++ +V+ ++ L L VT     +   +         ++          F +L+  S   
Sbjct: 133 QAFIRKVFLVLTLQLSVTLSTVAIFTFVGEVKGFVRENVWTYYVSYAIFFISLIVLSC-- 190

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      +   + +  +   +      Y +++++    IT
Sbjct: 191 ---------------CGDFRRKHPWNLVALSILTVSLSYMVGMIASFYNTEAVIMAVGIT 235

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
            A   ++ ++   T+ D       +++    LF+ +++ +F+R+  +++  +++G ++F+
Sbjct: 236 TAVCFTVVIFSMQTRYDFTSCMGVLLVSVVVLFIFAILCIFIRNRILEIVYASLGALLFT 295

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
              A DTQ +         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 296 CFLAVDTQLL----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 345


>gi|195426487|ref|XP_002061364.1| GK20878 [Drosophila willistoni]
 gi|194157449|gb|EDW72350.1| GK20878 [Drosophila willistoni]
          Length = 323

 Score =  115 bits (287), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 49/253 (19%), Positives = 95/253 (37%), Gaps = 20/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y    +    F        R ++ +VY ++   L VT     L      T D  A +  +
Sbjct: 91  YDDPESQPKNFSFDDQSIRRGFIRKVYLILMGQLMVTFGAVALFVFHQGTRDFAARNSWL 150

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                      ++  +    +                         +   +++A     +
Sbjct: 151 FWVAFGVMLVTMLCMACCESVR-----------------RQTPTNFIFLAIFTAAQSFLM 193

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                 Y  K ++    ITAA   +L+L+   TK D   +G  +I       +  +V +F
Sbjct: 194 GVSASRYAPKEVLLAVGITAAVCLALTLFALQTKYDFTMMGGILIACMVVFLIFGIVAIF 253

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           ++   I L  +++G ++FS    YDTQ +       +  + +  + +  AL LY+D I I
Sbjct: 254 IKGKIITLVYASIGALLFSVYLIYDTQLMM---GGDHKYSISPEEYIFAALNLYLDIINI 310

Query: 247 FVHLLRFLGSRRD 259
           F+++L  +G+ RD
Sbjct: 311 FLYILTIIGASRD 323


>gi|315497417|ref|YP_004086221.1| hypothetical protein Astex_0374 [Asticcacaulis excentricus CB 48]
 gi|315415429|gb|ADU12070.1| protein of unknown function UPF0005 [Asticcacaulis excentricus CB
           48]
          Length = 249

 Score =  114 bits (286), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 97/260 (37%), Positives = 149/260 (57%), Gaps = 12/260 (4%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+D R++     + +    ++D GLR++M+ VYN MALGL +TG +++    +       
Sbjct: 1   MNDFRSHN--PANATVQDMSVDAGLRSFMLGVYNKMALGLLLTGALAWAAANVP------ 52

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
               I N    +T  G L   + + ++  FAP+ + +     +   +  +  +++ L  A
Sbjct: 53  ---EITNLMFRVTADGRLAGYTIMGYVISFAPVVILLGSGFVMRQPTVASTSILYWLVVA 109

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           LIGLS  + FLVYT  S+  TFF+TAA+FG+LSLYGYTTKRD+   G F+ M   GL + 
Sbjct: 110 LIGLSTGANFLVYTGGSLASTFFVTAAAFGALSLYGYTTKRDMSGWGKFLFMAVIGLIIA 169

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSV-IGALML 239
           S+VNLF++SS +   +S +G++IFSAL A++TQ +K  Y            +   GAL L
Sbjct: 170 SVVNLFLQSSMLYFIVSGLGVLIFSALIAFETQNLKHTYYQLGGNEAGMAMATNYGALSL 229

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y+ FI +F  LL F+G RRD
Sbjct: 230 YISFINLFQFLLAFMGVRRD 249


>gi|21426783|ref|NP_653357.1| fas apoptotic inhibitory molecule 2 [Rattus norvegicus]
 gi|38502803|sp|O88407|FAIM2_RAT RecName: Full=Fas apoptotic inhibitory molecule 2; AltName:
           Full=Neural membrane protein 35; AltName: Full=Protein
           lifeguard
 gi|3426268|gb|AAC32463.1| neural membrane protein 35 [Rattus norvegicus]
 gi|56269623|gb|AAH87606.1| Fas apoptotic inhibitory molecule 2 [Rattus norvegicus]
 gi|149032071|gb|EDL86983.1| Fas apoptotic inhibitory molecule 2 [Rattus norvegicus]
          Length = 316

 Score =  114 bits (286), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 43/243 (17%), Positives = 87/243 (35%), Gaps = 26/243 (10%)

Query: 22  DQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           DQ +R  ++ +VY ++ + L VT  +  L        D   A+           F     
Sbjct: 95  DQKVRQLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWYWASYAVFFAT--- 151

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
                                           ++  +++  +          Y + S++ 
Sbjct: 152 --------------YLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLL 197

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTM 196
              ITA    S++++ + TK D       + +    LF    LL+++  F     +    
Sbjct: 198 CLGITALVCLSVTIFSFQTKFDFTSCHGVLFVLLMTLFFSGLLLAILLPFQYVPWLHAVY 257

Query: 197 SAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           + +G  +F+   A+DTQ +          + +  + + GAL +Y+D I IF   L+  G+
Sbjct: 258 AVLGAGVFTLFLAFDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGT 313

Query: 257 RRD 259
            R+
Sbjct: 314 NRE 316


>gi|24653221|ref|NP_725237.1| N-methyl-D-aspartate receptor-associated protein, isoform A
           [Drosophila melanogaster]
 gi|24653223|ref|NP_725238.1| N-methyl-D-aspartate receptor-associated protein, isoform B
           [Drosophila melanogaster]
 gi|21627288|gb|AAM68612.1| N-methyl-D-aspartate receptor-associated protein, isoform A
           [Drosophila melanogaster]
 gi|21627289|gb|AAM68613.1| N-methyl-D-aspartate receptor-associated protein, isoform B
           [Drosophila melanogaster]
 gi|27819762|gb|AAO24930.1| RH66362p [Drosophila melanogaster]
 gi|51092212|gb|AAT94519.1| GH12715p [Drosophila melanogaster]
          Length = 313

 Score =  114 bits (286), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 47/253 (18%), Positives = 95/253 (37%), Gaps = 20/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y    +    F        R ++ +VY ++   L VT     L      T      ++ +
Sbjct: 81  YDDPESQPKNFSFDDQSIRRGFIRKVYLILMGQLIVTFGAVALFVYHEGTKTFARNNMWL 140

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
               +      ++  +    +                         +   L++A     +
Sbjct: 141 FWVALGVMLVTMLSMACCESVR-----------------RQTPTNFIFLGLFTAAQSFLM 183

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                 Y  K ++    ITAA   +L+++   TK D   +G  +I       +  +V +F
Sbjct: 184 GVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIF 243

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           ++   I L  +++G ++FS    YDTQ +       +  + +  + +  AL LY+D I I
Sbjct: 244 VKGKIITLVYASIGALLFSVYLIYDTQLMM---GGEHKYSISPEEYIFAALNLYLDIINI 300

Query: 247 FVHLLRFLGSRRD 259
           F+++L  +G+ RD
Sbjct: 301 FMYILTIIGASRD 313


>gi|197100224|ref|NP_001126961.1| fas apoptotic inhibitory molecule 2 [Pongo abelii]
 gi|75040968|sp|Q5R4I4|FAIM2_PONAB RecName: Full=Fas apoptotic inhibitory molecule 2
 gi|55733300|emb|CAH93332.1| hypothetical protein [Pongo abelii]
          Length = 316

 Score =  114 bits (286), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 84/238 (35%), Gaps = 25/238 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++ + L VT  +  L        D   A+           F          
Sbjct: 100 RVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFAT-------- 151

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      ++  +++  +          Y + S++    IT
Sbjct: 152 ---------YLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGIT 202

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAMGL 201
           A    S++++ + TK D       + +    LF    +L+++  F     +    +A+G 
Sbjct: 203 ALVCLSVTVFSFQTKFDFTSCQGVLFVLPMTLFFSGLILAILLPFQYVPWLHAVYAALGA 262

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            +F+   A DTQ +          + +  + + GAL +Y+D I IF   L+  G+ R+
Sbjct: 263 GVFTLFLALDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE 316


>gi|261880930|ref|ZP_06007357.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
 gi|270332317|gb|EFA43103.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
          Length = 245

 Score =  114 bits (286), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 84/232 (36%), Positives = 132/232 (56%), Gaps = 19/232 (8%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A M +VY  M + L +TGI ++ V    +                      L   S   W
Sbjct: 31  ALMRKVYIWMTMALAITGICAYGVATSPSI------------------LQMLYANSMTIW 72

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
           +   A LG+  +   R+  LS   A  +F+++SAL G++LSS FLVY+  SI + FFIT+
Sbjct: 73  VLFIAELGLVFYTTARISKLSLTIATTLFIVFSALNGVTLSSIFLVYSLTSIAKVFFITS 132

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
            +F +++ YGY TK DL  +GS + M   GL + ++VNLFM+S+  D+ +  +G+ IF  
Sbjct: 133 GTFAAMAAYGYFTKTDLSKLGSILFMALIGLIIATVVNLFMKSAMFDMILCYIGVAIFVG 192

Query: 207 LTAYDTQKIKEAYSDRYD-VAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           LTA+D+QKIK   + + D    A++ +++GAL LY+DFI +F+++LR  G R
Sbjct: 193 LTAWDSQKIKRMLAMQMDMGEGAQKIALLGALSLYLDFINLFLYMLRIFGGR 244


>gi|294672963|ref|YP_003573579.1| hypothetical protein PRU_0181 [Prevotella ruminicola 23]
 gi|294472084|gb|ADE81473.1| putative membrane protein [Prevotella ruminicola 23]
          Length = 239

 Score =  114 bits (286), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 84/253 (33%), Positives = 131/253 (51%), Gaps = 19/253 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N             ++     A M +VY  M L L +TG+ ++ V               
Sbjct: 4   NEFNFDGLTRERELSMSAAFPALMRKVYVWMTLALVLTGVTAYGVATSPGI--------- 54

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                      AL   S L W  + A   +   ++  ++ LS   A ++F+LYS + G  
Sbjct: 55  ---------LTALYSNSVLLWGLVIAEFAIVFGVSAAINRLSLTTATLLFVLYSVINGAL 105

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
            SS F+VYT  SI   FFITA +F  ++L GYTTK DL  +G  + M   G+ + ++VN+
Sbjct: 106 FSSIFIVYTMSSIASVFFITAGTFAVMALIGYTTKTDLSSMGKILFMALIGIIIATVVNI 165

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYD-VAYAERQSVIGALMLYMDFI 244
           F++SS +++ +S +G++IF  LTAYD+QKIK       D    A++ +++GAL LY+DFI
Sbjct: 166 FLKSSGLEMIVSYLGVLIFVGLTAYDSQKIKNMLLMAPDAGEAAQKMALLGALTLYLDFI 225

Query: 245 QIFVHLLRFLGSR 257
            +F++LLR  G R
Sbjct: 226 NLFIYLLRIFGRR 238


>gi|325851949|ref|ZP_08171057.1| putative membrane protein [Prevotella denticola CRIS 18C-A]
 gi|325484666|gb|EGC87581.1| putative membrane protein [Prevotella denticola CRIS 18C-A]
          Length = 242

 Score =  114 bits (286), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 85/260 (32%), Positives = 140/260 (53%), Gaps = 19/260 (7%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M+   +    V S       + +   A M +VY  MA+ L +TG++++            
Sbjct: 1   MNMNFDNFTNVASSHERDLEMSRTFPALMRKVYVWMAMALAITGVVAYGAGSSPAL---- 56

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                            L   +    I   A LG+  ++  R+  LS  +A M F+++SA
Sbjct: 57  --------------IQMLYMNNGPLLIAGLAELGIVWYVTARISRLSLVSATMWFIVFSA 102

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           + GL+L   F+VY   +I +TFFITA +FG+++L G TTK+DL  +G  + M   GL + 
Sbjct: 103 VNGLTLGWIFVVYKIAAISKTFFITAGTFGAMALIGSTTKKDLTRMGGILFMALIGLIIA 162

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIK-EAYSDRYDVAYAERQSVIGALML 239
            LVN+F+RS+ +D  +S +G+++F+ LTA+D Q IK            A++ +++G+L L
Sbjct: 163 GLVNIFLRSTMMDFIVSGIGVLVFTGLTAWDAQAIKRNLLMALDAGESAQKIALLGSLSL 222

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y+DFI +F++LLRF GS+RD
Sbjct: 223 YLDFINLFLYLLRFFGSKRD 242


>gi|195154102|ref|XP_002017961.1| GL17450 [Drosophila persimilis]
 gi|198460182|ref|XP_001361641.2| GA17693 [Drosophila pseudoobscura pseudoobscura]
 gi|194113757|gb|EDW35800.1| GL17450 [Drosophila persimilis]
 gi|198136928|gb|EAL26220.2| GA17693 [Drosophila pseudoobscura pseudoobscura]
          Length = 319

 Score =  114 bits (286), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 49/253 (19%), Positives = 94/253 (37%), Gaps = 20/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y    +    F        R ++ +VY ++   L VT     L      T D  A ++ +
Sbjct: 87  YDDPESQPKNFSFDDQSIRRGFIRKVYLILMGQLLVTFGAVALFVFHQGTKDFAAKNMWL 146

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
               +      ++  +    +                         +   L++      +
Sbjct: 147 FWVALGVMLVTMLCMACCDSVR-----------------RQTPTNFIFLGLFTIAQSFLM 189

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                 Y    ++    ITAA   +L+L+   TK D   +G  +I       +  +V +F
Sbjct: 190 GVTATRYAPNEVLLAVGITAAVCLALTLFAMQTKYDFTMMGGILIACMVVFLIFGIVAMF 249

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           M+   I L  ++ G ++FS    YDTQ +       +  + +  + +  AL LY+D I I
Sbjct: 250 MKGKIITLVYASFGALLFSVYLIYDTQLMM---GGDHKYSISPEEYIFAALNLYLDIINI 306

Query: 247 FVHLLRFLGSRRD 259
           F+++L  +G+ RD
Sbjct: 307 FMYILTIIGASRD 319


>gi|195582901|ref|XP_002081264.1| GD25804 [Drosophila simulans]
 gi|194193273|gb|EDX06849.1| GD25804 [Drosophila simulans]
          Length = 324

 Score =  114 bits (286), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 46/253 (18%), Positives = 94/253 (37%), Gaps = 20/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y    +    F        R ++ +VY ++   L VT     L      T      ++ +
Sbjct: 92  YDDPESQPKNFSFDDQSIRRGFIRKVYLILMGQLIVTFGAVALFVFHEGTKTFARNNMWL 151

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
               +      ++  +    +                         +   L++A     +
Sbjct: 152 FWVALGVMLVTMLSMACCESVR-----------------RQTPTNFIFLGLFTAAQSFLM 194

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                 Y    ++    ITAA   +L+++   TK D   +G  +I       +  +V +F
Sbjct: 195 GVSATKYAPNEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIF 254

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           ++   I L  +++G ++FS    YDTQ +       +  + +  + +  AL LY+D I I
Sbjct: 255 VKGRIITLVYASIGALLFSVYLIYDTQLMM---GGEHKYSISPEEYIFAALNLYLDIINI 311

Query: 247 FVHLLRFLGSRRD 259
           F+++L  +G+ RD
Sbjct: 312 FMYILTIIGASRD 324


>gi|84781820|ref|NP_001033747.1| fas apoptotic inhibitory molecule 2 isoform 2 [Mus musculus]
 gi|12850853|dbj|BAB28874.1| unnamed protein product [Mus musculus]
 gi|26326511|dbj|BAC26999.1| unnamed protein product [Mus musculus]
          Length = 305

 Score =  114 bits (286), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 84/238 (35%), Gaps = 25/238 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++ + L VT  +  L        D   A+           F          
Sbjct: 89  RLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWYWASYAVFFAT-------- 140

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      ++  +++  +          Y + S++    IT
Sbjct: 141 ---------YLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLVIT 191

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAMGL 201
           A    S++++ + TK D       + +    LF    LL+++  F     +    + +G 
Sbjct: 192 ALVCLSVTIFSFQTKFDFTSCQGVLFVLLMTLFFSGLLLAVLLPFQYVPWLHAVYAVLGA 251

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            +F+   A+DTQ +          + +  + + GAL +Y+D I IF   L+  G+ R+
Sbjct: 252 GVFTLFLAFDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE 305


>gi|332970126|gb|EGK09120.1| protein of hypothetical function UPF0005 [Desmospora sp. 8437]
          Length = 224

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 92/229 (40%), Positives = 132/229 (57%), Gaps = 18/229 (7%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M RV++ M  GL +TGI+SFL+      +     +I +  G+M+                
Sbjct: 13  MTRVFSWMFAGLSLTGIISFLLVSDGGAIRYFYQNIGVLYGLMI---------------- 56

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
             A L +  FL  R+H ++A  A  +F LY+AL G++LS    +YT  SI Q FFITA  
Sbjct: 57  --AELILVFFLAARVHKMAAGTATFVFFLYAALNGVTLSPLLYLYTPVSITQVFFITAGM 114

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG  +LYG  TKRDL  +GS + M   GL + S+VN FM+SS +   +S +G++IF  LT
Sbjct: 115 FGVFALYGAVTKRDLSKLGSILFMALIGLIIASVVNWFMQSSVLYWVVSYLGVIIFCGLT 174

Query: 209 AYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           A+D QKIK    +  D     + +++GAL LY+DFI +F++LLR LGSR
Sbjct: 175 AFDVQKIKRIQDENMDYDTHTKTAIMGALALYLDFINMFIYLLRILGSR 223


>gi|303236922|ref|ZP_07323501.1| putative membrane protein [Prevotella disiens FB035-09AN]
 gi|302483090|gb|EFL46106.1| putative membrane protein [Prevotella disiens FB035-09AN]
          Length = 242

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 82/230 (35%), Positives = 131/230 (56%), Gaps = 19/230 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M +VY  M + L +TGI+++ V                           L        + 
Sbjct: 30  MRKVYTWMTMALAITGIVAYGVGTSEA------------------MLMMLYNGMAPLIVC 71

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
             A LG+  +L+ R+  LS  +A + F++++AL GL++   F  YT  SI +TFFITA +
Sbjct: 72  GLAELGIVFYLSARIQKLSLMSATIWFIVFAALNGLTMGWIFAAYTMASIAKTFFITAGT 131

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++++ G TTK+DL  +G  + M   GL +  LVNLF+ S+  +L +S +G++IF+ LT
Sbjct: 132 FGAMAVIGTTTKKDLTKMGGILFMALIGLIIAGLVNLFLHSTMFELIVSGLGVLIFTGLT 191

Query: 209 AYDTQKIKEAYSDRYD-VAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           A+D QKIKE      D    A++ +++G+L LY+DFI +F++LLRF G+R
Sbjct: 192 AWDAQKIKEMVRMAPDAGESAQKIALLGSLSLYLDFINLFLYLLRFFGNR 241


>gi|115495397|ref|NP_001068886.1| fas apoptotic inhibitory molecule 2 [Bos taurus]
 gi|122134258|sp|Q1LZ71|FAIM2_BOVIN RecName: Full=Fas apoptotic inhibitory molecule 2
 gi|94534836|gb|AAI16168.1| Fas apoptotic inhibitory molecule 2 [Bos taurus]
 gi|296487796|gb|DAA29909.1| Fas apoptotic inhibitory molecule 2 [Bos taurus]
          Length = 316

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 38/240 (15%), Positives = 84/240 (35%), Gaps = 29/240 (12%)

Query: 26  RAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           R ++ +VY ++ + L VT G+++                              +      
Sbjct: 100 RVFIRKVYTILLIQLLVTLGVVALFTFCDPVKD-------------------YVQANPGW 140

Query: 85  RWIFIFAPL-GVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
            W                           ++  +++  +          Y + S++    
Sbjct: 141 YWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLS 200

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAM 199
           ITA    S++++ + TK D       + +    LF    +L+++  F     +    + +
Sbjct: 201 ITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAVL 260

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           G  +F+   A+DTQ +          + +  + + GAL +Y+D I IF   L+  G+ R+
Sbjct: 261 GAGVFTLFLAFDTQLLM----GSRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE 316


>gi|241072382|ref|XP_002408639.1| conserved hypothetical protein [Ixodes scapularis]
 gi|241683526|ref|XP_002411642.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215492535|gb|EEC02176.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215504405|gb|EEC13899.1| conserved hypothetical protein [Ixodes scapularis]
          Length = 239

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 97/235 (41%), Positives = 140/235 (59%), Gaps = 19/235 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D+GLR +M++VYNLMA  L +TG  + +                    +  T    LM+ 
Sbjct: 19  DEGLRQFMLKVYNLMAAALLLTGSTAIIT-------------------ISWTPLANLMFN 59

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + +  I  FAPL + ++       LS   A+++F +Y+ L+G+SLS  FL+YT+ SI +T
Sbjct: 60  TAVGSIIAFAPLAIALYFFFGFSKLSIQLAQILFWIYAVLVGMSLSYLFLIYTAVSIART 119

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FFI AA FG +SLYGY T +DL   GSF +MG  GL L SL+NLF++S A+    S +G+
Sbjct: 120 FFICAAVFGMMSLYGYNTNKDLTSWGSFFLMGLVGLLLTSLINLFLQSPAVYFASSFLGV 179

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           +IF  L  +DTQKIK  Y    D   A++ S++ A  LY+DFI +F+HL+RFLG 
Sbjct: 180 IIFIGLIVWDTQKIKSFYFTNTDNHLAQKMSIVAAFNLYLDFINLFLHLIRFLGG 234


>gi|156538475|ref|XP_001606658.1| PREDICTED: similar to ENSANGP00000027407 [Nasonia vitripennis]
          Length = 312

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 52/254 (20%), Positives = 103/254 (40%), Gaps = 20/254 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           NY        GF        +A++ +VY+++ L L +T  +  L        +  A ++ 
Sbjct: 79  NYNEEDGEVKGFSFNDTTIRQAFIRKVYSILLLQLLITFGVVALFTFSHNAKEFAAKNVS 138

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           +    M   FG L+  +    +                    A    +   +++    + 
Sbjct: 139 VMYICMAITFGLLIAMACCTSVR-----------------RKAPMNFIFLFIFTLAESVM 181

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L      +   S++    ITA    +L+L+ + TK D    G+++ + A  L L   + +
Sbjct: 182 LGFVSSQHDEGSVILAVGITAFICFALTLFSFQTKIDFTGAGTYLFIAALCLMLFGFIAI 241

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F     + L  S +G ++FS    YDTQ        ++  + +  + +  AL LY+D + 
Sbjct: 242 FWHGRTVILVYSCLGALLFSFYLVYDTQL---MLGGKHKYSLSPEEYIFAALNLYLDIVN 298

Query: 246 IFVHLLRFLGSRRD 259
           IF+++L  +G+ RD
Sbjct: 299 IFIYILSIIGASRD 312


>gi|288929422|ref|ZP_06423267.1| membrane protein [Prevotella sp. oral taxon 317 str. F0108]
 gi|288329524|gb|EFC68110.1| membrane protein [Prevotella sp. oral taxon 317 str. F0108]
          Length = 238

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 82/234 (35%), Positives = 131/234 (55%), Gaps = 20/234 (8%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A M +VY  M L L +TG+ ++ V                           +  +  +  
Sbjct: 23  ALMRKVYVWMTLALIITGVTAYGVAHSEVL------------------ISQMFESRAVFM 64

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
           + I A L +   ++  ++ LS   A ++F+LYSAL G +LS  FL Y++  I +TFFITA
Sbjct: 65  VLIIAELALVFGISRFINRLSLTTATLLFILYSALNGATLSVIFLAYSASVITKTFFITA 124

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL-FMRSSAIDLTMSAMGLVIFS 205
            +FG+++L+GY TK DL  +G  ++M   G+ + S+ NL F +S   DL +S +G+++F 
Sbjct: 125 GTFGTMALFGYFTKADLSGLGKILLMALVGIIIASIANLLFFKSGMFDLIVSYIGVLVFV 184

Query: 206 ALTAYDTQKIKEAYSDRYDV-AYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            LTAYD+QKIKE      D    A++ +++G+L LY+DFI +F++LLR  G  R
Sbjct: 185 GLTAYDSQKIKEMLMRAEDADENAQKMALMGSLTLYLDFINLFLYLLRIFGRER 238


>gi|239946543|ref|ZP_04698298.1| aspartyl-tRNA synthetase [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239946598|ref|ZP_04698352.1| aspartyl-tRNA synthetase [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239920819|gb|EER20845.1| aspartyl-tRNA synthetase [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239920874|gb|EER20899.1| aspartyl-tRNA synthetase [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 236

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 97/235 (41%), Positives = 140/235 (59%), Gaps = 19/235 (8%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D+GLR +M++VYNLMA  L +TG  + +                    +  T    LM+ 
Sbjct: 16  DEGLRQFMLKVYNLMAAALLLTGSTAIIT-------------------ISWTPLANLMFN 56

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + +  I  FAPL + ++       LS   A+++F +Y+ L+G+SLS  FL+YT+ SI +T
Sbjct: 57  TAVGSIIAFAPLAIALYFFFGFSKLSIQLAQILFWIYAVLVGMSLSYLFLIYTAVSIART 116

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           FFI AA FG +SLYGY T +DL   GSF +MG  GL L SL+NLF++S A+    S +G+
Sbjct: 117 FFICAAVFGMMSLYGYNTNKDLTSWGSFFLMGLVGLLLTSLINLFLQSPAVYFASSFLGV 176

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           +IF  L  +DTQKIK  Y    D   A++ S++ A  LY+DFI +F+HL+RFLG 
Sbjct: 177 IIFIGLIVWDTQKIKSFYFTNTDNHLAQKMSIVAAFNLYLDFINLFLHLIRFLGG 231


>gi|78357643|ref|YP_389092.1| membrane protein [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
 gi|78220048|gb|ABB39397.1| membrane protein, putative [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 233

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 86/249 (34%), Positives = 140/249 (56%), Gaps = 20/249 (8%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
             +    +  + + A+M  VY  MA GL VT + +F V                      
Sbjct: 3   RTAQRSQSRTEVVNAFMRGVYQWMAAGLAVTAVSAFAVASSPAL---------------- 46

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
                +  T  L  + +   +G+  +++ R+ ++SA  A  +F++YSAL G+ LSS  +V
Sbjct: 47  --LQLIFGTPMLPLVLMIGLVGLVFYMSARIGTMSAGTATTLFMVYSALNGVVLSSVLIV 104

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           Y + S+ Q F   AA FG++++YG TTKRDL  +GSFM MG  G+ + S+VN+F+ SS +
Sbjct: 105 YATASVFQAFVTAAAMFGAMTVYGMTTKRDLTSMGSFMFMGLIGILIASVVNIFLGSSMM 164

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFIQIFVHL 250
           +L +SA+G+++F+ LTAYD+Q++++        D     R +++GAL LY+DFI +F+ L
Sbjct: 165 ELVISAIGVIVFTGLTAYDSQQLRQMGETAPMDDPVAIRRGTILGALRLYLDFINLFLML 224

Query: 251 LRFLGSRRD 259
           LR  G  RD
Sbjct: 225 LRLFGGARD 233


>gi|195382878|ref|XP_002050155.1| GJ21985 [Drosophila virilis]
 gi|194144952|gb|EDW61348.1| GJ21985 [Drosophila virilis]
          Length = 333

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/253 (16%), Positives = 92/253 (36%), Gaps = 20/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y         F        R ++ +VY ++   L VT     L +    T +   ++  +
Sbjct: 101 YDDPEGQPKNFSFDDQSIRRGFIRKVYIILMGQLLVTFGAVALFSFHNGTKNFVHSNRWL 160

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
               +      ++  +    +                         +   +++      L
Sbjct: 161 FWVALGVLVVTMLAMACCESVR-----------------RQTPTNFIFLGIFTVAQSFLL 203

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                 Y    ++    ITAA   +L+++   TK D   +G  ++       +  +V +F
Sbjct: 204 GVSASTYGQTEVLMAVGITAAVCLALTIFAMQTKVDFTMMGGVLLACLVVFMIFGIVAIF 263

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
            +   I L  ++ G ++FS    YDTQ +       +  + +  + +  AL LY+D + I
Sbjct: 264 FKGKIITLVYASFGALLFSVYLIYDTQLMM---GGDHKYSISPEEYIFAALNLYLDIVNI 320

Query: 247 FVHLLRFLGSRRD 259
           F+++L  +G+ RD
Sbjct: 321 FIYILTIIGASRD 333


>gi|149714295|ref|XP_001504277.1| PREDICTED: similar to Fas apoptotic inhibitory molecule 2 isoform 1
           [Equus caballus]
          Length = 316

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 38/240 (15%), Positives = 84/240 (35%), Gaps = 29/240 (12%)

Query: 26  RAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           R ++ +VY ++ + L VT G+++                              +      
Sbjct: 100 RVFIRKVYTILLIQLLVTLGVVALFTFCDPVKD-------------------YVQANPGW 140

Query: 85  RWIFIFAPL-GVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
            W                           ++  +++  +          Y + S++    
Sbjct: 141 YWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTMSVLLCLG 200

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAM 199
           ITA    S++++ + TK D       + +    LF    +L+++  F     +    + +
Sbjct: 201 ITALVCLSVTVFSFQTKFDFTSCQGVIFVLLMTLFFSGLILAILLPFQYVPWLHAVYAVL 260

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           G  +F+   A+DTQ +          + +  + + GAL +Y+D I IF   L+  G+ R+
Sbjct: 261 GAGVFTLFLAFDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE 316


>gi|89053719|ref|YP_509170.1| hypothetical protein Jann_1228 [Jannaschia sp. CCS1]
 gi|88863268|gb|ABD54145.1| protein of unknown function UPF0005 [Jannaschia sp. CCS1]
          Length = 252

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 91/264 (34%), Positives = 144/264 (54%), Gaps = 23/264 (8%)

Query: 4   IRNYQRVVNSG-SGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           +  YQ + + G +G  + IDQGLRA+M +VY  M++GL +T   ++ V      +    +
Sbjct: 1   MAEYQTMRSQGMAGSAAEIDQGLRAHMNKVYGTMSIGLLITFAAAWAVGANPAILQYLFS 60

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                  ++              WI +FAPLG+       +   SA AA+  F  ++A++
Sbjct: 61  FETGGPTIL-------------GWIAMFAPLGMIFAFGAVITKASAAAAQTFFYAFAAVM 107

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G+S++  F VYT  SIVQ F +T+ +F  LS +GY TKRD+   G+F+IMG  G  +L L
Sbjct: 108 GISIAYIFAVYTGASIVQAFLVTSIAFAGLSTWGYVTKRDISGWGAFLIMGLIGGIVLML 167

Query: 183 V------NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY---SDRYDVAYAERQSV 233
           +         +     DL +SA+ L++F+ LTAY TQ IK+ Y   +   D  +  + ++
Sbjct: 168 LSFALSAFWGIVIPGFDLALSALLLLVFAGLTAYHTQAIKQDYVDHAQHGDSEWLAKSAI 227

Query: 234 IGALMLYMDFIQIFVHLLRFLGSR 257
           +GAL LYM FI +F+ +L FLG+R
Sbjct: 228 MGALNLYMSFINMFLIILSFLGNR 251


>gi|296211614|ref|XP_002752489.1| PREDICTED: fas apoptotic inhibitory molecule 2-like [Callithrix
           jacchus]
          Length = 316

 Score =  114 bits (284), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 40/238 (16%), Positives = 84/238 (35%), Gaps = 25/238 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++ + L VT  +  L        D   A+           F          
Sbjct: 100 RVFIRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFAT-------- 151

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      ++  +++  +          Y + S++    IT
Sbjct: 152 ---------YLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGIT 202

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAMGL 201
           A    S++++ + TK D       + +    LF    +L+++  F     +    +++G 
Sbjct: 203 ALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYASLGA 262

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            +F+   A DTQ +          + +  + + GAL +Y+D I IF   L+  G+ R+
Sbjct: 263 GVFTLFLALDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE 316


>gi|88608506|ref|YP_505951.1| putative membrane proetin [Neorickettsia sennetsu str. Miyayama]
 gi|88600675|gb|ABD46143.1| putative membrane proetin [Neorickettsia sennetsu str. Miyayama]
          Length = 251

 Score =  114 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 96/257 (37%), Positives = 151/257 (58%), Gaps = 21/257 (8%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
             ++    +S S   +  ++GLR YM++V+N MA  LG+TG+ +F V             
Sbjct: 14  YMSFINRYSSTSTDSAYRNEGLRMYMVKVFNYMAAALGITGLTAFFVASSPA-------- 65

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                        +L+Y +PL+W+ +FAP+   I  + R+  +++  AK++F  +S L+G
Sbjct: 66  -----------MLSLLYQTPLQWVVMFAPVVFVIVFSTRISGMTSERAKVLFWCFSVLMG 114

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSLS  F+ YT  SI + FFI A  FG++++YG  T+ DL  +GSF+ MG  G+ + +LV
Sbjct: 115 LSLSWVFIAYTGASIARVFFIAATMFGAMAIYGNNTRTDLTGMGSFLTMGVVGILIAALV 174

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYM 241
           N+F+ S AI   +SA+G+VIF+ LTAYD Q+I++ Y      D     + +V+GAL LY 
Sbjct: 175 NVFLASPAIYFAVSALGVVIFTGLTAYDVQRIRDFYYFSVNADEETLSKIAVVGALTLYF 234

Query: 242 DFIQIFVHLLRFLGSRR 258
           DFI IF+ LL  +G R+
Sbjct: 235 DFINIFISLLNLMGERK 251


>gi|195485182|ref|XP_002090984.1| GE13412 [Drosophila yakuba]
 gi|194177085|gb|EDW90696.1| GE13412 [Drosophila yakuba]
          Length = 324

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 46/253 (18%), Positives = 96/253 (37%), Gaps = 20/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y    +    F        R ++ +VY ++   L VT     L      T      ++ +
Sbjct: 92  YDDPESQPKNFSFDDQSIRRGFIRKVYLILMGQLIVTFGAVALFVFHEGTKTFARRNMWL 151

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
               +      ++  +    +                         +   L++A     +
Sbjct: 152 FWVALGVMLITMLSMACCESVR-----------------RQTPTNFIFLGLFTAAQSFLM 194

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                 Y    ++    +TAA   +L+L+ + TK D   +G  +I       +  +V +F
Sbjct: 195 GVSATKYAPNEVLMAVGLTAAVCLALTLFAWQTKYDFTMMGGILIACMVIFLIFGIVAIF 254

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           ++ + I L  +++G ++FS    YDTQ +       +  + +  + +  AL LY+D I I
Sbjct: 255 IKGTVIKLIYASIGALLFSVYLIYDTQLMM---GGEHKYSISPEEYIFAALNLYLDIINI 311

Query: 247 FVHLLRFLGSRRD 259
           F+++L  +G+ RD
Sbjct: 312 FMYILTIIGASRD 324


>gi|253700702|ref|YP_003021891.1| hypothetical protein GM21_2081 [Geobacter sp. M21]
 gi|251775552|gb|ACT18133.1| protein of unknown function UPF0005 [Geobacter sp. M21]
          Length = 224

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 81/230 (35%), Positives = 128/230 (55%), Gaps = 24/230 (10%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M  VY  M  GL +T ++S +       +     + I+   ++    G ++  S      
Sbjct: 19  MRGVYGWMGGGLALTALVSLITASSPVLLQAILGNRILFYALVFGELGLVIAISGA---- 74

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
                         ++ +SA  A  +FL+Y+A+ GL++SS F+ YTS SI  TF +T+  
Sbjct: 75  --------------INRISATTASALFLIYAAVNGLTMSSIFVAYTSTSIASTFLVTSGM 120

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           F ++SLYGY T+ DL   GSF+ MG  G+ + SLVN+F++SS +   +S  G+++F+ LT
Sbjct: 121 FCAMSLYGYLTRSDLTSWGSFLFMGLVGVVIASLVNMFLQSSMLSWVLSVCGVIVFTGLT 180

Query: 209 AYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQKIK+  +         + +V+GAL LY+DFI +F+ +LR  G RR
Sbjct: 181 AYDTQKIKQMGN------TGRKGAVLGALTLYLDFINMFLSMLRLFGDRR 224


>gi|34101290|ref|NP_036438.2| fas apoptotic inhibitory molecule 2 [Homo sapiens]
 gi|114644893|ref|XP_509050.2| PREDICTED: fas apoptotic inhibitory molecule 2 [Pan troglodytes]
 gi|38503167|sp|Q9BWQ8|FAIM2_HUMAN RecName: Full=Fas apoptotic inhibitory molecule 2; AltName:
           Full=Protein lifeguard; AltName: Full=Transmembrane BAX
           inhibitor motif-containing protein 2
 gi|13111703|gb|AAH00051.1| Fas apoptotic inhibitory molecule 2 [Homo sapiens]
 gi|119578507|gb|EAW58103.1| Fas apoptotic inhibitory molecule 2, isoform CRA_a [Homo sapiens]
 gi|158261085|dbj|BAF82720.1| unnamed protein product [Homo sapiens]
 gi|208967815|dbj|BAG72553.1| Fas apoptotic inhibitory molecule 2 [synthetic construct]
 gi|312151952|gb|ADQ32488.1| Fas apoptotic inhibitory molecule 2 [synthetic construct]
          Length = 316

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 84/238 (35%), Gaps = 25/238 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++ + L VT  +  L        D   A+           F          
Sbjct: 100 RVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFAT-------- 151

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      ++  +++  +          Y + S++    IT
Sbjct: 152 ---------YLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGIT 202

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAMGL 201
           A    S++++ + TK D       + +    LF    +L+++  F     +    +A+G 
Sbjct: 203 ALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGA 262

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            +F+   A DTQ +          + +  + + GAL +Y+D I IF   L+  G+ R+
Sbjct: 263 GVFTLFLALDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE 316


>gi|288925150|ref|ZP_06419085.1| membrane protein [Prevotella buccae D17]
 gi|288337915|gb|EFC76266.1| membrane protein [Prevotella buccae D17]
          Length = 236

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 86/252 (34%), Positives = 145/252 (57%), Gaps = 19/252 (7%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
                        ++    A M +VY  MAL L +TGI ++ V      +     + ++ 
Sbjct: 3   NAAEGRTDTRSKELNLAFPALMRKVYTWMALALAITGITAYGVATSPALLTAIFTNKLLF 62

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
            G+++   G + YT+                   RL  LS   A ++F+L+S + G++L+
Sbjct: 63  YGLIIAELGIVFYTT------------------ARLAKLSLSTATLLFILFSVINGVTLA 104

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
           S F++YT  SI  TFF+TA +FG+++  GYTTKRDL  +G  ++M   GL + ++VN+F+
Sbjct: 105 SVFMIYTMSSIATTFFVTAGTFGAMAFIGYTTKRDLTKMGGILMMALIGLIIAAVVNMFL 164

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYD-VAYAERQSVIGALMLYMDFIQI 246
            +S  DL +S +G++IF+ LTA+D+Q IK    ++YD    A++ +++G+L LY+DFI +
Sbjct: 165 HNSTFDLIVSGLGVLIFTGLTAWDSQAIKRMLQEQYDMSEGAQKVALLGSLSLYLDFINM 224

Query: 247 FVHLLRFLGSRR 258
           F++LLRFLG R+
Sbjct: 225 FLYLLRFLGDRK 236


>gi|197124477|ref|YP_002136428.1| hypothetical protein AnaeK_4095 [Anaeromyxobacter sp. K]
 gi|196174326|gb|ACG75299.1| protein of unknown function UPF0005 [Anaeromyxobacter sp. K]
          Length = 236

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 87/233 (37%), Positives = 127/233 (54%), Gaps = 21/233 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R +M  VY  M LGLGVT +++  V    T +     + I+  G++L             
Sbjct: 25  RRFMSAVYRWMTLGLGVTALVATAVASSETLLLAIVGNRILFYGLIL------------- 71

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                A L + I+++  ++ L A AA  +FLLYSA+ G +LS   LVYT  S+   F  T
Sbjct: 72  -----AELALVIWISAAVNRLPAAAAGGLFLLYSAINGATLSVVLLVYTGASVGIAFLTT 126

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F ++S+YG  T+RDL   GSF+ MG  G+ + SL NLF RS  +   +S  G+++F+
Sbjct: 127 AGTFAAMSVYGTVTRRDLTGWGSFLFMGLIGIVIASLANLFFRSDMVSWVVSCAGVLVFT 186

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            LTAYDTQK++         A A       AL LY+DF+ +F+ LLR  G+RR
Sbjct: 187 GLTAYDTQKLRAYARAGGGAAAAPVSG---ALSLYLDFVNLFLSLLRLFGNRR 236


>gi|198276085|ref|ZP_03208616.1| hypothetical protein BACPLE_02272 [Bacteroides plebeius DSM 17135]
 gi|198270897|gb|EDY95167.1| hypothetical protein BACPLE_02272 [Bacteroides plebeius DSM 17135]
          Length = 233

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 89/234 (38%), Positives = 137/234 (58%), Gaps = 20/234 (8%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A    VY  M L L +TG ++  V                      T    +M  S + W
Sbjct: 18  ALFRSVYLWMTLALVITGFVAMYVAKS------------------YTLIETIMQNSIMFW 59

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
             + A +G+ ++L+ R+H +S   A ++F+ YS L G+++S  FL+YT  SI  TFF+TA
Sbjct: 60  GLLIAEVGLVMYLSARIHKISFTTATLLFIAYSVLNGVTMSVLFLIYTLSSIATTFFVTA 119

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
            +FG  +LYGY TK+DL  IGS  +MG  GL + SLVN+F+ +S +D+ +S +G+++F  
Sbjct: 120 GTFGVTALYGYVTKKDLTRIGSLCLMGVIGLIIASLVNMFLHNSMMDMIISYIGVLLFVG 179

Query: 207 LTAYDTQKIKEAYSDRYDV--AYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           LTAYD+QKIK+  S          ++ +++GAL LY+DFI +F++LLR LG R+
Sbjct: 180 LTAYDSQKIKQLLSHDDIEVNETTQKIALMGALTLYLDFINLFIYLLRILGDRK 233


>gi|86160399|ref|YP_467184.1| hypothetical protein Adeh_3983 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85776910|gb|ABC83747.1| protein of unknown function UPF0005 [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 236

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 86/233 (36%), Positives = 126/233 (54%), Gaps = 21/233 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R +M  VY  M LGLGVT +++  V    T +     + I+  G+++             
Sbjct: 25  RRFMSAVYRWMTLGLGVTALVATAVASSETLLLAIVGNRILFYGLVI------------- 71

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                A L + I+++  ++ L A AA  +FLLYSAL G +LS   LVYT  S+   F  T
Sbjct: 72  -----AELALVIWISAAVNRLPAVAAGGLFLLYSALNGATLSVVLLVYTGASVGIAFLTT 126

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F ++S+YG  T+RDL   GSF+ MG  G+ + SL NLF RS  +   +S  G+++F+
Sbjct: 127 AGTFAAMSVYGTVTRRDLTGWGSFLFMGLIGIVIASLANLFFRSDMVSWVVSCAGVLVFT 186

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            LTAYDTQK++         A A        L LY+DF+ +F+ LLR  G+RR
Sbjct: 187 GLTAYDTQKLRAYARAGGGAAAAPVSGA---LSLYLDFVNLFLSLLRLFGNRR 236


>gi|15896086|ref|NP_349435.1| YccA family membrane protein [Clostridium acetobutylicum ATCC 824]
 gi|15025874|gb|AAK80775.1|AE007780_9 Conserved membrane protein, YccA family [Clostridium acetobutylicum
           ATCC 824]
 gi|325510240|gb|ADZ21876.1| Conserved membrane protein, YccA family [Clostridium acetobutylicum
           EA 2018]
          Length = 231

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 83/236 (35%), Positives = 133/236 (56%), Gaps = 21/236 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R+++ +VY  M L L  T  ++  V+   + ++                   L     L 
Sbjct: 14  RSFIQQVYMWMTLALLTTAGVALAVSTSPSLIE------------------TLFINRSLF 55

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
           ++ I A + +  FL+ R++ +S+  A  +F +YS + G +LS  FLVY   SI   FFIT
Sbjct: 56  FVLILAEVLIVAFLSRRINKMSSQVATAIFFVYSVVNGFTLSWIFLVYDLGSISSVFFIT 115

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +FG++  YGY TK+DL  IG+  +MG  GL L S+VN+F+ +      +S +G+++F 
Sbjct: 116 AGTFGAMCAYGYFTKKDLTSIGNICLMGLVGLILASIVNIFIMNDMFSFIISFIGVILFV 175

Query: 206 ALTAYDTQKIKEAY---SDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           A+TAYDTQ+IK      S   DV  + + S++GAL LY+DFI +F+++LR  G +R
Sbjct: 176 AITAYDTQRIKAMALSSSYSGDVEASAKGSILGALTLYLDFINLFIYILRLFGRKR 231


>gi|312374512|gb|EFR22055.1| hypothetical protein AND_15830 [Anopheles darlingi]
          Length = 314

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/166 (23%), Positives = 71/166 (42%), Gaps = 3/166 (1%)

Query: 94  GVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLS 153
            +            A    +   L++      +      Y S+ ++  F ITAA    L+
Sbjct: 152 PLIAIACCGDLRRKAPMNFIFLGLFTFAESFLVCVITANYNSQEVMLAFGITAAVCLGLT 211

Query: 154 LYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQ 213
           L+ + TK D   +G  + +    L L  ++ +F     I +  ++ G ++FS    YDTQ
Sbjct: 212 LFAFQTKWDFTMMGGILFVAVLVLMLFGIIAMFFPGKTITIVYASAGALLFSFYLIYDTQ 271

Query: 214 KIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                    +  + +  + V  AL LY+D I IF+H+L  +G+ R+
Sbjct: 272 I---MLGGDHKYSISPEEYVFAALNLYLDVINIFLHILSIIGASRN 314


>gi|220919206|ref|YP_002494510.1| protein of unknown function UPF0005 [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219957060|gb|ACL67444.1| protein of unknown function UPF0005 [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 236

 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 86/233 (36%), Positives = 125/233 (53%), Gaps = 21/233 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R +M  VY  M LGLGVT +++  V    T +     + I+  G++L             
Sbjct: 25  RRFMSAVYRWMTLGLGVTALVATAVASSETLLLAIVGNRILFYGLIL------------- 71

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                  L + I+++  ++ L A AA  +FLLYSA+ G +LS   LVYT  S+   F  T
Sbjct: 72  -----GELALVIWISAAVNRLPAAAAGGLFLLYSAINGATLSVVLLVYTGASVGIAFLTT 126

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F ++S+YG  T+RDL   GSF+ MG  G+ + SL NLF RS  I   +S  G+++F+
Sbjct: 127 AGTFAAMSVYGTVTRRDLTGWGSFLFMGLIGIVIASLANLFFRSDMISWVVSCAGVLVFT 186

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            LTAYDTQK++         A A        L LY+DF+ +F+ LLR  G+RR
Sbjct: 187 GLTAYDTQKLRAYARAGGGAAAAPVSGA---LSLYLDFVNLFLSLLRLFGNRR 236


>gi|322419616|ref|YP_004198839.1| hypothetical protein GM18_2100 [Geobacter sp. M18]
 gi|320126003|gb|ADW13563.1| protein of unknown function UPF0005 [Geobacter sp. M18]
          Length = 224

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 87/230 (37%), Positives = 131/230 (56%), Gaps = 24/230 (10%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M  VY  M  GL +T ++S +       +     + I+   ++    G ++  S      
Sbjct: 19  MRGVYGWMGGGLLLTALVSLITASSPALLQAILGNRILFYALVFGELGLVVAISGA---- 74

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
                         ++ +S+  A ++FLLY+AL GL++S+ F+VYT  SI  TF ITA  
Sbjct: 75  --------------INRISSATASLLFLLYAALNGLTMSTIFVVYTQSSIASTFLITAGM 120

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGY TK DL   GSF+ MG  G+ + SLVN+F++SS +   MS  G+++F+ LT
Sbjct: 121 FGAMSLYGYLTKSDLSSWGSFLFMGLVGVVIASLVNIFLQSSMLGWVMSLCGILVFTGLT 180

Query: 209 AYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQKIK+            + +++GAL LY+DFI +F+ LLRF G+RR
Sbjct: 181 AYDTQKIKQMGV------SGRKGAILGALTLYLDFINMFLLLLRFFGNRR 224


>gi|325300371|ref|YP_004260288.1| hypothetical protein Bacsa_3289 [Bacteroides salanitronis DSM
           18170]
 gi|324319924|gb|ADY37815.1| protein of unknown function UPF0005 [Bacteroides salanitronis DSM
           18170]
          Length = 235

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 91/232 (39%), Positives = 138/232 (59%), Gaps = 20/232 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M  VY  M L L +TG++S  V                      T    ++    L W  
Sbjct: 22  MRNVYTWMTLALVITGLVSLYVAKS------------------YTLLSMIVQNQMLFWGL 63

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           + A +G+ I+L+ R+H ++   A ++F+ YS L G++L+  F+VYT  SI  TFF+TA +
Sbjct: 64  LIAEIGLVIYLSARIHRIAFSTATLLFIAYSILNGITLAFIFMVYTMSSIATTFFVTAGT 123

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG ++LYGY TKRDL  IG+  IM   GL + SLVNLF+ +S +DL +S +G++IF+ LT
Sbjct: 124 FGVMALYGYVTKRDLTRIGNICIMALIGLIIASLVNLFLHNSMMDLIISGIGVLIFTGLT 183

Query: 209 AYDTQKIKEAYSDRYDV--AYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYD+QKIK   +          ++ +++GA+ LY+DFI +F++LLRFLG R+
Sbjct: 184 AYDSQKIKHLLTGEDMEVNDTTQKIALMGAMTLYLDFINLFLYLLRFLGDRK 235


>gi|24653227|ref|NP_725240.1| N-methyl-D-aspartate receptor-associated protein, isoform F
           [Drosophila melanogaster]
 gi|16648240|gb|AAL25385.1| GH26622p [Drosophila melanogaster]
 gi|21627291|gb|AAM68615.1| N-methyl-D-aspartate receptor-associated protein, isoform F
           [Drosophila melanogaster]
 gi|220945674|gb|ACL85380.1| Nmda1-PF [synthetic construct]
 gi|220955448|gb|ACL90267.1| Nmda1-PF [synthetic construct]
          Length = 316

 Score =  113 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/253 (18%), Positives = 95/253 (37%), Gaps = 20/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y    +    F        R ++ +VY ++   L VT     L      T      ++ +
Sbjct: 84  YDDPESQPKNFSFDDQSIRRGFIRKVYLILMGQLIVTFGAVALFVYHEGTKTFARNNMWL 143

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
               +      ++  +    +                         +   L++A     +
Sbjct: 144 FWVALGVMLVTMLSMACCESVR-----------------RQTPTNFIFLGLFTAAQSFLM 186

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                 Y  K ++    ITAA   +L+++   TK D   +G  +I       +  +V +F
Sbjct: 187 GVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIF 246

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           ++   I L  +++G ++FS    YDTQ +       +  + +  + +  AL LY+D I I
Sbjct: 247 VKGKIITLVYASIGALLFSVYLIYDTQLMM---GGEHKYSISPEEYIFAALNLYLDIINI 303

Query: 247 FVHLLRFLGSRRD 259
           F+++L  +G+ RD
Sbjct: 304 FMYILTIIGASRD 316


>gi|239909125|ref|YP_002955867.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
 gi|239798992|dbj|BAH77981.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
          Length = 239

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 86/238 (36%), Positives = 133/238 (55%), Gaps = 20/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
           + + A+M  VY  M LGL VT   S  V      +     + I+  G+++          
Sbjct: 18  EVVNAFMRGVYGWMCLGLLVTAAASVFVVSSPALMQAVFGNQILFFGLII---------- 67

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + + L+  ++ LSA  A  +F+LYSAL G++LS+ F+VY   +I + F
Sbjct: 68  --------AELALVVGLSAAINRLSAGTASGLFMLYSALNGVTLSAIFVVYAQATIFKAF 119

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            +T   FG++SLYG  TKRDL  +GSF+ MG  G+ + SLVN+F +S+  D  +S +G++
Sbjct: 120 LVTGGMFGAMSLYGLLTKRDLTGMGSFLFMGLIGIVIASLVNMFTKSAMADFIISCVGVL 179

Query: 203 IFSALTAYDTQKIKEA--YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F+ LTAYDTQK+K     +   D     R +++GAL LY+DFI +F+ +LR  G   
Sbjct: 180 VFTGLTAYDTQKLKVMGEMAPADDATAVRRGTILGALTLYLDFINLFLMMLRLFGGGN 237


>gi|302895685|ref|XP_003046723.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256727650|gb|EEU41010.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 275

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 50/247 (20%), Positives = 94/247 (38%), Gaps = 30/247 (12%)

Query: 14  GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
           GS   +T+D     ++ +VY ++ + L  T  +S L    A   +           V  +
Sbjct: 57  GSVAEATVDIR-NQFVRKVYTILTVQLLATAGVSSLTFFSAGYKEWIQGHP---GVVWAS 112

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
            FGA+++     W                    S     +   L++     ++S     Y
Sbjct: 113 LFGAMIFMGLTYWKRK-----------------SYPTNLLFLSLFTLAEAYTISVIVSFY 155

Query: 134 TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL-SLVNLFMRSSAI 192
            +  ++    +TA  F  L+L+   TK D      ++    +GL +   +   F  SS  
Sbjct: 156 KTSIVLNAVVLTAGIFVFLTLFACQTKYDFTSWMPYLFGALWGLVIFGFMAMFFPYSSTG 215

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           +L    +  +IFS     DTQ +   +    +        +  A+ LY+D I +F+ +LR
Sbjct: 216 ELIYGGLAALIFSGYILVDTQLVLRHHHVEEE--------IAAAISLYLDIINLFLAILR 267

Query: 253 FLGSRRD 259
            L S+ +
Sbjct: 268 ILNSQSN 274


>gi|58269994|ref|XP_572153.1| vacuole  protein [Cryptococcus neoformans var. neoformans JEC21]
 gi|134113673|ref|XP_774421.1| hypothetical protein CNBG0670 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257059|gb|EAL19774.1| hypothetical protein CNBG0670 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57228389|gb|AAW44846.1| vacuole protein, putative [Cryptococcus neoformans var. neoformans
           JEC21]
          Length = 283

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 101/233 (43%), Gaps = 30/233 (12%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++ +VY+++ + L  T  +S L+++ +                             + WI
Sbjct: 79  FIRKVYSILLIQLLATAGVSILLSLPSAKDFTHT-------------------NPWIMWI 119

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
            +        F+  + H     A  ++  L++      +      Y S+ ++Q  FIT  
Sbjct: 120 PLIGSFTSLFFVYWKRH--QHPANLILLGLFTLFEATMIGLAVSYYESRIVIQALFITLG 177

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMSAMGLVIFSA 206
            F  L+L+ + TK D       + +G +GL    L+ +F   ++ +DL ++    ++FS 
Sbjct: 178 VFIGLTLFTFQTKYDFSSFAPILFIGIWGLLTTYLIQIFLPFNATVDLGIACFSTLLFSG 237

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
              YDTQ+I +          +  +++ GAL LY+DF+ +F+ +LR L +  D
Sbjct: 238 FVLYDTQQIMK--------RLSVDEAIAGALTLYLDFLNLFLSILRILNNSND 282


>gi|158294321|ref|XP_001688676.1| AGAP005529-PA [Anopheles gambiae str. PEST]
 gi|158294323|ref|XP_001688677.1| AGAP005529-PB [Anopheles gambiae str. PEST]
 gi|157015510|gb|EDO63682.1| AGAP005529-PA [Anopheles gambiae str. PEST]
 gi|157015511|gb|EDO63683.1| AGAP005529-PB [Anopheles gambiae str. PEST]
          Length = 320

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 51/253 (20%), Positives = 95/253 (37%), Gaps = 20/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y     S  GF        R ++ +VY+++ + L +T     L      T         +
Sbjct: 88  YDPETGSVKGFEFNDQSIRRGFIRKVYSILTVQLAITLGFITLFLYHRPTKLWVQNHPEM 147

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
               +      L+  +    +                    A    +   L++      L
Sbjct: 148 FWIALGVMVVTLISMACCGDVR-----------------RKAPMNFIFLTLFTLAQAFLL 190

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                 ++S+ ++    ITAA    L+L+ + TK D   +G  + +    L L  L+ +F
Sbjct: 191 GVTTANFSSQEVMLAVGITAAVCLGLTLFAFQTKWDFTVMGGILFVAVLILMLFGLIAIF 250

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
                I L  ++ G +IFS    YDTQ         +  + +  + +  AL LY+D + I
Sbjct: 251 FPGKTITLVYASAGALIFSIYLVYDTQL---MLGGEHKYSISPEEYIFAALNLYLDIVNI 307

Query: 247 FVHLLRFLGSRRD 259
           F+++L  +G+ RD
Sbjct: 308 FLYILTIIGASRD 320


>gi|21311561|gb|AAM46781.1|AF468028_1 lifeguard [Mus musculus]
          Length = 317

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 84/238 (35%), Gaps = 25/238 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++ + L VT  +  L        D   A+           F          
Sbjct: 101 RLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWYWASYAVFFAT-------- 152

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      ++  +++  +          Y + S++    IT
Sbjct: 153 ---------YLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLVIT 203

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAMGL 201
           A    S++++ + TK D       + +    LF    LL+++  F     +    + +G 
Sbjct: 204 ALVCLSVTIFSFQTKFDFTSCQGVLFVLLMTLFFSGLLLAVLLPFQYVPWLHAVYAVLGA 263

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            +F+   A+DTQ +          + +  + + GAL +Y+D I IF   L+  G+ R+
Sbjct: 264 GVFTLFLAFDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLYGTNRE 317


>gi|147906077|ref|NP_001088462.1| transmembrane BAX inhibitor motif containing 1 [Xenopus laevis]
 gi|54311223|gb|AAH84788.1| LOC495327 protein [Xenopus laevis]
          Length = 335

 Score =  113 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 50/257 (19%), Positives = 102/257 (39%), Gaps = 28/257 (10%)

Query: 7   YQRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASI 64
           Y      G  FGS  D+ +R A++ RVY ++A+ L VT GI++    +   T        
Sbjct: 100 YNTSDREGGNFGSWDDKTVRHAFIRRVYAIIAVQLLVTVGIIAIFTYVEPVTTFIRKTPG 159

Query: 65  IINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGL 124
           I      +     ++                                 ++  +++  +  
Sbjct: 160 IYYASYAVFFVTYIVLV------------------CCEGPRRRFPWNIILLSIFTLAMSF 201

Query: 125 SLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLL 180
              +    Y+SK+++ +  ITA     ++++ + TK D         +    +     + 
Sbjct: 202 MAGTIASFYSSKAVLISMGITAIVTIIVTIFCFQTKVDFTSCAGLFAVLGIVMFVTGIVT 261

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           ++V  F     + +  +A+G ++F+   A+DTQ +            +  + V GAL +Y
Sbjct: 262 AIVLAFKYVYWLHMLYAALGAIVFTLFLAFDTQLVI----GNRKHTISPEEYVYGALKIY 317

Query: 241 MDFIQIFVHLLRFLGSR 257
            D + IF++LL+ +GSR
Sbjct: 318 TDIVYIFLNLLQIVGSR 334


>gi|46135813|ref|XP_389598.1| hypothetical protein FG09422.1 [Gibberella zeae PH-1]
          Length = 276

 Score =  113 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 49/247 (19%), Positives = 94/247 (38%), Gaps = 30/247 (12%)

Query: 14  GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
           GS   +T+D     ++ +VY ++ + L  T  +S L        D   +       V  +
Sbjct: 58  GSVAEATVDIR-NQFVRKVYTILTVQLLATAGVSSLTFFSTGYKDWIQSHP---GVVWAS 113

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
            FG++++     W                    S     +   L++     ++S     Y
Sbjct: 114 LFGSMIFMGLTYWKRK-----------------SYPTNLLFLSLFTLAEAYTISVIVSFY 156

Query: 134 TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL-SLVNLFMRSSAI 192
            +  ++    +TA  F  L+L+   TK D      ++    +GL +   +   F  SS  
Sbjct: 157 KTSIVLNAVVLTAGIFVFLTLFACQTKYDFTSWMPYLFGALWGLVIFGFMAMFFPYSSTG 216

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           +L    +  +IFS     DTQ +   +    +        +  A+ LY+D I +F+ +LR
Sbjct: 217 ELIYGGLAALIFSGYILVDTQLVLRHHHVEEE--------IAAAISLYLDIINLFLAILR 268

Query: 253 FLGSRRD 259
            L S+ +
Sbjct: 269 ILNSQSN 275


>gi|197118517|ref|YP_002138944.1| hypothetical protein Gbem_2135 [Geobacter bemidjiensis Bem]
 gi|197087877|gb|ACH39148.1| inner membrane protein of unknown function UPF0005 [Geobacter
           bemidjiensis Bem]
          Length = 224

 Score =  113 bits (281), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 82/230 (35%), Positives = 127/230 (55%), Gaps = 24/230 (10%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M  VY  M  GL +T ++S +       +     + I+   ++    G ++  S      
Sbjct: 19  MRGVYGWMGGGLALTALVSLMTASSPALLQAILGNRILFYALVFGELGLVIAISGA---- 74

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
                         ++ +SA  A  +FLLY+A+ GL++SS F+ YTS SI  TF +T+  
Sbjct: 75  --------------INRISATTASALFLLYAAVNGLTMSSIFVAYTSTSIASTFLVTSGM 120

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           F ++SLYGY T+ DL   GSF+ MG  G+ + SLVN+F+ SS +   +S  G+++F+ LT
Sbjct: 121 FCAMSLYGYLTRSDLTSWGSFLFMGLVGVVIASLVNMFLHSSMLSWVLSVCGVIVFTGLT 180

Query: 209 AYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQKIK+  +         + +V+GAL LY+DFI +F+ +LR  G RR
Sbjct: 181 AYDTQKIKQMGNA------GRKGAVLGALTLYLDFINMFLSMLRLFGDRR 224


>gi|241176175|ref|XP_002399495.1| inner membrane protein ybhL [Ixodes scapularis]
 gi|215495147|gb|EEC04788.1| inner membrane protein ybhL [Ixodes scapularis]
          Length = 215

 Score =  113 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 90/233 (38%), Positives = 136/233 (58%), Gaps = 20/233 (8%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           YM +VY  M +GL +T  +++     A  ++    + +   G+++               
Sbjct: 1   YMAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII--------------- 45

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
              A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF +TA 
Sbjct: 46  ---AQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTAG 102

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
            FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  L
Sbjct: 103 MFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVGL 162

Query: 208 TAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           TAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 163 TAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 215


>gi|48097206|ref|XP_391854.1| PREDICTED: glutamate [NMDA] receptor-associated protein 1-like
           isoform 1 [Apis mellifera]
          Length = 318

 Score =  113 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 41/234 (17%), Positives = 92/234 (39%), Gaps = 20/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +VY+++   L +T  M  L    A T         +     ++    ++  +   
Sbjct: 105 NGFIRKVYSILMCQLLITVGMIALFLYHAPTNKFVMTHPELFWICFVSTIVLIICMACCS 164

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +                    A    +   L++   G  L++    + S+ ++    IT
Sbjct: 165 SVR-----------------RKAPMNFVFLFLFTIAEGFLLATAASTFKSEEVLLAAGIT 207

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           +     L+L+ + TK D   + S + +      +  +  +      + L  +++G ++FS
Sbjct: 208 SVVCLGLTLFAFQTKFDFTGLNSILFVALLIFVVFGIFAMIWHGKIMTLVYASIGALLFS 267

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
               YDTQ        ++  + +  + +  AL LY+D I IF+++L  +GS R+
Sbjct: 268 IYLIYDTQV---MIGGKHKYSISPEEYIFAALNLYIDIINIFLYILTIIGSSRN 318


>gi|116004355|ref|NP_001070536.1| transmembrane Bax inhibitor motif containing 1B [Bos taurus]
 gi|82571715|gb|AAI10221.1| Hypothetical protein MGC134563 [Bos taurus]
          Length = 301

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 93/233 (39%), Gaps = 19/233 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++++V  L+++ L +TG +  L             +      ++   F   +  +   
Sbjct: 88  RDFIVKVLFLLSIQLLITGAIVSLFVFWKALRSWVVKNPWFTYTLLPAFFVVFIVLACCG 147

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +                      A  ++  L++ L GL L +  + Y  + ++     T
Sbjct: 148 NLR-----------------RQVPANYILLGLFTVLQGLLLGTVSVFYHVEEVLWATAAT 190

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A    SLSL+   TK D   +   + +  F L +  ++ +F+R+  + L  + +G VIFS
Sbjct: 191 ALVTLSLSLFDLQTKWDFTLLNGMLFVLLFVLIIYGIILIFIRAYWLHLLYAGLGTVIFS 250

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
                D Q +       +       + V  AL +YMD I +F+ +L+ +G  R
Sbjct: 251 LYLVMDVQLMVG--GRHHHSDLDPEEYVFAALNIYMDIINLFLFILQLIGMGR 301


>gi|54400486|ref|NP_001005992.1| transmembrane BAX inhibitor motif-containing protein 1 [Danio
           rerio]
 gi|53734147|gb|AAH83414.1| Transmembrane BAX inhibitor motif containing 1 [Danio rerio]
          Length = 324

 Score =  112 bits (280), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 35/233 (15%), Positives = 90/233 (38%), Gaps = 25/233 (10%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           +++ +VY ++A  L VT  +  ++  +         +  I        F   +       
Sbjct: 109 SFIRKVYLILAAQLLVTAAVVAILTFVEPVGLFVRKNPAIYWVSYAVYFVTHI------- 161

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                     + +  +          ++  +++  +     +    Y+++++     IT 
Sbjct: 162 ----------VLVCCQGPRRRFPWNLLLLAIFTLALPFMTGNIASYYSTRAVFLALAITV 211

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSLVNLFMRSSAIDLTMSAMGLV 202
               +++++ + TK D      F  +    +     + ++V  F     + +  +++G +
Sbjct: 212 VVCVAVTVFCFQTKVDFTKCSGFFCVLGIVVFVTGIITAIVLSFKHVPWLHMLYASIGAI 271

Query: 203 IFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
            F+   AY TQ +         ++ +  + V  AL LY+D +QIF+ LL+ +G
Sbjct: 272 AFTLFLAYHTQLLI----GNRKLSISPEEYVFAALSLYVDIVQIFIFLLQIIG 320


>gi|302420543|ref|XP_003008102.1| transmembrane BAX inhibitor motif-containing protein [Verticillium
           albo-atrum VaMs.102]
 gi|261353753|gb|EEY16181.1| transmembrane BAX inhibitor motif-containing protein [Verticillium
           albo-atrum VaMs.102]
          Length = 285

 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 52/248 (20%), Positives = 98/248 (39%), Gaps = 32/248 (12%)

Query: 14  GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
           GS   +TID  +  ++ +VY ++ + L VTG +S L                        
Sbjct: 67  GSVAEATIDIRM-QFIRKVYAILTVQLIVTGAVSALSFFSE------------------- 106

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMF-LLYSALIGLSLSSFFLV 132
             G   +      +   +  G   F+ +      +Y   ++F   ++ L   ++S     
Sbjct: 107 --GYKSWIQSHPGVVWISLFGSIAFMLLTFWKRKSYPTNLLFLSGFTLLEAYTVSVIVSF 164

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSA 191
           Y +  ++    +TA  F  L+L+   TK D      ++    + L L  L+  F   +S 
Sbjct: 165 YKAPIVLNAVVLTAGIFVFLTLFACQTKYDFTSWAPYLFGSLWALLLFGLMAAFLPYNST 224

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLL 251
            +L       +IFSA    DTQ I   +    +        +  A+ LY+D + +F+ +L
Sbjct: 225 AELVYGGAAALIFSAYILVDTQLIMRKHHVEEE--------IAAAISLYLDILNLFLAIL 276

Query: 252 RFLGSRRD 259
           R L S+++
Sbjct: 277 RILNSQQN 284


>gi|300939821|ref|ZP_07154459.1| putative inner membrane protein [Escherichia coli MS 21-1]
 gi|300455353|gb|EFK18846.1| putative inner membrane protein [Escherichia coli MS 21-1]
          Length = 214

 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 90/232 (38%), Positives = 135/232 (58%), Gaps = 20/232 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M +VY  M +GL +T  +++     A  ++    + I   G+++                
Sbjct: 1   MAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRIFLIGLVI---------------- 44

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
             A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF +TA  
Sbjct: 45  --AQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTAGM 102

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  LT
Sbjct: 103 FGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVGLT 162

Query: 209 AYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 163 AYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 214


>gi|301755766|ref|XP_002913716.1| PREDICTED: transmembrane BAX inhibitor motif-containing protein
           1-like [Ailuropoda melanoleuca]
 gi|281340235|gb|EFB15819.1| hypothetical protein PANDA_001558 [Ailuropoda melanoleuca]
          Length = 311

 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 44/256 (17%), Positives = 96/256 (37%), Gaps = 26/256 (10%)

Query: 8   QRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           +R V+   G G   D+ +R  ++ +VY ++++ L VT  +  +   +    D    ++ +
Sbjct: 77  ERAVSESFGPGEWDDRKVRHTFIRKVYTIISIQLLVTVAIIAVFTFVKPVGDFVRRNLFV 136

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                                              +          ++  +++  +G   
Sbjct: 137 YYVSYAVFLAT-----------------YLTLACCQGPRRRFPWNIILLAIFTLAMGFMT 179

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
            +   VY +K+++    ITA    S++++ + TK D         +    + +  +V   
Sbjct: 180 GTISSVYETKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVMMVTGIVTAI 239

Query: 187 MRS----SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           + S      + +  +A+G + F+   AYDTQ +            +    + GAL +Y D
Sbjct: 240 VLSFKYIYWLHMVYAALGAICFTLFLAYDTQLV----LGNRKHTISPEDYITGALQIYTD 295

Query: 243 FIQIFVHLLRFLGSRR 258
            I IF  +L+ +G R 
Sbjct: 296 IIYIFTFVLQLVGDRN 311


>gi|315498128|ref|YP_004086932.1| hypothetical protein Astex_1105 [Asticcacaulis excentricus CB 48]
 gi|315416140|gb|ADU12781.1| protein of unknown function UPF0005 [Asticcacaulis excentricus CB
           48]
          Length = 251

 Score =  112 bits (279), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 93/248 (37%), Positives = 139/248 (56%), Gaps = 11/248 (4%)

Query: 12  NSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVM 71
           + G+     +D  LR YM+ +YN M L L ++G ++FL       +            V 
Sbjct: 14  SGGTTRTLALDADLRRYMMGIYNRMGLALLISGGVAFLAAQSPGFISA----------VY 63

Query: 72  LTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFL 131
           +     +   + L W   FAPL + + L   +  +S   A+  F +++A++GLSL+S  L
Sbjct: 64  VMSGDRISGLTGLGWGLAFAPLAMAMVLGFGVMRMSLATAQFSFWIFAAIMGLSLTSIVL 123

Query: 132 VYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSA 191
            YT  SI Q F ITA +FG  S +GYTTK+DL   G F++M   GL + SLVNL ++SS 
Sbjct: 124 AYTGASIAQAFLITAITFGLTSFWGYTTKQDLTRFGGFLMMAVIGLIVASLVNLLLQSSW 183

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDV-AYAERQSVIGALMLYMDFIQIFVHL 250
           + L +SA+G++IF+ALTA+DTQ++K  Y D  D      +  ++GAL LY++ I IF  L
Sbjct: 184 LQLALSALGVLIFTALTAFDTQRLKGLYYDLSDQGETRGKIMILGALSLYINVINIFTSL 243

Query: 251 LRFLGSRR 258
           L   G RR
Sbjct: 244 LHLSGERR 251


>gi|226532734|ref|NP_001141365.1| hypothetical protein LOC100273456 [Zea mays]
 gi|194704196|gb|ACF86182.1| unknown [Zea mays]
          Length = 275

 Score =  112 bits (279), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 50/247 (20%), Positives = 94/247 (38%), Gaps = 30/247 (12%)

Query: 14  GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
           GS   +T+D     ++ +VY ++ + L  T  +S L        D   +       V  +
Sbjct: 57  GSVAEATVDIR-NQFVRKVYTILTVQLLATAGVSSLTFFSTGYKDWIQSHP---GVVWAS 112

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
            FGA+++     W                    S     +   L++     ++S     Y
Sbjct: 113 LFGAMIFMGLTYWKRK-----------------SYPTNLLFLSLFTLAEAYTISVIVSFY 155

Query: 134 TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL-SLVNLFMRSSAI 192
            +  ++    +TA  F  L+L+   TK D      ++    +GL +   +   F  SS  
Sbjct: 156 KTSIVLNAVVLTAGIFVFLTLFACQTKYDFTSWMPYLFGALWGLVIFSFMAMFFPYSSTG 215

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           +L    +  +IFS     DTQ +   +    +        +  A+ LY+D I +F+ +LR
Sbjct: 216 ELIYGGLAALIFSGYILVDTQLVLRHHHVEEE--------IAAAISLYLDIINLFLAILR 267

Query: 253 FLGSRRD 259
            L S+ +
Sbjct: 268 ILNSQSN 274


>gi|109096565|ref|XP_001110495.1| PREDICTED: fas apoptotic inhibitory molecule 2-like isoform 2
           [Macaca mulatta]
          Length = 315

 Score =  112 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 40/238 (16%), Positives = 84/238 (35%), Gaps = 25/238 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++ + L VT  +  L        D   A+           F          
Sbjct: 99  RVFIRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPAWYWASYAVFFAT-------- 150

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      ++  +++  +          Y + S++    IT
Sbjct: 151 ---------YLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGIT 201

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAMGL 201
           A    S++++ + TK D       + +    LF    +L+++  F     +    +A+G 
Sbjct: 202 ALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGA 261

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            +F+   A DTQ +          + +  + + G+L +Y+D I IF   L+  G+ R+
Sbjct: 262 GVFTLFLALDTQLLM----GNRRHSLSPEEYIFGSLNIYLDIIYIFTFFLQLFGTNRE 315


>gi|153791752|ref|NP_001093342.1| hypothetical protein LOC100101281 [Xenopus laevis]
 gi|120577490|gb|AAI30077.1| LOC100101281 protein [Xenopus laevis]
          Length = 335

 Score =  112 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 51/262 (19%), Positives = 103/262 (39%), Gaps = 28/262 (10%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVT-GIMSFLVNILATTVDP 59
            D   Y      G  FGS  D+ +R A++ RVY ++A+ L VT GI++    +   T   
Sbjct: 95  GDNEMYNTGDREGGDFGSWDDKTVRHAFIRRVYAIIAVQLLVTVGIIAIFTYVEPVTAFI 154

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
                I      +     ++                                 ++  +++
Sbjct: 155 RRTPAIYYASYAVFFVTYIVLV------------------CCEGPRRRFPWNIILLSIFT 196

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL-- 177
             +     +    Y+SK+++ +  ITA     ++++ + TK D         +    +  
Sbjct: 197 LAMFFMAGTIASFYSSKAVLISMGITAIVTIIVTVFCFQTKVDFTSCAGLFAVLGIVMFV 256

Query: 178 --FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIG 235
              + ++V  F     + +  +A+G ++F+   A+DTQ +            +  + V G
Sbjct: 257 TGIVTAIVLAFKYVYWLHMLYAALGAIVFTLFLAFDTQLV----LGNRKHTISPEEYVYG 312

Query: 236 ALMLYMDFIQIFVHLLRFLGSR 257
           AL +Y D + IF++LL+ +GSR
Sbjct: 313 ALKIYTDIVYIFLNLLQIVGSR 334


>gi|291394823|ref|XP_002713852.1| PREDICTED: transmembrane Bax inhibitor motif containing 1B-like
           [Oryctolagus cuniculus]
          Length = 300

 Score =  112 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 45/254 (17%), Positives = 100/254 (39%), Gaps = 20/254 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASI 64
           +     ++ +      D+ +R A++++V+ +++  L VT ++  L             + 
Sbjct: 66  DTNAESSNRTSSSPFSDRNVRRAFIVKVFLILSAQLLVTALIISLFLFWQALKTWVLENP 125

Query: 65  IINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGL 124
                +    F  L+  +    +                      A  ++   ++ L GL
Sbjct: 126 WFTYAIFPAFFAVLIILACCGNLR-----------------RQVPANYILLGFFTFLQGL 168

Query: 125 SLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN 184
            L +  + Y ++ ++     T     +L+L+   TK D   +   + +  F L    ++ 
Sbjct: 169 LLGAVSVYYKAEEVLWATAATTLVTLALTLFALQTKWDFTLLNGVLFVFLFVLMAYGIIL 228

Query: 185 LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
           +F+RS  + L  + +G +IFS     D Q +        D+     + V  AL +Y+D I
Sbjct: 229 IFVRSYWLHLLYAGLGTLIFSFYLVMDVQLMVGGRHIHSDLD--PEEYVFAALNIYLDII 286

Query: 245 QIFVHLLRFLGSRR 258
            +F+ +L+ +G  R
Sbjct: 287 NLFLFILQLIGLGR 300


>gi|62859497|ref|NP_001016038.1| hypothetical protein LOC548792 [Xenopus (Silurana) tropicalis]
 gi|89269821|emb|CAJ81594.1| glutamate receptor, ionotropic, N-methyl D-asparate-associated
           protein 1 (glutamate binding) [Xenopus (Silurana)
           tropicalis]
 gi|213624445|gb|AAI71110.1| hypothetical protein LOC548792 [Xenopus (Silurana) tropicalis]
          Length = 366

 Score =  112 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 40/230 (17%), Positives = 88/230 (38%), Gaps = 21/230 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           RA++ +V+ ++   L VT     +   +         +           F +L+  S   
Sbjct: 154 RAFIRKVFLVLTAQLLVTFAFVAVFTFVDEAKVYVRRNTWTYYLSYAIFFVSLITLSC-- 211

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      +   + +  +   +      Y + +++    IT
Sbjct: 212 ---------------CGDFRRRHPWNLVALSILTFSLSYMVGMIASFYDTDAVIMAIGIT 256

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           AA   ++ L+   TK D       +++    L + S++ +F+R+  + +  +++G ++F+
Sbjct: 257 AAVCFTVVLFSLQTKYDFTSCMGVLLVSLIVLLIFSILCIFIRNKILQIVYASLGALLFT 316

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
              A DTQ I         ++ +  + V  AL LY D I IF+++L  +G
Sbjct: 317 CFLAVDTQMI----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILAIIG 362


>gi|227884252|ref|ZP_04002057.1| membrane protein [Escherichia coli 83972]
 gi|300816431|ref|ZP_07096653.1| putative inner membrane protein [Escherichia coli MS 107-1]
 gi|300822930|ref|ZP_07103065.1| putative inner membrane protein [Escherichia coli MS 119-7]
 gi|300898274|ref|ZP_07116625.1| putative inner membrane protein [Escherichia coli MS 198-1]
 gi|300907114|ref|ZP_07124780.1| putative inner membrane protein [Escherichia coli MS 84-1]
 gi|300920033|ref|ZP_07136492.1| putative inner membrane protein [Escherichia coli MS 115-1]
 gi|300922810|ref|ZP_07138896.1| putative inner membrane protein [Escherichia coli MS 182-1]
 gi|300929412|ref|ZP_07144881.1| putative inner membrane protein [Escherichia coli MS 187-1]
 gi|300947134|ref|ZP_07161348.1| putative inner membrane protein [Escherichia coli MS 116-1]
 gi|300957733|ref|ZP_07169920.1| putative inner membrane protein [Escherichia coli MS 175-1]
 gi|300992088|ref|ZP_07179790.1| putative inner membrane protein [Escherichia coli MS 200-1]
 gi|300993261|ref|ZP_07180308.1| putative inner membrane protein [Escherichia coli MS 45-1]
 gi|301020723|ref|ZP_07184791.1| putative inner membrane protein [Escherichia coli MS 69-1]
 gi|301051295|ref|ZP_07198121.1| putative inner membrane protein [Escherichia coli MS 185-1]
 gi|301306927|ref|ZP_07212971.1| putative inner membrane protein [Escherichia coli MS 124-1]
 gi|301327978|ref|ZP_07221143.1| putative inner membrane protein [Escherichia coli MS 78-1]
 gi|301646215|ref|ZP_07246111.1| putative inner membrane protein [Escherichia coli MS 146-1]
 gi|309797963|ref|ZP_07692342.1| putative inner membrane protein [Escherichia coli MS 145-7]
 gi|312967830|ref|ZP_07782043.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|312970860|ref|ZP_07785039.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|227839004|gb|EEJ49470.1| membrane protein [Escherichia coli 83972]
 gi|300297054|gb|EFJ53439.1| putative inner membrane protein [Escherichia coli MS 185-1]
 gi|300305417|gb|EFJ59937.1| putative inner membrane protein [Escherichia coli MS 200-1]
 gi|300315549|gb|EFJ65333.1| putative inner membrane protein [Escherichia coli MS 175-1]
 gi|300358063|gb|EFJ73933.1| putative inner membrane protein [Escherichia coli MS 198-1]
 gi|300398534|gb|EFJ82072.1| putative inner membrane protein [Escherichia coli MS 69-1]
 gi|300401159|gb|EFJ84697.1| putative inner membrane protein [Escherichia coli MS 84-1]
 gi|300406669|gb|EFJ90207.1| putative inner membrane protein [Escherichia coli MS 45-1]
 gi|300412980|gb|EFJ96290.1| putative inner membrane protein [Escherichia coli MS 115-1]
 gi|300420842|gb|EFK04153.1| putative inner membrane protein [Escherichia coli MS 182-1]
 gi|300453212|gb|EFK16832.1| putative inner membrane protein [Escherichia coli MS 116-1]
 gi|300462612|gb|EFK26105.1| putative inner membrane protein [Escherichia coli MS 187-1]
 gi|300524471|gb|EFK45540.1| putative inner membrane protein [Escherichia coli MS 119-7]
 gi|300531121|gb|EFK52183.1| putative inner membrane protein [Escherichia coli MS 107-1]
 gi|300837853|gb|EFK65613.1| putative inner membrane protein [Escherichia coli MS 124-1]
 gi|300845543|gb|EFK73303.1| putative inner membrane protein [Escherichia coli MS 78-1]
 gi|301075552|gb|EFK90358.1| putative inner membrane protein [Escherichia coli MS 146-1]
 gi|308118451|gb|EFO55713.1| putative inner membrane protein [Escherichia coli MS 145-7]
 gi|310336621|gb|EFQ01788.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|312287556|gb|EFR15463.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|315257772|gb|EFU37740.1| putative inner membrane protein [Escherichia coli MS 85-1]
 gi|315287189|gb|EFU46601.1| putative inner membrane protein [Escherichia coli MS 110-3]
 gi|315292594|gb|EFU51946.1| putative inner membrane protein [Escherichia coli MS 153-1]
 gi|315299283|gb|EFU58535.1| putative inner membrane protein [Escherichia coli MS 16-3]
 gi|320175207|gb|EFW50316.1| putative membrane protein [Shigella dysenteriae CDC 74-1112]
 gi|320178497|gb|EFW53462.1| Putative membrane protein [Shigella boydii ATCC 9905]
 gi|320196719|gb|EFW71342.1| Putative membrane protein [Escherichia coli WV_060327]
 gi|323159715|gb|EFZ45693.1| hypothetical protein ECE128010_4021 [Escherichia coli E128010]
 gi|323165703|gb|EFZ51489.1| hypothetical protein SS53G_3909 [Shigella sonnei 53G]
 gi|323185059|gb|EFZ70425.1| hypothetical protein ECOK1357_1515 [Escherichia coli 1357]
 gi|323190912|gb|EFZ76179.1| hypothetical protein ECRN5871_0760 [Escherichia coli RN587/1]
 gi|323967384|gb|EGB62805.1| inner membrane protein ybhL [Escherichia coli M863]
 gi|324009628|gb|EGB78847.1| putative inner membrane protein [Escherichia coli MS 57-2]
 gi|324011119|gb|EGB80338.1| putative inner membrane protein [Escherichia coli MS 60-1]
 gi|324018564|gb|EGB87783.1| putative inner membrane protein [Escherichia coli MS 117-3]
 gi|327253570|gb|EGE65199.1| hypothetical protein ECSTEC7V_0994 [Escherichia coli STEC_7v]
 gi|332097516|gb|EGJ02496.1| hypothetical protein SB359474_0793 [Shigella boydii 3594-74]
 gi|332759685|gb|EGJ89988.1| hypothetical protein SF434370_0977 [Shigella flexneri 4343-70]
 gi|333007143|gb|EGK26635.1| hypothetical protein SFK218_1112 [Shigella flexneri K-218]
 gi|333009772|gb|EGK29221.1| hypothetical protein SFK272_1134 [Shigella flexneri K-272]
          Length = 214

 Score =  112 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 89/232 (38%), Positives = 135/232 (58%), Gaps = 20/232 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M +VY  M +GL +T  +++     A  ++    + +   G+++                
Sbjct: 1   MAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII---------------- 44

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
             A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF +TA  
Sbjct: 45  --AQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTAGM 102

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  LT
Sbjct: 103 FGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVGLT 162

Query: 209 AYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 163 AYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 214


>gi|148228080|ref|NP_001088192.1| hypothetical protein LOC495017 [Xenopus laevis]
 gi|54035119|gb|AAH84105.1| LOC495017 protein [Xenopus laevis]
          Length = 342

 Score =  112 bits (279), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 90/234 (38%), Gaps = 21/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           RA++ +V+ ++   L VT     +   +         ++          F +L+  S   
Sbjct: 130 RAFIRKVFLVLTAQLLVTFAFVAVFTFVDEAKLFVRRNVWTYYLSYAIFFVSLITLSCCG 189

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      +   + +  +   +      Y + +++    IT
Sbjct: 190 NF-----------------HRRHPWNLVALSILTLSLSYMVGMIASFYDTDAVIMAIGIT 232

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A    ++ L+   TK D       +++    L + S++ +F+R+  + +  +++G ++F+
Sbjct: 233 ATVCFTVILFSMQTKYDFTSCMGVLLVSLIVLLIFSILCIFIRNKILQIVYASLGALLFT 292

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
              A DTQ I         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 293 CFLAVDTQMI----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILAIIGKAKE 342


>gi|219684171|ref|ZP_03539115.1| putative membrane protein [Borrelia garinii PBr]
 gi|219685108|ref|ZP_03539928.1| putative membrane protein [Borrelia garinii Far04]
 gi|219672160|gb|EED29213.1| putative membrane protein [Borrelia garinii PBr]
 gi|219673204|gb|EED30223.1| putative membrane protein [Borrelia garinii Far04]
          Length = 232

 Score =  112 bits (279), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 86/235 (36%), Positives = 140/235 (59%), Gaps = 19/235 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ I ++  +          ++ +    ++L  FG         
Sbjct: 15  NKFLAKVFGLMSIGLLISAIFAYATSENQAIKAIIFSNPMSFMAIILMQFG--------- 65

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                    +   ++  L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 66  ---------LVYAISGALNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS++IMG +G+ + SLVN+F RSS ++  +S +G++IF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYLIMGLWGIIIASLVNMFFRSSGLNFLISILGVIIFT 176

Query: 206 ALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +     + D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNIAKMDRMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|223889018|ref|ZP_03623609.1| putative membrane protein [Borrelia burgdorferi 64b]
 gi|223885834|gb|EEF56933.1| putative membrane protein [Borrelia burgdorferi 64b]
          Length = 232

 Score =  112 bits (279), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 87/235 (37%), Positives = 140/235 (59%), Gaps = 19/235 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ + ++  +   T      ++ +    ++L  FG         
Sbjct: 15  NKFLAKVFGLMSIGLLISAVFAYATSENQTIKAIIFSNSMSFMAMILIQFG--------- 65

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                    +   ++  L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 66  ---------LVYAISGALNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS++IMG +G+ + SLVN+F RSS ++   S +G+VIF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYLIMGLWGIIIASLVNMFFRSSGLNFLTSILGVVIFT 176

Query: 206 ALTAYDTQKIKEA-YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +     + D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNISKMDKMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|51245524|ref|YP_065408.1| hypothetical protein DP1672 [Desulfotalea psychrophila LSv54]
 gi|50876561|emb|CAG36401.1| conserved hypothetical membrane protein, probably cold-shock
           inducible [Desulfotalea psychrophila LSv54]
          Length = 240

 Score =  112 bits (279), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 95/235 (40%), Positives = 138/235 (58%), Gaps = 23/235 (9%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++ +V+N MALGLG+TG+++F                            A +  SPL  +
Sbjct: 26  FLAKVFNWMALGLGLTGLVAFFAAGSG--------------------ITAAIVASPLFMM 65

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
            I A LG+  FL+ R+  + A  A  +FL YS L GL+LS+ FL YTS SI  TFFITA 
Sbjct: 66  LIIAELGMVFFLSARIDKIQASTASGLFLGYSFLNGLTLSAIFLAYTSTSIAATFFITAG 125

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
            FG++++YG  TKRDL   GSF+ MG  G+ + S+VN+F++S+ +   +S +G+ IF+AL
Sbjct: 126 MFGAMAVYGLITKRDLSGFGSFLFMGLVGIIIASVVNIFLKSTGLYWVISLLGVFIFTAL 185

Query: 208 TAYDTQKIKEAYSDR---YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           TAYD QKIK               ++ +++GAL LY+DFI +F+ LLRF G  R+
Sbjct: 186 TAYDVQKIKTMGEKGILSQGEVAIKKGAIMGALTLYLDFINLFLMLLRFFGGSRN 240


>gi|322702601|gb|EFY94236.1| transmembrane BAX inhibitor motif-containing protein [Metarhizium
           anisopliae ARSEF 23]
          Length = 275

 Score =  111 bits (278), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 46/247 (18%), Positives = 88/247 (35%), Gaps = 30/247 (12%)

Query: 14  GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
           GS   +T+D     ++ +VY ++ + L VT  +S L                        
Sbjct: 57  GSVAEATVDIR-NQFVRKVYTILTVQLAVTAAVSGLTFFSDAYRTWIQ------------ 103

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
                   S    +++     +           S     +   L++     S+S     Y
Sbjct: 104 --------SHPGVVWVSLIGALVFMGLTYWKRKSYPTNLLFLSLFTLAEAYSISVIVSFY 155

Query: 134 TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL-SLVNLFMRSSAI 192
            +  ++    +TA  F  L+L+   TK D      ++    + L L   +   F  +S  
Sbjct: 156 KTSIVLNAVILTAGIFVFLTLFACQTKYDFTSWMPYLFGALWALVLFGFMAMFFPYNSTA 215

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           +L    +  +IFS     DTQ +   +    +        +  A+ LY+D I +F+ +LR
Sbjct: 216 ELIYGGVAALIFSGYILVDTQLVMRHHHVEEE--------IAAAISLYLDIINLFLAILR 267

Query: 253 FLGSRRD 259
            L S+ +
Sbjct: 268 ILNSQSN 274


>gi|226356647|ref|YP_002786387.1| hypothetical protein Deide_16610 [Deinococcus deserti VCD115]
 gi|226318637|gb|ACO46633.1| Conserved hypothetical protein; putative membrane protein
           [Deinococcus deserti VCD115]
          Length = 228

 Score =  111 bits (278), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 79/235 (33%), Positives = 124/235 (52%), Gaps = 21/235 (8%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           +R +M R Y+ MA GL +T  +++L     T                       M    L
Sbjct: 15  VRTFMARTYSWMAAGLALTAGVAYLTAQNETL---------------------AMQVMAL 53

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
           R   I A L +   L++    LS+  A M+F+ Y+AL GL+ S+    Y+  +++  F  
Sbjct: 54  RLPLILAQLALVFVLSMFAQRLSSAVAGMLFIGYAALTGLTFSALLFAYSPTAVITAFAT 113

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TA +FG +S+ G+  K+DL  +G F +    GL +  +VNLF+ SSA+ L +S +G+++F
Sbjct: 114 TAGTFGLMSVAGFVIKKDLSAMGRFFMFAVLGLIVAMIVNLFVASSALTLGISIVGVLVF 173

Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           + LTAYDTQ ++           AER ++ GAL LY+DFI +F+ +LR  G  RD
Sbjct: 174 AGLTAYDTQMLRNLALSGVTGEQAERAAINGALALYLDFINMFLFILRLFGGSRD 228


>gi|307564992|ref|ZP_07627509.1| putative membrane protein [Prevotella amnii CRIS 21A-A]
 gi|307346305|gb|EFN91625.1| putative membrane protein [Prevotella amnii CRIS 21A-A]
          Length = 239

 Score =  111 bits (278), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 83/251 (33%), Positives = 139/251 (55%), Gaps = 19/251 (7%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
               +       + + +   M +V+  M + L +TGI ++ ++                 
Sbjct: 7   STQTNTRERDLAMQKAMPVLMRKVFTWMTMALVITGITAYFLSTSPA------------- 53

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
                       +     I     +G+  +++ R++ LS  +A M F+L+S + G +L  
Sbjct: 54  -----MMQMFRTSRMPILICAIIEVGIVFYVSARINRLSLQSATMWFILFSIINGATLGW 108

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            F+ Y   SI +TF ITA +FG+++L GY TKRDL  +GS ++M   GL +  +VN+F++
Sbjct: 109 IFMAYNIASITKTFLITAGTFGAMALIGYATKRDLSRLGSILMMAVIGLIIAGVVNIFLK 168

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDV-AYAERQSVIGALMLYMDFIQIF 247
           SS +DL +SA G++IF+ LTA+DTQ IK+  S   DV   A++ ++IGAL LY+DF+ +F
Sbjct: 169 SSMMDLIVSAFGVLIFTGLTAWDTQNIKKQLSLVGDVNEQAQKVALIGALSLYLDFVNLF 228

Query: 248 VHLLRFLGSRR 258
           ++LLRFLG R+
Sbjct: 229 LYLLRFLGDRK 239


>gi|257457384|ref|ZP_05622555.1| inner membrane protein YbhL [Treponema vincentii ATCC 35580]
 gi|257445306|gb|EEV20378.1| inner membrane protein YbhL [Treponema vincentii ATCC 35580]
          Length = 239

 Score =  111 bits (278), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 85/252 (33%), Positives = 130/252 (51%), Gaps = 18/252 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
                          ++  + ++  VY  M   L ++GI +F V            S   
Sbjct: 6   MNNTSFDDISLQQANEKITQRFITAVYGWMVAALAISGIAAFAVFNSNALATFIFGSRFT 65

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++                  A   + + L+  +  +S  AA   F++YS + GL+L
Sbjct: 66  FMGLII------------------AEFALVVILSAGIRKMSFAAAAASFVIYSIINGLTL 107

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS   VYT  SIV+ F ITA  FG++S+YG TTK +L   G +++M   GL + SLVN+F
Sbjct: 108 SSVLFVYTGTSIVRIFVITALMFGAMSIYGATTKNNLQSAGKYLMMAVIGLIIASLVNIF 167

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           MRSS++D  +S + + +F+ LTAYDTQKI EA     +    ++ ++IGAL LY+DF+ I
Sbjct: 168 MRSSSLDWLISFVTVGVFTGLTAYDTQKITEAARYAQNNEGFKKVAIIGALELYLDFVNI 227

Query: 247 FVHLLRFLGSRR 258
           F+ LLR  G RR
Sbjct: 228 FLSLLRLFGKRR 239


>gi|259046638|ref|ZP_05737039.1| membrane protein [Granulicatella adiacens ATCC 49175]
 gi|259036803|gb|EEW38058.1| membrane protein [Granulicatella adiacens ATCC 49175]
          Length = 238

 Score =  111 bits (278), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 75/238 (31%), Positives = 116/238 (48%), Gaps = 13/238 (5%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
           +G   + ++VY  M  G+ ++ ++++L +            ++   G  + G   L    
Sbjct: 13  EGRNQFFMKVYGWMFGGIAISAVVAYLFSTTPALFSLFYNFMVKTHGYGMWGIFLLQLVL 72

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                  +  LG            +     +M+ LY+AL GL+  +   VY   SIVQ F
Sbjct: 73  VFLMRPDYEKLG------------NPIRYMVMYCLYAALTGLTFFTLTFVYDLGSIVQAF 120

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGL 201
             T A F  LS+ G+TTK+DL   G   +    GL + S +N  F RSS ++  MS + L
Sbjct: 121 ASTCALFVGLSVVGFTTKKDLTGWGQQALGALIGLIIASALNLFFFRSSMVEWIMSGISL 180

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +IF  LT YDTQK+K  Y      +  E  +++GAL LY+DFI IF+ +LR  GS +D
Sbjct: 181 IIFIILTIYDTQKLKRMYDYFEGQSALEGIAILGALELYLDFINIFLDILRLFGSGKD 238


>gi|229496385|ref|ZP_04390102.1| inner membrane protein YbhL [Porphyromonas endodontalis ATCC 35406]
 gi|229316704|gb|EEN82620.1| inner membrane protein YbhL [Porphyromonas endodontalis ATCC 35406]
          Length = 248

 Score =  111 bits (278), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 82/255 (32%), Positives = 129/255 (50%), Gaps = 21/255 (8%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y+  V S +         +     +V+  MA  LG+T + +FLV                
Sbjct: 11  YREDVVSQAPEVIVETADVAKLFTKVFYWMAGALGLTALTAFLVYSSE------------ 58

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                 +    ++    L W    A LG+ + L+  +H +S   A +M  +YS L G++L
Sbjct: 59  ------SMMMTILMNRWLMWGLFIAELGLVMGLSAAIHKVSFSTAVLMMAVYSVLNGVTL 112

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           S  FLVYT  SI   F I+A  F  +++ G  TKRDL    S ++M   GL + S+VNLF
Sbjct: 113 SVIFLVYTYSSIAMAFVISAGMFAVMAIVGTVTKRDLSSWRSILLMALVGLIIASVVNLF 172

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYD---VAYAERQSVIGALMLYMDF 243
           + SS ++  +S +G+V+F+ LT YDTQKI+    ++          + +++G+L LY+DF
Sbjct: 173 LHSSTMEWIISLVGVVLFAILTVYDTQKIRRLLIEKNGLVSEEGMHKIALLGSLELYLDF 232

Query: 244 IQIFVHLLRFLGSRR 258
           I IF+ +LR LG  R
Sbjct: 233 INIFLFVLRLLGGNR 247


>gi|74005723|ref|XP_853016.1| PREDICTED: similar to RECS1 protein homolog [Canis familiaris]
          Length = 289

 Score =  111 bits (278), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 45/256 (17%), Positives = 97/256 (37%), Gaps = 26/256 (10%)

Query: 8   QRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           +R V+   G G   D+ +R  ++ +VY+++++ L +T  +  +   +    D    ++ +
Sbjct: 55  ERAVSESFGPGEWDDRKVRHTFIRKVYSIISIQLLITVAIIAIFTFVKPVGDFVRRNLFV 114

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                                              +          ++  L++  +G   
Sbjct: 115 YYVSYAVFLAT-----------------YLTLACCQGPRRRFPWNIILLTLFTLAMGFMT 157

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
            +   VY +K+++    ITA    S++++ + TK D         +    L +  +V   
Sbjct: 158 GTISSVYETKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLMVTGIVTAI 217

Query: 187 MRS----SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           + S      + +  +A+G + F+   AYDTQ +            +    + GAL +Y D
Sbjct: 218 VLSFKYIYWLHMVYAALGAICFTLFLAYDTQLV----LGNRKHTISPEDYITGALQIYTD 273

Query: 243 FIQIFVHLLRFLGSRR 258
            I IF  +L+ +G R 
Sbjct: 274 IIYIFTFVLQLVGDRN 289


>gi|15594884|ref|NP_212673.1| hypothetical protein BB0539 [Borrelia burgdorferi B31]
 gi|195941673|ref|ZP_03087055.1| hypothetical protein Bbur8_02171 [Borrelia burgdorferi 80a]
 gi|216264211|ref|ZP_03436203.1| putative membrane protein [Borrelia burgdorferi 156a]
 gi|218249285|ref|YP_002375045.1| hypothetical protein BbuZS7_0549 [Borrelia burgdorferi ZS7]
 gi|225548731|ref|ZP_03769778.1| putative membrane protein [Borrelia burgdorferi 94a]
 gi|225552130|ref|ZP_03773070.1| putative membrane protein [Borrelia sp. SV1]
 gi|226321845|ref|ZP_03797371.1| putative membrane protein [Borrelia burgdorferi Bol26]
 gi|15214340|sp|O51489|Y539_BORBU RecName: Full=Uncharacterized protein BB_0539
 gi|2688450|gb|AAC66898.1| conserved hypothetical integral membrane protein [Borrelia
           burgdorferi B31]
 gi|215980684|gb|EEC21491.1| putative membrane protein [Borrelia burgdorferi 156a]
 gi|218164473|gb|ACK74534.1| putative membrane protein [Borrelia burgdorferi ZS7]
 gi|225370761|gb|EEH00197.1| putative membrane protein [Borrelia burgdorferi 94a]
 gi|225371128|gb|EEH00558.1| putative membrane protein [Borrelia sp. SV1]
 gi|226233034|gb|EEH31787.1| putative membrane protein [Borrelia burgdorferi Bol26]
 gi|312148125|gb|ADQ30784.1| membrane protein, putative [Borrelia burgdorferi JD1]
 gi|312149727|gb|ADQ29798.1| membrane protein, putative [Borrelia burgdorferi N40]
          Length = 232

 Score =  111 bits (277), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 87/235 (37%), Positives = 141/235 (60%), Gaps = 19/235 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ + ++  +   T      ++ +    ++L  FG         
Sbjct: 15  NKFLAKVFGLMSIGLLISAVFAYATSENQTIKAIIFSNSMSFMAMILIQFG--------- 65

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                    +   ++  L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 66  ---------LVYAISGALNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS++IMG +G+ + SLVN+F RSS ++  +S +G+VIF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYLIMGLWGIIIASLVNMFFRSSGLNFLISILGVVIFT 176

Query: 206 ALTAYDTQKIKEA-YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +     + D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNISKMDKMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|332091045|gb|EGI96135.1| hypothetical protein SD15574_2523 [Shigella dysenteriae 155-74]
          Length = 214

 Score =  111 bits (277), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 88/232 (37%), Positives = 134/232 (57%), Gaps = 20/232 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M +VY  M +GL +T  +++     A  ++    + +   G+++                
Sbjct: 1   MAQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII---------------- 44

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
             A L + I L+  +  LSA    M+F+LYS L GL+LSS F+VYT+ SI  TF +TA  
Sbjct: 45  --AQLALVIVLSAMIQKLSAGVTTMLFMLYSVLTGLTLSSIFIVYTAASIASTFVVTAGM 102

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  LT
Sbjct: 103 FGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVGLT 162

Query: 209 AYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 163 AYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 214


>gi|224533558|ref|ZP_03674147.1| putative membrane protein [Borrelia burgdorferi CA-11.2a]
 gi|224513231|gb|EEF83593.1| putative membrane protein [Borrelia burgdorferi CA-11.2a]
          Length = 232

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 86/235 (36%), Positives = 141/235 (60%), Gaps = 19/235 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ + ++  +   T      ++ +    ++L  FG         
Sbjct: 15  NKFLAKVFGLMSIGLLISAVFAYATSENQTIKAIIFSNSMSFMAMILIQFG--------- 65

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                    +   ++  L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 66  ---------LVYAISGTLNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS++IMG +G+ + SLVN+F RSS ++  +S +G++IF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYLIMGLWGIIIASLVNMFFRSSGLNFLISILGVIIFT 176

Query: 206 ALTAYDTQKIKEA-YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +     + D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNISKMDKMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|51598790|ref|YP_072978.1| hypothetical protein BG0549 [Borrelia garinii PBi]
 gi|51573361|gb|AAU07386.1| conserved hypothetical integral membrane protein [Borrelia garinii
           PBi]
          Length = 232

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 84/235 (35%), Positives = 139/235 (59%), Gaps = 19/235 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ I ++  +          ++ +    ++L  FG         
Sbjct: 15  NKFLAKVFGLMSIGLLISAIFAYATSENQAIKAIIFSNPMSFMAIILIQFG--------- 65

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                    +   ++  L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 66  ---------LVYAISGALNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS++IM  +G+ + SLVN+F R+S ++  +S +G++IF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYLIMSLWGIIIASLVNMFFRNSGLNFLISILGVIIFT 176

Query: 206 ALTAYDTQKIKEA-YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +     + D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNIAKMDKMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|116194003|ref|XP_001222814.1| hypothetical protein CHGG_06719 [Chaetomium globosum CBS 148.51]
 gi|88182632|gb|EAQ90100.1| hypothetical protein CHGG_06719 [Chaetomium globosum CBS 148.51]
          Length = 276

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/255 (16%), Positives = 91/255 (35%), Gaps = 29/255 (11%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N       G        +    ++ +VY ++ + L  TG +S L  +  +          
Sbjct: 49  NVPDDFKFGGSVAEATVEIRNQFIRKVYTILTVQLIATGAVSALSFMSDSYKSWIQ---- 104

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                           S    +++     +   +       S     +    ++ L   +
Sbjct: 105 ----------------SHPAIVWVSLFGSMACMMLTYWKRHSYPTNLLFLSAFTLLEAYT 148

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           +S     Y++  ++   F+TA  F  L+ +   TK D      ++    +GL +   ++ 
Sbjct: 149 ISVIVSFYSASIVLNAVFLTAGIFLFLTAFACQTKYDFTSWMPYLFGALWGLVIFGFMSF 208

Query: 186 F-MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
           F   +S  +L    +  +IFS     DTQ +   +    +        +  A+ LY+D I
Sbjct: 209 FLPHTSTTELVYGLLTALIFSGYVLVDTQLVLRKHHVEEE--------IAAAISLYLDII 260

Query: 245 QIFVHLLRFLGSRRD 259
            +F+ +LR L S+ +
Sbjct: 261 NLFLAILRILNSQSN 275


>gi|312222489|emb|CBY02429.1| similar to transmembrane BAX inhibitor motif-containing protein 4
           [Leptosphaeria maculans]
          Length = 280

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 93/234 (39%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY ++ + L  T  +SF+    AT       +  +   + ++  G  ++     W
Sbjct: 73  AFIRKVYAILTVQLLATAAVSFVAMTSATFKHWIQTNEWM---MWVSMLGTFVFLGLTFW 129

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S     +    ++A+    +S       SK +++    T 
Sbjct: 130 KRK-----------------SYPTNLLFLAGFTAMEAYCVSLIVSFTDSKIVLEAVIFTL 172

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFS 205
             F +LSL+   TK D      ++    + + L   +N  F  +S ++L    +  +IFS
Sbjct: 173 GIFVALSLFACQTKYDFSAWQPYLFGMIWVVILFGFMNAFFPYNSKVELGYGIVCALIFS 232

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
               +DTQ I   Y    +        +  A+ LY+D + +F+ +LR L S+++
Sbjct: 233 GYILFDTQMIMRHYHVEEE--------IAAAISLYLDILNLFLAILRILNSQQN 278


>gi|71895843|ref|NP_001025668.1| transmembrane BAX inhibitor motif containing 1 [Xenopus (Silurana)
           tropicalis]
 gi|62201902|gb|AAH92551.1| MGC107973 protein [Xenopus (Silurana) tropicalis]
          Length = 347

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 52/257 (20%), Positives = 107/257 (41%), Gaps = 28/257 (10%)

Query: 7   YQRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASI 64
           Y      G  FGS  D+ +R A++ RVY ++A+ L +T GI++    +   T      S 
Sbjct: 112 YNTNDGEGGNFGSWDDKAVRHAFIRRVYAIIAVQLLLTVGIIAIFTYVEPVT------SF 165

Query: 65  IINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGL 124
           I     +     A+ + + +  +    P                    ++  +++  +  
Sbjct: 166 IRRTPGVYYASYAVFFVTYIVLVCCEGP------------RRRFPWNIILLAIFTLAMAF 213

Query: 125 SLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLL 180
              +    Y+SK+++ +  ITA     ++++ + TK D         +    +     + 
Sbjct: 214 MAGTIASFYSSKAVLISMGITAIVTIIVTIFCFQTKVDFTSCAGLFAVLGIVMFVTGIVT 273

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           ++V  F     + +  +A+G ++F+   A+DTQ +               + V GAL +Y
Sbjct: 274 AIVLAFKYVYWLHMLYAALGAIVFTLFLAFDTQLVI----GNRKHTINPEEYVYGALKIY 329

Query: 241 MDFIQIFVHLLRFLGSR 257
            D + IF++LL+ +GSR
Sbjct: 330 TDIVYIFLNLLQIIGSR 346


>gi|322697737|gb|EFY89513.1| transmembrane BAX inhibitor motif-containing protein [Metarhizium
           acridum CQMa 102]
          Length = 275

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/247 (18%), Positives = 87/247 (35%), Gaps = 30/247 (12%)

Query: 14  GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
           GS   +T+D     ++ +VY ++ + L  T  +S L                        
Sbjct: 57  GSVAEATVDIR-NQFVRKVYTILTVQLAATAAVSALTFFSDAYRTWIQ------------ 103

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
                   S    +++     +           S     +   L++     S+S     Y
Sbjct: 104 --------SHPGVVWVSLIGALVFMGLTYWKRKSYPTNLLFLSLFTLAEAYSISVIVSFY 155

Query: 134 TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL-SLVNLFMRSSAI 192
            +  ++    +TA  F  L+L+   TK D      ++    + L L   +   F  +S  
Sbjct: 156 KTSIVLNAVILTAGIFVFLTLFACQTKYDFTSWMPYLFGALWALVLFGFMAMFFPYNSTA 215

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           +L    +  +IFS     DTQ +   +    +        +  A+ LY+D I +F+ +LR
Sbjct: 216 ELIYGGVAALIFSGYILVDTQLVMRHHHVEEE--------IAAAISLYLDIINLFLAILR 267

Query: 253 FLGSRRD 259
            L S+ +
Sbjct: 268 ILNSQSN 274


>gi|216263386|ref|ZP_03435381.1| putative membrane protein [Borrelia afzelii ACA-1]
 gi|215980230|gb|EEC21051.1| putative membrane protein [Borrelia afzelii ACA-1]
          Length = 232

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 88/235 (37%), Positives = 141/235 (60%), Gaps = 19/235 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ + ++  +   T      ++ +    ++L  FG         
Sbjct: 15  NKFLAKVFGLMSIGLLISAMFAYATSENQTIKAIIFSNSMSFMTLILIQFG--------- 65

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                    +   +   L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 66  ---------LVYAIGGALNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS++IMG +G+ + SLVN+F RSS ++L +S +G+VIF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYLIMGLWGIIIASLVNMFFRSSGLNLLISILGVVIFT 176

Query: 206 ALTAYDTQKIKEA-YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +     + D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNISKMDKMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|221218123|ref|ZP_03589589.1| putative membrane protein [Borrelia burgdorferi 72a]
 gi|224532707|ref|ZP_03673324.1| putative membrane protein [Borrelia burgdorferi WI91-23]
 gi|225549638|ref|ZP_03770604.1| putative membrane protein [Borrelia burgdorferi 118a]
 gi|226320961|ref|ZP_03796508.1| putative membrane protein [Borrelia burgdorferi 29805]
 gi|221192071|gb|EEE18292.1| putative membrane protein [Borrelia burgdorferi 72a]
 gi|224512325|gb|EEF82709.1| putative membrane protein [Borrelia burgdorferi WI91-23]
 gi|225369915|gb|EEG99362.1| putative membrane protein [Borrelia burgdorferi 118a]
 gi|226233634|gb|EEH32368.1| putative membrane protein [Borrelia burgdorferi 29805]
          Length = 232

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 86/235 (36%), Positives = 141/235 (60%), Gaps = 19/235 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ + ++  +   T      ++ +    ++L  FG         
Sbjct: 15  NKFLAKVFGLMSIGLLISAVFAYATSENQTIKAIIFSNSMSFMAMILIQFG--------- 65

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                    +   ++  L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 66  ---------LVYAISGALNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS++IMG +G+ + SLVN+F RSS ++  +S +G++IF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYLIMGLWGIIIASLVNMFFRSSGLNFLISILGVIIFT 176

Query: 206 ALTAYDTQKIKEA-YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +     + D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNISKMDKMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|332865635|ref|XP_003318563.1| PREDICTED: glutamate [NMDA] receptor-associated protein 1-like [Pan
           troglodytes]
          Length = 338

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/233 (18%), Positives = 91/233 (39%), Gaps = 20/233 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           RA++I+V+ L+++ L +T +++ +             +      +    F  L+      
Sbjct: 126 RAFIIKVFFLLSVQLLLTAVITSVFIFWEALKVWVLKNPWFISAIFSAFFAILIILDCCG 185

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +                      A  ++   ++AL GL L +  + Y ++ ++     T
Sbjct: 186 NLR-----------------RQVPAEYILLGFFTALQGLLLGAVSVFYKAEEVLWATAAT 228

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
                +L+L+   TK D   +   + +  F L +  +  +F+RS  + L  + +G V+FS
Sbjct: 229 TLVTLALTLFALQTKWDFTWLNGALFVFCFVLLIYGITLIFVRSYWLHLLYAGLGTVLFS 288

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
                D Q            +      V   L +++D I +F+ +LR +G  R
Sbjct: 289 LYLVIDVQL---MLGGHRHYSLDPEGYVFAVLNIHLDIIDLFIFILRLIGRGR 338


>gi|291085664|ref|ZP_06353660.2| putative membrane protein [Citrobacter youngae ATCC 29220]
 gi|291070591|gb|EFE08700.1| putative membrane protein [Citrobacter youngae ATCC 29220]
          Length = 214

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 84/232 (36%), Positives = 130/232 (56%), Gaps = 20/232 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M +VY  M  GL +T  +++     +  ++    + I   G+++                
Sbjct: 1   MAQVYGWMTCGLLLTAFIAWYAANSSAFMELLYTNRIFFFGLVI---------------- 44

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
             A L +   L+  +H LSA     +F+LYS L GL+LSS F++YT+ SI  TF +T   
Sbjct: 45  --AQLALVFVLSGMIHKLSAGVTTTLFMLYSVLTGLTLSSIFIIYTASSIASTFVVTGGM 102

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG +SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  LT
Sbjct: 103 FGIMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVGLT 162

Query: 209 AYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K         D +   + +++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 163 AYDTQKLKNIGEQIDLRDSSNLRKYAILGALTLYLDFINLFLMLLRIFGNRR 214


>gi|6273281|gb|AAF06327.1|AF190461_1 lifeguard [Homo sapiens]
          Length = 316

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/265 (15%), Positives = 90/265 (33%), Gaps = 34/265 (12%)

Query: 6   NYQRVVNSGSGFGSTIDQGL-----RAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDP 59
           +Y       +   S +  G+     R ++ +VY ++ + L VT  +++            
Sbjct: 75  SYDNGFPPETMSSSPLSAGMTKKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDP----- 129

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPL-GVFIFLNVRLHSLSAYAAKMMFLLY 118
                           G         W                           ++  ++
Sbjct: 130 --------------CQGLCSGQPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVF 175

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
           +  +          Y + S++    ITA    S++++ + TK D       + +    LF
Sbjct: 176 TLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLF 235

Query: 179 ----LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVI 234
               +L+++  F     +    +A+G  +F+   A DTQ +          + +  + + 
Sbjct: 236 FSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLM----GNRRHSLSPEEYIF 291

Query: 235 GALMLYMDFIQIFVHLLRFLGSRRD 259
           GAL +Y+D I IF   L+  G+ R+
Sbjct: 292 GALNIYLDIIYIFTFFLQLFGTNRE 316


>gi|332089004|gb|EGI94116.1| hypothetical protein SB521682_2588 [Shigella boydii 5216-82]
          Length = 214

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 90/232 (38%), Positives = 137/232 (59%), Gaps = 20/232 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M++VY  M +GL +T  +++     A  ++    + +   G+++                
Sbjct: 1   MVQVYGWMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII---------------- 44

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
             A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF +TA  
Sbjct: 45  --AQLALVIVLSAMIKKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTAGM 102

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  LT
Sbjct: 103 FGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVGLT 162

Query: 209 AYDTQKIKEA--YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K      D  D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 163 AYDTQKLKNMSEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 214


>gi|313886339|ref|ZP_07820064.1| putative membrane protein [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|312924208|gb|EFR34992.1| putative membrane protein [Porphyromonas asaccharolytica
           PR426713P-I]
          Length = 242

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 85/231 (36%), Positives = 128/231 (55%), Gaps = 22/231 (9%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M + +  MA+ L +T + +  V                            + +S   W+ 
Sbjct: 30  MRKTFGWMAMCLLITALTAMGVVNSG--------------------LFYQIASSGAMWLL 69

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A L +   L+ R++ +S   A +M ++YSAL G +LS  FL Y+  SI +TFFIT   
Sbjct: 70  IIAELVLVFVLSARINKMSVTTATIMLIVYSALNGATLSFIFLAYSLGSIAKTFFITTGM 129

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG ++L G TTKRDL  +GS ++M   GL + SLVN+F+RSS +D  +S +G+V+F+ALT
Sbjct: 130 FGVMALVGATTKRDLSKMGSILLMALIGLIIASLVNIFLRSSGLDWIISLIGVVLFTALT 189

Query: 209 AYDTQKIKEAYSDRYDVAYA--ERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           AYD Q++K   ++          R +VI AL LY+DFI +F++LLRF G  
Sbjct: 190 AYDVQRVKRLATESDLYDDTQVGRLAVISALSLYLDFINLFLYLLRFFGRN 240


>gi|296103287|ref|YP_003613433.1| hypothetical protein ECL_02948 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295057746|gb|ADF62484.1| hypothetical protein ECL_02948 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 214

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 92/232 (39%), Positives = 133/232 (57%), Gaps = 20/232 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M +VY  M +GL +T  +++        +    +S I   G+++                
Sbjct: 1   MAQVYGWMTVGLLLTAFIAWYAANTPELMMFIFSSKITFFGLII---------------- 44

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
             A L +   L+  +  LSA  A  +F+LYSAL GL+LSS F+VYT  SI  TF +T   
Sbjct: 45  --AQLALVFVLSGLVQKLSAGMATTLFMLYSALTGLTLSSIFIVYTYSSIASTFVVTGGM 102

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG +SLYGYTTKRDL  +G+ + MG  G+ L SLVNL+++S A+   ++ +G+VIF  LT
Sbjct: 103 FGVMSLYGYTTKRDLSGLGNMLFMGLIGIVLASLVNLWLKSDALMWAVTYIGVVIFVGLT 162

Query: 209 AYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 163 AYDTQKLKNIGEQIDVRDSSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 214


>gi|156058608|ref|XP_001595227.1| hypothetical protein SS1G_03316 [Sclerotinia sclerotiorum 1980]
 gi|154701103|gb|EDO00842.1| hypothetical protein SS1G_03316 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 279

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/255 (19%), Positives = 97/255 (38%), Gaps = 29/255 (11%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N       G        +    ++ +VY ++++ L  T  +S +     +      ++  
Sbjct: 52  NIPDDFKFGGSVAEATIEIRMQFVRKVYAILSVQLIATAALSSVSFFSQSYKTWIQSNTW 111

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           +    M    G ++ T                         S     +    ++AL   +
Sbjct: 112 LLWTSMFGAIGFMLLTYWK--------------------RKSYPTNLLFLGGFTALEAYT 151

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL-SLVN 184
           +S     + S+ ++Q   +TA  F +L+L+   TK D      ++  G + L L   +  
Sbjct: 152 ISVIVSTFDSRIVLQAVLLTAGIFVALTLFACQTKYDFTSWMPYLFGGLWALILFGFMAM 211

Query: 185 LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
            F  +S ++L  S +  VIFS     DTQ I   Y    +        +  A+ LY+D I
Sbjct: 212 FFPGNSTVELIYSGITAVIFSGYILVDTQLIMRHYHVEEE--------IAAAISLYLDII 263

Query: 245 QIFVHLLRFLGSRRD 259
            +F+ +LR L S+++
Sbjct: 264 NLFLAILRILNSQQN 278


>gi|293397175|ref|ZP_06641449.1| integral membrane protein [Serratia odorifera DSM 4582]
 gi|291420646|gb|EFE93901.1| integral membrane protein [Serratia odorifera DSM 4582]
          Length = 214

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 88/232 (37%), Positives = 132/232 (56%), Gaps = 20/232 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M +VY  M  GL +T  +S+        ++   +S I   G+++                
Sbjct: 1   MAQVYGWMTCGLLLTAFVSWYAANTPAILNFIFSSQITFFGLII---------------- 44

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
             A L +   ++  ++ LS   A  +F+LYSAL GL+LSS F+VYT  SI  TF +TA  
Sbjct: 45  --AQLALVFVISGMVNRLSGAVATSLFMLYSALTGLTLSSIFIVYTYSSIASTFVVTAGM 102

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S+A+   ++ +G+V+F  LT
Sbjct: 103 FGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSTALMWAITYIGVVVFVGLT 162

Query: 209 AYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K         D     + +++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 163 AYDTQKLKAMGEQLNPDDKDGFRKYAIVGALTLYLDFINLFLMLLRIFGNRR 214


>gi|301024510|ref|ZP_07188186.1| putative inner membrane protein [Escherichia coli MS 196-1]
 gi|299880363|gb|EFI88574.1| putative inner membrane protein [Escherichia coli MS 196-1]
          Length = 214

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 89/232 (38%), Positives = 135/232 (58%), Gaps = 20/232 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M +VY  M +GL +T  +++     A  ++    + +   G+++                
Sbjct: 1   MAQVYGRMTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII---------------- 44

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
             A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF +TA  
Sbjct: 45  --AQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTAGM 102

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  LT
Sbjct: 103 FGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVGLT 162

Query: 209 AYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 163 AYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 214


>gi|327260344|ref|XP_003214994.1| PREDICTED: transmembrane BAX inhibitor motif-containing protein
           1-like [Anolis carolinensis]
          Length = 328

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/235 (18%), Positives = 98/235 (41%), Gaps = 25/235 (10%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY ++++ L +T  +  + +     VDP ++ +  N  V  T +G  + T     
Sbjct: 114 TFIRKVYAIISVQLIITVAIIAVFS----FVDPVSSFVRRNVAVYYTSYGVFLVT----- 164

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                     + +             ++  +++  +G    +   +Y++K+++    ITA
Sbjct: 165 --------YLVLVCCEGPRRRFPWNLILLFIFTLAMGFMTGTIASMYSTKAVLIAMLITA 216

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSLVNLFMRSSAIDLTMSAMGLV 202
                ++++ + TK D         +    +     + ++V  F     + +  +A+G +
Sbjct: 217 IVATIVTIFCFQTKVDFTSCAGLFCVLGIVVMVTGIITAIVLSFKYVPWLHMLYAAIGAI 276

Query: 203 IFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            F+   AYDTQ +            +  + V GAL +Y D + IF  LL+ +GSR
Sbjct: 277 AFTLFLAYDTQLV----LGNRKHTISPEEYVYGALKIYTDIVYIFTFLLQIVGSR 327


>gi|111115365|ref|YP_709983.1| hypothetical protein BAPKO_0567 [Borrelia afzelii PKo]
 gi|110890639|gb|ABH01807.1| hypothetical protein BAPKO_0567 [Borrelia afzelii PKo]
          Length = 232

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 87/235 (37%), Positives = 140/235 (59%), Gaps = 19/235 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ + ++  +   T      ++ +    ++L  FG         
Sbjct: 15  NKFLAKVFGLMSIGLLISAMFAYATSENQTIKAIIFSNSMSFMTLILIQFG--------- 65

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                    +   +   L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 66  ---------LVYAIGGALNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS++IMG +G+ + SLVN+F RSS ++  +S +G+VIF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYLIMGLWGIIIASLVNMFFRSSGLNFLISILGVVIFT 176

Query: 206 ALTAYDTQKIKEA-YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +     + D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNISKMDKMLQDDTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|332300273|ref|YP_004442194.1| protein of unknown function UPF0005 [Porphyromonas asaccharolytica
           DSM 20707]
 gi|332177336|gb|AEE13026.1| protein of unknown function UPF0005 [Porphyromonas asaccharolytica
           DSM 20707]
          Length = 241

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 85/231 (36%), Positives = 128/231 (55%), Gaps = 22/231 (9%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M + +  MA+ L +T + +  V                            + +S   W+ 
Sbjct: 30  MRKTFGWMAMCLLITALTAMGVVNSG--------------------LFYQIASSGAMWLL 69

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A L +   L+ R++ +S   A +M ++YSAL G +LS  FL Y+  SI +TFFIT   
Sbjct: 70  IIAELVLVFVLSARINKMSVTTATIMLIVYSALNGATLSFIFLAYSLGSIAKTFFITTGM 129

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG ++L G TTKRDL  +GS ++M   GL + SLVN+F+RSS +D  +S +G+V+F+ALT
Sbjct: 130 FGVMALVGATTKRDLSKMGSILLMALIGLIIASLVNIFLRSSGLDWIISLIGVVLFTALT 189

Query: 209 AYDTQKIKEAYSDRYDVAYA--ERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           AYD Q++K   ++          R +VI AL LY+DFI +F++LLRF G  
Sbjct: 190 AYDVQRVKRLATESDLYDDTQVGRLAVISALSLYLDFINLFLYLLRFFGRN 240


>gi|195123947|ref|XP_002006463.1| GI21061 [Drosophila mojavensis]
 gi|193911531|gb|EDW10398.1| GI21061 [Drosophila mojavensis]
          Length = 324

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/253 (17%), Positives = 91/253 (35%), Gaps = 20/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y         F        R ++ +VY ++   L VT     L    + T    A +  +
Sbjct: 92  YDDPEGQPKNFSFDDQSIRRGFIRKVYIILMGQLLVTFGAVALFVFHSGTRMFVARNQWL 151

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
               +      ++  +    +                         +   +++      L
Sbjct: 152 FWVALAVLIVTMLCMACCESVR-----------------RQTPTNFIFLGIFTVAQSFLL 194

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                 Y    ++    ITAA   +L+L+   TK D   +G  ++       +  +V +F
Sbjct: 195 GVSASRYGPTEVLMAVGITAAVCLALTLFAMQTKVDFTMMGGILLACMVVFMIFGIVAIF 254

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
            +   I L  ++ G ++FS    YDTQ +       +  + +  + +  AL LY+D + I
Sbjct: 255 FKGKIITLVYASFGALLFSIYLIYDTQLMM---GGDHKYSISPEEYIFAALNLYLDVVNI 311

Query: 247 FVHLLRFLGSRRD 259
           F+++L  +G+ RD
Sbjct: 312 FIYILTIIGASRD 324


>gi|228470189|ref|ZP_04055096.1| membrane protein [Porphyromonas uenonis 60-3]
 gi|228308140|gb|EEK17003.1| membrane protein [Porphyromonas uenonis 60-3]
          Length = 240

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 85/251 (33%), Positives = 134/251 (53%), Gaps = 22/251 (8%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
               +  G    +   +   M + +  MA+ L +T + +                     
Sbjct: 10  SNDTASEGQTYMVAPLVSTVMRKTFGWMAMCLLITALTAMGFVNSG-------------- 55

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
                     + +S   W+ I A L +   L+ R++ +S   A +M ++YSAL G++LS 
Sbjct: 56  ------LFYHIASSGAMWLLIIAELVLVFVLSARINKMSVATATIMLIVYSALNGVTLSF 109

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            F+VY+  SI +TFFIT   FG ++L G TTKRDL  +GS + M   GL + SLVN+F+R
Sbjct: 110 IFVVYSLGSIAKTFFITTGMFGVMALVGATTKRDLSKLGSILFMALIGLIIASLVNIFLR 169

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYA--ERQSVIGALMLYMDFIQI 246
           SS +D  +S +G+V+F+ALTAYD Q++K+  ++          R +VI AL LY+DFI +
Sbjct: 170 SSGLDWIISLIGVVLFTALTAYDVQRVKQLAAESDLYDDTQVGRLAVISALSLYLDFINL 229

Query: 247 FVHLLRFLGSR 257
           F++LLRF G +
Sbjct: 230 FLYLLRFFGRK 240


>gi|332188342|ref|ZP_08390068.1| uncharacterized UPF0005 family protein [Sphingomonas sp. S17]
 gi|332011655|gb|EGI53734.1| uncharacterized UPF0005 family protein [Sphingomonas sp. S17]
          Length = 213

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 81/229 (35%), Positives = 133/229 (58%), Gaps = 19/229 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M+ +Y  MALGL +TG+++ LV        P                   ++ +PL+W+ 
Sbjct: 1   MLGIYRTMALGLVLTGLVASLVASTPALYQP-------------------IFNTPLKWVV 41

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           + APL   +F + R+  +SA  A++ F  ++A++GLSL+S FLV+T  SI   FF  AA 
Sbjct: 42  MLAPLAFVLFFSFRVEQMSANTARIAFYSFAAIMGLSLASVFLVFTGTSIALAFFSAAAL 101

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           F ++ L+GYTT  DL    +F+++G  G+ + SL+NLF+ S  +   +S +G+++F+ LT
Sbjct: 102 FATMCLWGYTTNVDLSRWSTFLMVGLVGVIIASLINLFLASDTLQFAVSIIGVLVFTGLT 161

Query: 209 AYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           A+D+Q++K  Y         E+ +V+GAL LY+D I +F  LL  +G R
Sbjct: 162 AWDSQRLKSQYFAYAGTESGEKLAVMGALSLYLDLINLFQLLLNLIGER 210


>gi|283852305|ref|ZP_06369576.1| protein of unknown function UPF0005 [Desulfovibrio sp. FW1012B]
 gi|283572262|gb|EFC20251.1| protein of unknown function UPF0005 [Desulfovibrio sp. FW1012B]
          Length = 237

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 86/240 (35%), Positives = 133/240 (55%), Gaps = 21/240 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
           + + A+M  VY  M LGL +T   S         +     + I+  G+++  FG ++  S
Sbjct: 16  EVVNAFMRGVYGWMCLGLLLTAGASAFTVSSPAMMQAVFGNQILFFGLIIAEFGLVIGIS 75

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                               ++ LSA AA  +FLLYSAL G++L++ F VY   +I   F
Sbjct: 76  ------------------AAINRLSAGAASGLFLLYSALNGITLAAIFAVYAKAAIFNAF 117

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
           F+T   FG++SLYG  TK+DL   GSF+ MG  G+ + S++N+F +S+ +D  +S +G++
Sbjct: 118 FVTGGMFGAMSLYGLLTKKDLTSFGSFLFMGLVGIVIASVINIFTKSAMMDFIISCVGVL 177

Query: 203 IFSALTAYDTQKIKEA--YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL-GSRRD 259
           +F  LTAYDTQK+K     +   D     R +++GAL LY+DFI +F+ +LR   GS RD
Sbjct: 178 VFLGLTAYDTQKLKVMGEMAPADDATAVRRGTILGALTLYLDFINLFLMMLRLFSGSNRD 237


>gi|224531786|ref|ZP_03672418.1| putative membrane protein [Borrelia valaisiana VS116]
 gi|224511251|gb|EEF81657.1| putative membrane protein [Borrelia valaisiana VS116]
          Length = 232

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 87/235 (37%), Positives = 141/235 (60%), Gaps = 19/235 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ + ++  +   T      ++ +    ++L  FG         
Sbjct: 15  NKFLAKVFGLMSIGLLISAMFAYATSENQTIKAIIFSNPMSFMTIILIQFG--------- 65

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                    +   ++  L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 66  ---------LVYAISGALNKISSNTAIALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS+MIMG +G+ + SLVN+F RSS ++  +S +G++IF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYMIMGLWGIIIASLVNMFFRSSGLNFLISILGVIIFT 176

Query: 206 ALTAYDTQKIKEA-YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +     + D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNIAKMDKMLQDDTEVKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|189439135|ref|YP_001954216.1| membrane protein [Bifidobacterium longum DJO10A]
 gi|189427570|gb|ACD97718.1| Integral membrane protein [Bifidobacterium longum DJO10A]
          Length = 297

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 61/239 (25%), Positives = 123/239 (51%), Gaps = 19/239 (7%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
            ++  R  + +VY  M +G+ VT +++ L  I         A+ ++              
Sbjct: 75  YEEARRVSVTKVYGEMTIGILVTAVVAVLGQITGAYYSFLMATGMVGLIG---------- 124

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
                       + + + L +R+  + +  A++MF +Y+AL+G +LSS F+VY   SI  
Sbjct: 125 -------LCVVQIALAVVLGMRVTKMKSATARVMFYVYAALMGFTLSSIFMVYDLGSIGV 177

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              +TAA F +L+++G TTK ++   G  +++G   L +  +V  F++   +   + A+G
Sbjct: 178 ALGVTAAFFFALTMFGMTTKFNMLKAGPILMIGLIVLIISQIVLAFVQVDGMTKIVCAIG 237

Query: 201 LVIFSALTAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           L++F+ +T YD Q  +   ++         ++ S++ AL LY+DF+ +F+++L+ LG+R
Sbjct: 238 LILFAGMTIYDAQSTRALLTEYEAQGPEMVKKISILCALNLYLDFVNMFLYILQLLGNR 296


>gi|10732614|gb|AAG22473.1|AF193045_1 unknown [Homo sapiens]
 gi|14124916|gb|AAH07980.1| Transmembrane BAX inhibitor motif containing 1 [Homo sapiens]
 gi|15488574|gb|AAH13428.1| Transmembrane BAX inhibitor motif containing 1 [Homo sapiens]
 gi|93276956|dbj|BAE93467.1| responsive to centrifugal force and shear stress gene 1 [Homo
           sapiens]
 gi|123980192|gb|ABM81925.1| transmembrane BAX inhibitor motif containing 1 [synthetic
           construct]
 gi|123994213|gb|ABM84708.1| transmembrane BAX inhibitor motif containing 1 [synthetic
           construct]
          Length = 311

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/256 (20%), Positives = 105/256 (41%), Gaps = 26/256 (10%)

Query: 8   QRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           +R V+   G G   D+ +R  ++ +VY+++++ L +T  +  +     T V+P +A +  
Sbjct: 77  ERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIF----TFVEPVSAFVRR 132

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           N  V    +   + T               I    +          ++  L++  +G   
Sbjct: 133 NVAVYYVSYAVFVVT-------------YLILACCQGPRRRFPWNIILLTLFTFAMGFMT 179

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSL 182
            +   +Y +K+++    ITA    S++++ + TK D         +    L     + S+
Sbjct: 180 GTISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLLVTGIVTSI 239

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           V  F     + +  +A+G + F+   AYDTQ +            +    + GAL +Y D
Sbjct: 240 VLYFQYVYWLHMLYAALGAICFTLFLAYDTQLV----LGNRKHTISPEDYITGALQIYTD 295

Query: 243 FIQIFVHLLRFLGSRR 258
            I IF  +L+ +G R 
Sbjct: 296 IIYIFTFVLQLMGDRN 311


>gi|291516735|emb|CBK70351.1| Integral membrane protein, interacts with FtsH [Bifidobacterium
           longum subsp. longum F8]
          Length = 300

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 61/239 (25%), Positives = 123/239 (51%), Gaps = 19/239 (7%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
            ++  R  + +VY  M +G+ VT +++ L  I         A+ ++              
Sbjct: 78  YEEARRVSVTKVYGEMTIGILVTAVVAVLGQITGAYYSFLMATGMVGLIG---------- 127

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
                       + + + L +R+  + +  A++MF +Y+AL+G +LSS F+VY   SI  
Sbjct: 128 -------LCVVQIALAVVLGMRVTKMKSATARVMFYVYAALMGFTLSSIFMVYDLGSIGV 180

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              +TAA F +L+++G TTK ++   G  +++G   L +  +V  F++   +   + A+G
Sbjct: 181 ALGVTAAFFFALTMFGMTTKFNMLKAGPILMIGLIVLIISQIVLAFVQVDGMTKIVCAIG 240

Query: 201 LVIFSALTAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           L++F+ +T YD Q  +   ++         ++ S++ AL LY+DF+ +F+++L+ LG+R
Sbjct: 241 LILFAGMTIYDAQSTRALLTEYEAQGPEMVKKISILCALNLYLDFVNMFLYILQLLGNR 299


>gi|302679244|ref|XP_003029304.1| hypothetical protein SCHCODRAFT_78117 [Schizophyllum commune H4-8]
 gi|300102994|gb|EFI94401.1| hypothetical protein SCHCODRAFT_78117 [Schizophyllum commune H4-8]
          Length = 272

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/258 (17%), Positives = 93/258 (36%), Gaps = 29/258 (11%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D  +       G+    +  +  RA++ +V+ ++   +  T I++  V+     +     
Sbjct: 42  DFGDLPDDFKYGTTVSESAPEIRRAFVRKVFTILLCQIAATTIVAAGVSTSDDVMTWVLH 101

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                   +                     L +     +     +     ++   ++ + 
Sbjct: 102 HTWSFYAPLF--------------------LSLANLALLFFKRHNHPWNLVLLSSFTIME 141

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
             +L      +    ++Q  FIT   F  L+L+   +K D   +  F+  G   L +  L
Sbjct: 142 AFTLGVTVAFFDKVIVLQALFITLGVFVGLTLFTLQSKYDFSGMAPFLFGGLLALVMTGL 201

Query: 183 V-NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYM 241
           V      S    L  +  G +IFS    YDT  I        +   +  + ++GA+ LY+
Sbjct: 202 VGLFLPFSHTFSLIYAVGGCLIFSGYIVYDTYLI--------NARLSPDEYIMGAISLYL 253

Query: 242 DFIQIFVHLLRFLGSRRD 259
           DF+ +F+ +LR L   +D
Sbjct: 254 DFVNLFLSILRLLNELQD 271


>gi|21754493|dbj|BAC04516.1| unnamed protein product [Homo sapiens]
          Length = 303

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/256 (20%), Positives = 104/256 (40%), Gaps = 26/256 (10%)

Query: 8   QRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           +R V+   G G   D+ +R  ++ +VY+++++ L +T  +        T V+P +A +  
Sbjct: 69  ERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAI----IATFTFVEPVSAFVRR 124

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           N  V    +   + T               I    +          ++  L++  +G   
Sbjct: 125 NVAVYYVSYAVFVVT-------------YLILACCQGPRRRFPWNIILLTLFTFAMGFMT 171

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSL 182
            +   +Y +K+++    ITA    S++++ + TK D         +    L     + S+
Sbjct: 172 GTISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLLVTGIVTSI 231

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           V  F     + +  +A+G + F+   AYDTQ +            +    + GAL +Y D
Sbjct: 232 VLYFQYVYWLHMLYAALGAICFTLFLAYDTQLV----LGNRKHTISPEDYITGALQIYTD 287

Query: 243 FIQIFVHLLRFLGSRR 258
            I IF  +L+ +G R 
Sbjct: 288 IIYIFTFVLQLMGDRN 303


>gi|321457436|gb|EFX68523.1| hypothetical protein DAPPUDRAFT_63064 [Daphnia pulex]
          Length = 239

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 45/259 (17%), Positives = 98/259 (37%), Gaps = 20/259 (7%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           M    +Y+      + F  +      A++ +VY ++ + L +T     L           
Sbjct: 1   MYGGADYESGGLGDAAFSFSEKSIRMAFVRKVYAILMVQLAITVGFISLFVYEPNVKMYS 60

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                +     +  F                 + + +               ++  L++A
Sbjct: 61  REHPEMWWIAFVMTF-----------------VLLIVLACCNDFRRRWPLNIILLGLFTA 103

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
             G  L +   +Y S+ ++    I  A   +L+++   TK D    G  + +    LF+ 
Sbjct: 104 CEGFMLGAVSSLYRSEDVLIAAGICTAVCLALTIFAMQTKWDFTACGGILFVCVIVLFIF 163

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            +V + +    I L  +++G ++FS    +DTQ        ++  + +  + +  AL LY
Sbjct: 164 GIVAICIPGKVIHLVYASLGALLFSVYLVFDTQL---MLGGKHKYSISPEEYIFAALNLY 220

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +D I IF+++L  +G  R+
Sbjct: 221 LDIINIFLYILAIVGGSRN 239


>gi|118403532|ref|NP_001072357.1| Fas apoptotic inhibitory molecule 2 [Xenopus (Silurana) tropicalis]
 gi|111308099|gb|AAI21456.1| neuromembrane protein 35 [Xenopus (Silurana) tropicalis]
          Length = 311

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 44/234 (18%), Positives = 87/234 (37%), Gaps = 25/234 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++ + L VT  +  L     T  DP    I  N G     +     T    
Sbjct: 96  RGFIRKVYAILMIQLLVTVAVVALF----TFCDPVKGYIQANPGWYWASYAVFFST---- 147

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                      +               ++  +++  +          Y +KS++    IT
Sbjct: 148 ---------YLVLACCSGPRRKFPWNLILLCIFTLSMAYITGMLSSFYNTKSVILCLGIT 198

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSLVNLFMRSSAIDLTMSAMGL 201
           A    S++L+ + +K D       + + +  L      L ++  F     +    + +G 
Sbjct: 199 ALVCMSVTLFSFQSKIDFTSCQGVLFVLSMVLLFSGIFLVILIPFQYIPWLHAVYAVIGA 258

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           ++F+   A+DTQ +          + +  + + GAL +Y+D I IF  LL+  G
Sbjct: 259 IVFTMFLAFDTQMLM----GSRRYSLSPEEYIFGALNIYLDIIYIFSFLLQLFG 308


>gi|154303170|ref|XP_001551993.1| hypothetical protein BC1G_09605 [Botryotinia fuckeliana B05.10]
 gi|150855068|gb|EDN30260.1| hypothetical protein BC1G_09605 [Botryotinia fuckeliana B05.10]
          Length = 278

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/255 (19%), Positives = 96/255 (37%), Gaps = 29/255 (11%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N       G        +    ++ +VY ++++ L  T  +S +     +      ++  
Sbjct: 51  NIPDDFKFGGSVAEATIEIRMQFVRKVYTILSVQLIATAALSSVSFFSESYKTWIQSNTW 110

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           +    M    G ++ T                         S     +    ++AL   S
Sbjct: 111 MLWTSMFGAIGFMLLTYWK--------------------RKSYPTNLLFLGGFTALEAYS 150

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL-SLVN 184
           +S     + S+ ++Q   +TA  F +L+L+   TK D      ++  G + L L   +  
Sbjct: 151 ISVIVSTFDSRIVLQAVLLTAGIFVALTLFACQTKYDFTSWMPYLFGGLWALILFGFMAM 210

Query: 185 LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
            F  +S ++L  S +  +IFS     DTQ I        +        +  A+ LY+D I
Sbjct: 211 FFPNNSTVELIYSGIAALIFSGYILVDTQLIMRHSHVEEE--------IAAAISLYLDII 262

Query: 245 QIFVHLLRFLGSRRD 259
            +F+ +LR L S+++
Sbjct: 263 NLFLAILRILNSQQN 277


>gi|198429962|ref|XP_002129091.1| PREDICTED: similar to NMDA receptor glutamate-binding chain isoform
           1 [Ciona intestinalis]
          Length = 323

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/247 (17%), Positives = 89/247 (36%), Gaps = 24/247 (9%)

Query: 15  SGFGSTIDQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
           +  GS  D+ +R  ++ +VY  + L L VT  +  +   + +      A+  +       
Sbjct: 98  TTRGSFDDKSVRRLFIRKVYITLGLQLLVTFGIVCIFTFIPSVKTFIRANSAMYYVAYAI 157

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
                +       +                         ++  +++  +   + +    Y
Sbjct: 158 FLALYIALVCCPNVR-----------------RKHPTNIIVLAIFTLALSYMVGTIASFY 200

Query: 134 TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAID 193
            + S+V    IT     +++L+   TK D       + +    L L   V +F  + +  
Sbjct: 201 DTMSVVIALGITVGVCVAVTLFSLQTKFDFTKCSGLLFVLVLVLMLFGFVTIFTWNKSWY 260

Query: 194 LTMSA--MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLL 251
           L +    +G ++F+   A+DTQ I               + + GAL LY+D + IF+ +L
Sbjct: 261 LHVVYGSLGALVFTLFLAFDTQLIM----GGKRYELDPEEYIYGALNLYIDVVYIFIFIL 316

Query: 252 RFLGSRR 258
              GS  
Sbjct: 317 SIFGSSN 323


>gi|289740511|gb|ADD19003.1| N-methyl-D-aspartate receptor glutamate-binding subunit [Glossina
           morsitans morsitans]
          Length = 321

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 46/239 (19%), Positives = 92/239 (38%), Gaps = 21/239 (8%)

Query: 22  DQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           DQ +R  ++ +VY ++   L VT     L      T D    +  +    +      ++ 
Sbjct: 103 DQTVRKGFIRKVYMILMGQLMVTFGFVALFTFHQPTKDFARHNPALFWVALAVLLVTMIA 162

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            +    +                         +   L++      L      Y +  ++ 
Sbjct: 163 MACCEGVR-----------------RKTPMNFIFLGLFTLAESFLLGMTAGNYAANEVLM 205

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              ITAA   +L+L+   TK D    G  ++       +  +V +F+    + +  +++G
Sbjct: 206 AVGITAAVCFALTLFAIQTKYDFTMCGGVLLAVMVVFLIFGIVAIFIPGKIMTIVYASLG 265

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            VIFS    YDTQ +       +  + +  + +  AL LY+D + IF+++L  +G+ RD
Sbjct: 266 AVIFSIYLIYDTQLMM---GGEHKYSISPEEYIFAALNLYLDIVNIFIYILTLIGATRD 321


>gi|224534717|ref|ZP_03675289.1| putative membrane protein [Borrelia spielmanii A14S]
 gi|224513965|gb|EEF84287.1| putative membrane protein [Borrelia spielmanii A14S]
          Length = 232

 Score =  109 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 87/235 (37%), Positives = 141/235 (60%), Gaps = 19/235 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LM++GL ++ + ++  +   T      ++ +    ++L  FG         
Sbjct: 15  NKFLAKVFGLMSIGLLISAMFAYATSENQTIKAIIFSNSMSFMAIILIQFG--------- 65

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                    +   ++  L+ +S+  A  +FLLYSAL G++LSS F++YT  SIV TF IT
Sbjct: 66  ---------LVYAISGALNKISSNTATALFLLYSALTGVTLSSIFMIYTQGSIVFTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A +F  +S+YGYTT  DL  +GS+MIMG +G+ + SLVN+F RSS ++  +S +G++IF+
Sbjct: 117 AGTFLGMSVYGYTTTTDLTKMGSYMIMGLWGIIIASLVNMFFRSSGLNFLISILGVIIFT 176

Query: 206 ALTAYDTQKIKEA-YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +     + D     R +V+ +L LY+DFI +F++LLRFLG RR+
Sbjct: 177 GLTAYDVQNISKMDKMLQDDTEVKNRMAVVASLKLYLDFINLFLYLLRFLGQRRN 231


>gi|224026838|ref|ZP_03645204.1| hypothetical protein BACCOPRO_03595 [Bacteroides coprophilus DSM
           18228]
 gi|224020074|gb|EEF78072.1| hypothetical protein BACCOPRO_03595 [Bacteroides coprophilus DSM
           18228]
          Length = 233

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 84/232 (36%), Positives = 134/232 (57%), Gaps = 20/232 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
              VY  M L L +TG  +  V                      T    ++      W  
Sbjct: 20  FRSVYVWMTLALVITGFTALYVAKS------------------YTLLNLMLQNQMAFWGV 61

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           + A  G+  +++ R++ +S   A ++F++YS L G+++S  FL+YT  SI  TFF+TA +
Sbjct: 62  LIAEFGLVFYMSARINRISFTTATILFIVYSILNGVTMSMLFLIYTMSSIATTFFVTAGT 121

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG+++L+GY TK+DL  IG+  IMG  GL + SLVN+F+ +S +DL +S +G+++F  LT
Sbjct: 122 FGAMALFGYATKKDLTRIGNLCIMGVIGLIIASLVNMFLHNSMMDLIISYVGVLLFVGLT 181

Query: 209 AYDTQKIKEAYSDRYDV--AYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYD+QKIK+  S          ++ +++GAL LY+DFI +F++LLR LG R+
Sbjct: 182 AYDSQKIKQMLSGEDIEVNETTQKIALMGALTLYLDFINLFLYLLRILGDRK 233


>gi|147901259|ref|NP_001086159.1| Fas apoptotic inhibitory molecule 2 [Xenopus laevis]
 gi|49256498|gb|AAH74272.1| MGC84041 protein [Xenopus laevis]
          Length = 311

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 44/234 (18%), Positives = 86/234 (36%), Gaps = 25/234 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++ + L VT  +  L     T  +P    I  N G     +     T    
Sbjct: 96  RGFIRKVYTILMVQLLVTVAVVALF----TFCNPVKEYIQANPGWYWASYAVFFST---- 147

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                      +               ++  +++  +          Y +KS++    IT
Sbjct: 148 ---------YLVLACCSGPRRKFPWNLILLCIFTLSMAYITGMLSSFYNTKSVILCLGIT 198

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSLVNLFMRSSAIDLTMSAMGL 201
           A    S++L+ + TK D       + + +  L      L ++  F     +      +G 
Sbjct: 199 ALVCMSVTLFSFQTKIDFTSCQGVLFVLSMVLLFSGIFLVILIPFQYIPWLHAIYGVLGA 258

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           ++F+   A+DTQ +          + +  + + GAL +Y+D I IF  LL+  G
Sbjct: 259 IVFTMFLAFDTQLLM----GSRRYSLSPEEYIFGALNIYLDIIYIFSFLLQVFG 308


>gi|312890122|ref|ZP_07749665.1| protein of unknown function UPF0005 [Mucilaginibacter paludis DSM
           18603]
 gi|311297399|gb|EFQ74525.1| protein of unknown function UPF0005 [Mucilaginibacter paludis DSM
           18603]
          Length = 243

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 71/256 (27%), Positives = 127/256 (49%), Gaps = 14/256 (5%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + N                   R ++  V+  M + L ++ I ++      + +      
Sbjct: 1   MDNNNLNYTYDKVIQVDDASASRKFIANVFLWMFVALAISSIAAYEFGTNESLLRLLINF 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
              +R  + T             + +F+PL   + ++  ++ LS     ++F+ ++AL G
Sbjct: 61  ETGSRTGLGT-------------LVMFSPLAFVLIMSYGMNKLSYPILAVLFICFAALFG 107

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +S+S   L+YT+ S++  F   +  FG +++ GYTT +DL   GS MIMG  G+ + SLV
Sbjct: 108 MSISYILLMYTASSVLGVFVTASVVFGVMAVAGYTTDQDLTKFGSLMIMGLIGIVIASLV 167

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAE-RQSVIGALMLYMD 242
           N+F++S  +   +S +G+ +F  LTAYD QK+K   +        + +  ++GAL LY+D
Sbjct: 168 NMFLKSEQLGYIISYIGVAVFVGLTAYDVQKLKRIGASEEYGDATKSKLVLMGALTLYLD 227

Query: 243 FIQIFVHLLRFLGSRR 258
           FI +F+ LLR  G RR
Sbjct: 228 FINLFLMLLRIFGRRR 243


>gi|282859826|ref|ZP_06268920.1| putative membrane protein [Prevotella bivia JCVIHMP010]
 gi|282587446|gb|EFB92657.1| putative membrane protein [Prevotella bivia JCVIHMP010]
          Length = 239

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 82/231 (35%), Positives = 135/231 (58%), Gaps = 19/231 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M +VY  M + L +TGI ++ V+     ++   +S +                    ++ 
Sbjct: 27  MRKVYTWMTMALIITGIAAYWVSQSVGLMNLMFSSRL------------------TFFLL 68

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A +G+ I+L+ R+H LS  AA + F+ YS L G+  +   L +T  SI +TF ITA +
Sbjct: 69  IGAQVGIVIYLSARIHKLSLQAATLWFIAYSVLTGVVFAPIILAFTGASIAKTFLITAGT 128

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++++ G TTKRDL  +GS + MG  GL +  +VN+F++S+ +D  +S  G++IF+ LT
Sbjct: 129 FGAMAVIGTTTKRDLSRMGSILTMGIIGLIIAMVVNIFLKSTMMDFIISGAGVLIFTGLT 188

Query: 209 AYDTQKIKEAYS-DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           A+D Q IK+  S         ++ +++GAL LY+DFI +F++LLRF G R+
Sbjct: 189 AWDVQNIKKQLSLAGNVSESTQKIALLGALNLYLDFINLFLYLLRFFGDRK 239


>gi|149029068|gb|EDL84362.1| rCG41106, isoform CRA_a [Rattus norvegicus]
          Length = 303

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 44/229 (19%), Positives = 86/229 (37%), Gaps = 20/229 (8%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++++V+ +++  L +T  +  +            A                        +
Sbjct: 95  FIVKVFVVLSAQLLITAAIISIFVFCEAVRKWIIAMPWFMYA-----------------L 137

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
                + + I    R       A  ++ + ++ L GL L S  + Y +  I+     T A
Sbjct: 138 LPAVLIVIVILACCRDIRRQVPANYILLVFFTILEGLLLGSMSVFYKADEILWATGATTA 197

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
               L+L+   TK D   +   + +    L +  +V L +RS  + L  SA+G ++FS  
Sbjct: 198 VTLVLTLFALQTKWDFTLLNGMLFVFTSVLVIYGIVTLVVRSYWLHLVYSALGTLLFSMY 257

Query: 208 TAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
              D Q        RY       + +  AL +Y+D I +F+ +L  +G 
Sbjct: 258 LVMDVQM---MVGGRYHYEIDPEEYIFAALNIYVDIINLFIFILDLIGR 303


>gi|23465965|ref|NP_696568.1| hypothetical protein BL1405 [Bifidobacterium longum NCC2705]
 gi|227547643|ref|ZP_03977692.1| integral membrane protein [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239621248|ref|ZP_04664279.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|312132569|ref|YP_003999908.1| integral membrane protein [Bifidobacterium longum subsp. longum
           BBMN68]
 gi|322689421|ref|YP_004209155.1| hypothetical protein BLIF_1237 [Bifidobacterium longum subsp.
           infantis 157F]
 gi|322691388|ref|YP_004220958.1| hypothetical protein BLLJ_1199 [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|23326678|gb|AAN25204.1| conserved hypothetical protein with MutT type domain
           [Bifidobacterium longum NCC2705]
 gi|227211898|gb|EEI79794.1| integral membrane protein [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239515709|gb|EEQ55576.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|311773509|gb|ADQ02997.1| Integral Membrane protein [Bifidobacterium longum subsp. longum
           BBMN68]
 gi|320456244|dbj|BAJ66866.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|320460757|dbj|BAJ71377.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 299

 Score =  109 bits (272), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 61/239 (25%), Positives = 123/239 (51%), Gaps = 19/239 (7%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
            ++  R  + +VY  M +G+ VT +++ L  I         A+ ++              
Sbjct: 77  YEEARRVSVTKVYGEMTIGILVTAVVAVLGQITGAYYSFLMATGMVGLIG---------- 126

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
                       + + + L +R+  + +  A++MF +Y+AL+G +LSS F+VY   SI  
Sbjct: 127 -------LCVVQIALAVVLGMRVTKMKSATARVMFYVYAALMGFTLSSIFMVYDLGSIGV 179

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              +TAA F +L+++G TTK ++   G  +++G   L +  +V  F++   +   + A+G
Sbjct: 180 ALGVTAAFFFALTMFGMTTKFNMLKAGPILMIGLIVLIISQIVLAFVQVDGMTKIVCAIG 239

Query: 201 LVIFSALTAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           L++F+ +T YD Q  +   ++         ++ S++ AL LY+DF+ +F+++L+ LG+R
Sbjct: 240 LILFAGMTIYDAQSTRALLTEYEAQGPEMVKKISILCALNLYLDFVNMFLYILQLLGNR 298


>gi|296454334|ref|YP_003661477.1| hypothetical protein BLJ_1196 [Bifidobacterium longum subsp. longum
           JDM301]
 gi|296183765|gb|ADH00647.1| protein of unknown function UPF0005 [Bifidobacterium longum subsp.
           longum JDM301]
          Length = 300

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 61/239 (25%), Positives = 122/239 (51%), Gaps = 19/239 (7%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
            ++  R  + +VY  M +G+ VT +++ L  I         A+ ++              
Sbjct: 78  YEEARRVSVAKVYGEMTIGILVTAVVAVLGQITGAYYSFLMATGMVGLIG---------- 127

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
                       + + + L +R+  + +  A++MF +Y+AL+G +LSS F+VY   SI  
Sbjct: 128 -------LCVVQIALAVVLGMRVTKMKSATARVMFYVYAALMGFTLSSIFMVYDLGSIGV 180

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              +TAA F +L+++G TTK D+   G  +++G   L +  +V  F++   +   + A+G
Sbjct: 181 ALGVTAAFFFALTMFGMTTKFDMLKAGPILMIGLIVLIISQIVLAFVQVDGMTKIVCAIG 240

Query: 201 LVIFSALTAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           L++F+ +  YD Q  +   ++         ++ S++ AL LY+DF+ +F+++L+ LG+R
Sbjct: 241 LILFAGMAIYDAQSTRALLTEYEAQGPEMVKKISILCALNLYLDFVNMFLYILQLLGNR 299


>gi|255533663|ref|YP_003094035.1| hypothetical protein Phep_3782 [Pedobacter heparinus DSM 2366]
 gi|255346647|gb|ACU05973.1| protein of unknown function UPF0005 [Pedobacter heparinus DSM 2366]
          Length = 249

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 83/261 (31%), Positives = 130/261 (49%), Gaps = 18/261 (6%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D  N                   + +   V+  M + L ++   ++ ++  A        
Sbjct: 2   DNNNNYDWAQKSVFVQPQTGVVAKKFFANVFLWMFVALSLSTFSAYFMSANAEFSSFLRN 61

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                           +  + L WI  FAPLG+ + ++  L+ LS  A   +F+LYS L 
Sbjct: 62  PE-------------TLRPTTLGWIATFAPLGLVLLMSAGLNRLSYGALVGVFVLYSVLT 108

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GLSLS   LVYTS S++  F   A  FG +++ GYTT  DL   G  +++G  GL + S+
Sbjct: 109 GLSLSFILLVYTSTSVLSCFIGAAGIFGIMAIMGYTTNIDLSKFGPILMIGVVGLIIASV 168

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYS-----DRYDVAYAERQSVIGAL 237
           VN+F++S+   L M+ +G+ IF+ALTAYD QK+K              A  ++ +++GAL
Sbjct: 169 VNMFIQSANFSLFMAFIGIAIFTALTAYDVQKLKRIGEGLEANGAQMDADTKKLAIMGAL 228

Query: 238 MLYMDFIQIFVHLLRFLGSRR 258
            LY+DF+ IF++LLR  G RR
Sbjct: 229 SLYLDFLNIFIYLLRIFGDRR 249


>gi|94987252|ref|YP_595185.1| integral membrane protein, interacts with FtsH [Lawsonia
           intracellularis PHE/MN1-00]
 gi|94731501|emb|CAJ54864.1| Integral membrane protein, interacts with FtsH [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 237

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 86/233 (36%), Positives = 130/233 (55%), Gaps = 20/233 (8%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           +M  VY  M +GL VT   +F V                           L   +    I
Sbjct: 23  FMRYVYWWMTIGLLVTAGSAFYVANSPAL------------------LQTLFSNTLSLVI 64

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
              A + + + L+  +  LS+ AA ++F+LYS L+G  LSS  +VYT  S+VQ F  TA 
Sbjct: 65  LAIAVIALPLVLSTMISRLSSTAATLLFILYSLLMGAFLSSVLVVYTGTSVVQAFVTTAG 124

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
           +F ++S+YG  TKRDL  +GSF+ MG  GL +  +VN+F++S  ++  +SA+G++IF+ L
Sbjct: 125 TFAAMSIYGTVTKRDLTSMGSFLTMGLIGLIIAMVVNIFLKSPMMEFIISAIGVLIFTGL 184

Query: 208 TAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           TAYDTQKI+    +    D     R +++GAL LY+DFI +F+ +LR +G RR
Sbjct: 185 TAYDTQKIRTFGENAPLNDSLAIRRGALLGALTLYLDFINLFLMMLRLMGDRR 237


>gi|327264447|ref|XP_003217025.1| PREDICTED: fas apoptotic inhibitory molecule 2-like [Anolis
           carolinensis]
          Length = 313

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 47/240 (19%), Positives = 90/240 (37%), Gaps = 29/240 (12%)

Query: 26  RAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           R ++ +VY++++L L VT  I++                            G +      
Sbjct: 97  RVFIRKVYSIISLQLFVTVAIVALFTFCEPVK-------------------GYVQANPAW 137

Query: 85  RWIFIFAPL-GVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
            W           I               ++  +++  +G         Y +KSI+    
Sbjct: 138 YWASYAVFFVTYLILACCSGPRRYFPWNLILLTIFTLSMGYMTGMLASYYDTKSILLCLM 197

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSLVNLFMRSSAIDLTMSAM 199
           ITA    S++++ + TK D       + + A  L     +L+++  F     +    + +
Sbjct: 198 ITALVCISVTIFSFQTKYDFTTCQGVLFVMAMVLFFSGIILAVMLPFKYVPWLHAVYAVL 257

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           G ++F+   A+DTQ +          A +  + V GAL +Y+D + IF   L+  GS RD
Sbjct: 258 GAIVFTMFLAFDTQLLM----GSRSYALSPEEYVFGALNIYLDIVYIFSFFLQIFGSGRD 313


>gi|149277448|ref|ZP_01883589.1| membrane protein [Pedobacter sp. BAL39]
 gi|149231681|gb|EDM37059.1| membrane protein [Pedobacter sp. BAL39]
          Length = 250

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 80/262 (30%), Positives = 127/262 (48%), Gaps = 19/262 (7%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D  N                   + +   V+  M + L ++ + +  +            
Sbjct: 2   DNNNNFNWTQKDVYVQDQTGVVAKKFFANVFLWMFVALTLSTLSAIFMTSSPEIYSALRN 61

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                              + L WI  FAPLG+ + ++  L  LS  A   +F+LYSAL 
Sbjct: 62  LETGKP-------------TTLGWIATFAPLGLVLLMSAGLSRLSYTALIGVFILYSALT 108

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           G+SLS   L+YTS S++  F   A  FG ++  GYTT  DL   G  +++G  GL + S+
Sbjct: 109 GVSLSFILLIYTSASVITCFAAAAGIFGIMAFLGYTTDVDLSKFGPILMVGVVGLIIASV 168

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDV------AYAERQSVIGA 236
            N+F++S +  L M+ +G+ IF+ALTAYD QK+K   +   +       A  ++ +++GA
Sbjct: 169 ANMFIQSESFSLFMAFVGIAIFTALTAYDVQKLKRIGAGLEESGAQIQDADTKKLAIMGA 228

Query: 237 LMLYMDFIQIFVHLLRFLGSRR 258
           L LY+DF+ IF++LLR  G RR
Sbjct: 229 LSLYLDFLNIFIYLLRIFGDRR 250


>gi|50593008|ref|NP_071435.2| transmembrane BAX inhibitor motif-containing protein 1 [Homo
           sapiens]
 gi|93117549|sp|Q969X1|TMBI1_HUMAN RecName: Full=Transmembrane BAX inhibitor motif-containing protein
           1; AltName: Full=Protein RECS1 homolog
 gi|20071154|gb|AAH26348.1| Transmembrane BAX inhibitor motif containing 1 [Homo sapiens]
 gi|119591013|gb|EAW70607.1| transmembrane BAX inhibitor motif containing 1, isoform CRA_a [Homo
           sapiens]
 gi|119591015|gb|EAW70609.1| transmembrane BAX inhibitor motif containing 1, isoform CRA_a [Homo
           sapiens]
 gi|193786875|dbj|BAG52198.1| unnamed protein product [Homo sapiens]
          Length = 311

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 52/256 (20%), Positives = 105/256 (41%), Gaps = 26/256 (10%)

Query: 8   QRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           +R V+   G G   D+ +R  ++ +VY+++++ L +T  +  +     T V+P +A +  
Sbjct: 77  ERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIF----TFVEPVSAFVRR 132

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           N  V    +   + T               I    +          ++  L++  +G   
Sbjct: 133 NVAVYYVSYAVFVVT-------------YLILACCQGPRRRFPWNIILLTLFTFAMGFMT 179

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSL 182
            +   +Y +K+++    ITA    S++++ + TK D         +    L     + S+
Sbjct: 180 GTISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLLVTGIVTSI 239

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           V  F     + +  +A+G + F+   AYDTQ +            +    + GAL +Y D
Sbjct: 240 VLYFQYVYWLHMLYAALGAICFTLFLAYDTQLV----LGNRKHTISPEDYITGALQIYTD 295

Query: 243 FIQIFVHLLRFLGSRR 258
            I IF  +L+ +G R 
Sbjct: 296 IIYIFTFVLQLMGDRN 311


>gi|189192426|ref|XP_001932552.1| transmembrane BAX inhibitor motif-containing protein 4 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187974158|gb|EDU41657.1| transmembrane BAX inhibitor motif-containing protein 4 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 278

 Score =  109 bits (271), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 91/233 (39%), Gaps = 29/233 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY ++ + L  T  +SF+     +              + ++ FG+  +     W
Sbjct: 72  AFVRKVYAILTVQLLATAAVSFISMTSESYKHFVQTHQW---PLWVSLFGSFAFLGLTFW 128

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S     +    ++A+   S+S       SK ++Q  F T 
Sbjct: 129 KRK-----------------SYPTNLLFLGGFTAMEAYSISVIVSFTESKIVLQALFFTL 171

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV-NLFMRSSAIDLTMSAMGLVIFS 205
             F +LSL+   +K D      ++    + + L   + + F  +S ++L    +  +IFS
Sbjct: 172 GIFVALSLFACQSKYDFTSWVPYLFGTLWVVVLFGFMSSFFPYNSTVELGYGVICALIFS 231

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           A    DTQ I   Y    +        +  A+ LY+D I +F+ +LR L S+ 
Sbjct: 232 AYILVDTQMIMRHYHVEEE--------IAAAISLYLDIINLFLAILRILNSQN 276


>gi|320334405|ref|YP_004171116.1| hypothetical protein Deima_1803 [Deinococcus maricopensis DSM
           21211]
 gi|319755694|gb|ADV67451.1| protein of unknown function UPF0005 [Deinococcus maricopensis DSM
           21211]
          Length = 230

 Score =  109 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 71/249 (28%), Positives = 130/249 (52%), Gaps = 22/249 (8%)

Query: 10  VVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRG 69
                S   +  +  +R+++ R Y+ M  GL +T  +++ V                   
Sbjct: 2   NQYPPSTLSARSESVVRSFIGRTYSWMTAGLALTAAIAYFVGRNPDL------------- 48

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
                   ++      ++     LG+ +FL+     +SA  A ++F+ YSA+ GL+    
Sbjct: 49  --------MVSIGRSGFLLPLVQLGIVMFLSFLAPRVSATVAGLLFMAYSAVTGLTFGVI 100

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
           F  YT+  +   F  TA +FG++S +G+ T+R+L P+G+F++    GL + S+VN+F+  
Sbjct: 101 FQFYTASDVTAAFLTTAGTFGAMSAFGFLTRRNLAPMGTFLMFALIGLIIASIVNIFIGG 160

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR-YDVAYAERQSVIGALMLYMDFIQIFV 248
           S ++L +SA+G+++F+ LTAYDTQ ++        D    E+ ++ GAL LY++FI +F+
Sbjct: 161 STLNLIISAVGVLLFAGLTAYDTQMLRNMALQGFGDAHTQEKGAIYGALTLYLNFINMFL 220

Query: 249 HLLRFLGSR 257
            +LR   SR
Sbjct: 221 FILRLFSSR 229


>gi|225709710|gb|ACO10701.1| Transmembrane BAX inhibitor motif-containing protein 4 [Caligus
           rogercresseyi]
          Length = 247

 Score =  109 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 95/226 (42%), Gaps = 28/226 (12%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++ +VY L+A+ L +T +++ +             +  +     +   G L+        
Sbjct: 45  FLRKVYGLLAVQLILTTLIAGVCLFTPAVKTAVQQNSWLVIVAFILSIGILIAL------ 98

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
                          ++        ++   ++ +   ++      +    ++Q FFITA 
Sbjct: 99  --------------HVNRHKTPLNLILLAAFTVVEAYTVGVMVSFFDKLVVIQAFFITAT 144

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
               L+L+ + TKRD    GS + +G + L L  ++N+F+  + +DL M+  G ++FS  
Sbjct: 145 VVVGLTLFTFNTKRDFSKWGSALFIGLWVLILGGILNIFIGGTGLDLLMTIGGTILFSGF 204

Query: 208 TAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
             +DTQ I            +  + +I  + LY+D I +F+ +L+ 
Sbjct: 205 IVFDTQMIMTK--------VSPEEYIIATINLYLDIINLFIEILKL 242


>gi|332815554|ref|XP_001144519.2| PREDICTED: transmembrane BAX inhibitor motif-containing protein 1
           [Pan troglodytes]
          Length = 311

 Score =  109 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 52/256 (20%), Positives = 105/256 (41%), Gaps = 26/256 (10%)

Query: 8   QRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           +R V+   G G   D+ +R  ++ +VY+++++ L +T  +  +     T V+P +A +  
Sbjct: 77  ERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIF----TFVEPVSAFVRR 132

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           N  V    +   + T               I    +          ++  L++  +G   
Sbjct: 133 NVAVYYVSYAVFVVT-------------YLILACCQGPRRRFPWNIILLTLFTFAMGFMT 179

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSL 182
            +   +Y +K+++    ITA    S++++ + TK D         +    L     + S+
Sbjct: 180 GTISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLLVTGIVTSI 239

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           V  F     + +  +A+G + F+   AYDTQ +            +    + GAL +Y D
Sbjct: 240 VLYFQYVYWLHMLYAALGAICFTLFLAYDTQLV----LGNRKHTISPEDYITGALQIYTD 295

Query: 243 FIQIFVHLLRFLGSRR 258
            I IF  +L+ +G R 
Sbjct: 296 IIYIFTFVLQLMGDRN 311


>gi|326388928|ref|ZP_08210510.1| hypothetical protein Y88_3672 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206528|gb|EGD57363.1| hypothetical protein Y88_3672 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 210

 Score =  109 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 91/230 (39%), Positives = 136/230 (59%), Gaps = 20/230 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M+ +YN MA G+ ++GI++                               +  +PLRW+ 
Sbjct: 1   MLSIYNYMASGVLLSGIVALGFATSG--------------------LAEAVLMTPLRWLI 40

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
             +PL   + ++  ++ LS  A + +F  +S  +GLSLSS F VYT  SI  TFF TA +
Sbjct: 41  ALSPLAFTMVMSFGVNRLSTGAMRGLFWAFSVAMGLSLSSIFFVYTGPSIAVTFFATAGA 100

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           F  LSL+GYTT+++L  +G+F++MG FG+ + SLVNLF+ S  +   +S +G+ IF+ LT
Sbjct: 101 FAGLSLFGYTTQKNLSGMGTFLLMGLFGILIASLVNLFLHSPGLSWGISFLGVFIFAGLT 160

Query: 209 AYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+KE Y+       A +  V+GAL LY+DFI +F+ LLRF+G RR
Sbjct: 161 AYDTQKLKEQYAYVAGTDMAGKVVVLGALELYLDFINMFMMLLRFMGDRR 210


>gi|94984645|ref|YP_604009.1| hypothetical protein Dgeo_0538 [Deinococcus geothermalis DSM 11300]
 gi|94554926|gb|ABF44840.1| protein of unknown function UPF0005 [Deinococcus geothermalis DSM
           11300]
          Length = 228

 Score =  109 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 75/231 (32%), Positives = 119/231 (51%), Gaps = 21/231 (9%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           +R +M R Y+ MA GL +T  +++L                                  L
Sbjct: 12  VRTFMARTYSWMAAGLALTAGVAYLTAQNEAL---------------------AAQVMGL 50

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
           R   + A L +   L++    LS+  A ++F+ Y+AL GL+ SS  L Y+  ++   F  
Sbjct: 51  RMPLVLAQLAIVFVLSLAAQRLSSAVAGILFIAYAALTGLTFSSLLLAYSPSAVTAAFLT 110

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TA +F ++S+ G   KRDL  +G F +    GL +  +VNLF+ SSA+ L +S +G+++F
Sbjct: 111 TAGTFAAMSVAGLVIKRDLSALGRFFLFAVLGLLIAMIVNLFVASSALTLGISIVGVLLF 170

Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           + LTAYDTQ ++           AER ++ GAL LY+DFI +F+ +LR  G
Sbjct: 171 AGLTAYDTQMLRTLALSGVSGELAERAAINGALALYLDFINMFLFILRLFG 221


>gi|74217818|dbj|BAE41919.1| unnamed protein product [Mus musculus]
          Length = 309

 Score =  109 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 42/261 (16%), Positives = 98/261 (37%), Gaps = 26/261 (9%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
            D    +R  +     G   D+ +R +++ +VY ++++ L +T  +  +   +       
Sbjct: 69  HDYNEEERAGSDSFRPGEWDDRKVRHSFIQKVYCIISVQLLITVAIIAIFTFVEPVGKYV 128

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
             ++ +                          +        +          ++  +++ 
Sbjct: 129 RNNVAVYYVSYAVFL-----------------VTYLTLACCQGPRRRFPWNIILLTIFTL 171

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL--- 177
            +G    +   +Y +K+++    ITA    S++++ + TK D         +    L   
Sbjct: 172 ALGFVTGTISSMYETKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLMVT 231

Query: 178 -FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGA 236
             + S+V +F     + +  +A+G + F+   AYDTQ +            +    + GA
Sbjct: 232 GIVTSIVLIFKYIYWLHMVYAALGAICFTLFLAYDTQLV----LGNRKHTISPEDYITGA 287

Query: 237 LMLYMDFIQIFVHLLRFLGSR 257
           L +Y D + IF  +L+ +GSR
Sbjct: 288 LQIYTDIVYIFTFVLQLVGSR 308


>gi|71892121|ref|YP_277853.1| putative transport protein [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
 gi|71796227|gb|AAZ40978.1| putative transport protein [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
          Length = 236

 Score =  109 bits (271), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 78/254 (30%), Positives = 136/254 (53%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             +     +     ++  ++ Y+++V+  M+ GL +T  +++  +               
Sbjct: 1   MDQFPRFQNTASEQVNNAIQPYILQVFGWMSCGLLLTAFVAWYASRTPAI---------- 50

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                      L     + +  I   L +   L+  +  LS   A  +F+LYS L GL+L
Sbjct: 51  --------LQLLFSNQIIFFSLIIGQLALVFVLSGMVTRLSGSLATTLFMLYSMLTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F++YT+ SI   F +T+  FG+++LYGYTTKRDL   G+ + M   G+ L S+VNL+
Sbjct: 103 SSVFILYTTSSISSAFVVTSGMFGAMTLYGYTTKRDLSSFGNLLFMALIGIVLASMVNLW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFI 244
           ++++A+   ++ +G++IF  LTAYDTQK+K   +     +     + S+IGAL LY+DFI
Sbjct: 163 LKNTALMWLITYIGVIIFVGLTAYDTQKLKSIGASLSIDNQDQFRKYSIIGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ ++R  G+RR
Sbjct: 223 NLFLMIVRIFGNRR 236


>gi|115400231|ref|XP_001215704.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114191370|gb|EAU33070.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 270

 Score =  109 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 48/234 (20%), Positives = 91/234 (38%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY ++ + L +T +MS L             +  +    +    G ++ T     
Sbjct: 64  QFIRKVYAILTVQLLLTTVMSSLSFFSEGYRHWIQGNFWLMMVSVFGALGFMLVTYWK-- 121

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S  A  +    ++ L   S+S     Y ++ +VQ   +T 
Sbjct: 122 ------------------RKSYPANLLFLSAFTILEAYSISVVVSFYDARVVVQALVLTL 163

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR-SSAIDLTMSAMGLVIFS 205
             F +L+L+   TK D      ++    + L L   V  FM  SS ++L   A+  +IFS
Sbjct: 164 GMFVALTLFACQTKYDFTNWMPYLFGALWFLILFGFVAAFMPRSSTVELIYGAVAALIFS 223

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ I   Y    +        +  ++ LY+D + +F+ +LR L ++ +
Sbjct: 224 GYILVDTQLIMRHYHVEEE--------IAASISLYLDILNLFLAILRILNNQNN 269


>gi|195333904|ref|XP_002033626.1| GM20328 [Drosophila sechellia]
 gi|195582899|ref|XP_002081263.1| GD25805 [Drosophila simulans]
 gi|194125596|gb|EDW47639.1| GM20328 [Drosophila sechellia]
 gi|194193272|gb|EDX06848.1| GD25805 [Drosophila simulans]
          Length = 244

 Score =  108 bits (270), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 44/261 (16%), Positives = 97/261 (37%), Gaps = 28/261 (10%)

Query: 7   YQRVVNSGSGFGSTIDQGL--------RAYMIRVYNLMALGLGVTGIMSFLVNILATTVD 58
           YQ+   +G+   +  D+          + ++ +VY ++   L +T     +      + +
Sbjct: 4   YQQGDETGAYTDAEADKSFAFDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQE 63

Query: 59  PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
               +  +    ++     ++  +    +    PL                       L+
Sbjct: 64  WVQKNPALFWIALVVLIVTMICMACCESVRRKTPLNFIFLF-----------------LF 106

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
           +      L      Y +  ++    ITAA    L+L+   TK D    G  ++       
Sbjct: 107 TVAESFLLGMVAGQYEADEVLMAVGITAAVALGLTLFALQTKYDFTMCGGVLVACLVVFI 166

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALM 238
           +  ++ +F+    I L  +++G ++FS    YDTQ         +  + +  + +  AL 
Sbjct: 167 IFGIIAIFIPGKVIGLVYASLGALLFSVYLVYDTQL---MLGGNHKYSISPEEYIFAALN 223

Query: 239 LYMDFIQIFVHLLRFLGSRRD 259
           LY+D I IF+++L  +G  R+
Sbjct: 224 LYLDIINIFMYILTIIGLSRN 244


>gi|170060737|ref|XP_001865933.1| fas apoptotic inhibitory molecule 2 [Culex quinquefasciatus]
 gi|167879114|gb|EDS42497.1| fas apoptotic inhibitory molecule 2 [Culex quinquefasciatus]
          Length = 310

 Score =  108 bits (270), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 98/239 (41%), Gaps = 21/239 (8%)

Query: 22  DQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           DQ +R  ++ +VY+++ + LG+T     L      T         +           ++ 
Sbjct: 92  DQSIRKGFIRKVYSILMVQLGITLGFICLFMYHEPTKVWVQRHPELFWIAFGVMLVTMIS 151

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            +    +                    +    +   L++  +   +      ++S+ ++ 
Sbjct: 152 MACCDSVR-----------------RKSPMNFIFLGLFTLAMSFLMGVTTARFSSQEVLL 194

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              ITAA    L+L+ + TK D   +G  + + A  L L  L+ +F     I L  +++G
Sbjct: 195 AVGITAAVCLGLTLFAFQTKWDFTVMGGMLFVAALVLMLFGLIAIFFPGKTITLVYASLG 254

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++FS    YDTQ +      ++  + +  + +  AL LY+D I IF+ +L  +G+ RD
Sbjct: 255 ALLFSFYLVYDTQLMM---GGKHKYSISPEEYIFAALNLYLDIINIFMFILTIIGASRD 310


>gi|169848036|ref|XP_001830726.1| glutamate binding protein [Coprinopsis cinerea okayama7#130]
 gi|116508200|gb|EAU91095.1| glutamate binding protein [Coprinopsis cinerea okayama7#130]
          Length = 274

 Score =  108 bits (270), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 48/231 (20%), Positives = 97/231 (41%), Gaps = 29/231 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY+++   +  T ++  LV+   + +    A+        +  FG L+    L W
Sbjct: 68  AFVRKVYSILLAQIFATCVVGGLVSSSPSAILWVQANPW---SFYVPLFGTLINLGLLYW 124

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S     +    ++ +   +L      Y  + ++Q   IT 
Sbjct: 125 -----------------KRHSHPWNFVFLSTFTLMEAFTLGIVTAFYDDRLVMQALLITL 167

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFS 205
             F  L+L+ + +K D   +G F+      L    L++  F  +   D+  + +G+++FS
Sbjct: 168 GIFLGLTLFTFQSKYDFSGMGPFLFGTLMALLFTGLISIFFPFNRTFDIVYACVGILLFS 227

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
               YDT  I        +   +  + ++GA+ LY+DFI +F+++LR LG 
Sbjct: 228 GYIVYDTYMI--------NKRLSPDEYIMGAISLYLDFINLFINILRLLGD 270


>gi|126339183|ref|XP_001374575.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 339

 Score =  108 bits (270), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 37/239 (15%), Positives = 89/239 (37%), Gaps = 27/239 (11%)

Query: 26  RAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           R ++ +VY+++ + L +T G+++         +   +          +     L+     
Sbjct: 123 RVFVRKVYSILMIQLLLTVGVVALFTFCEPVKMYVQSNPAWYWASYAVFFMTYLI----- 177

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
                                       ++  +++  +          Y +KS++    I
Sbjct: 178 -------------LACCSGPRRYFPWNLILLSIFTLSMAYLTGMLSSYYNTKSVLLCLGI 224

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSLVNLFMRSSAIDLTMSAMG 200
           TA    S++L+ + TK D       + +    +     LL+++  F     +    + +G
Sbjct: 225 TALVCLSVTLFSFQTKFDFTSCQGILFVLLMVMFFSGILLAIILPFQYVPWLHGIYAVLG 284

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            ++F+   A+DTQ +          + +  + + GAL +Y+D + IF   L+  G+ R+
Sbjct: 285 AIVFTMFLAFDTQLLM----GNRRYSLSPEEYIFGALNIYLDIVYIFSFFLQLFGTNRE 339


>gi|91079076|ref|XP_975234.1| PREDICTED: similar to AGAP005529-PA [Tribolium castaneum]
 gi|270004203|gb|EFA00651.1| hypothetical protein TcasGA2_TC003527 [Tribolium castaneum]
          Length = 312

 Score =  108 bits (270), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 48/254 (18%), Positives = 105/254 (41%), Gaps = 22/254 (8%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASII 65
           Y     +  GF  +     R ++ +VY+++ + L ++   +++ +    T     +   +
Sbjct: 80  YSGEDPTVKGFDFSDKSIRRGFIRKVYSILMVQLSISLAFIAWFLFHTPTRKFVQSHGEL 139

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           +   +++                    + +            A    +   +++      
Sbjct: 140 LIISLVI------------------IFVTMIALACCGEVRRKAPTNYIFLFIFTLAESFV 181

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           L+     Y S+ ++    ITAA    L+L+ + TK D    G  + +    LF+  +V +
Sbjct: 182 LAVCSSTYESQEVMMAVGITAAVCLGLTLFAFQTKYDFTMCGGILFVAVLILFIFGIVTI 241

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F+ +  + L  +++G +IFS    YDTQ +       +  + +  + V  AL LY+D I 
Sbjct: 242 FVHTKVVKLVYASLGALIFSIYLVYDTQLMM---GGNHKYSISPEEYVFAALNLYIDVIN 298

Query: 246 IFVHLLRFLGSRRD 259
           IF+++L  +G+ RD
Sbjct: 299 IFMYILSIIGTSRD 312


>gi|46850169|gb|AAT02516.1| unknown [Chlamydomonas reinhardtii]
          Length = 248

 Score =  108 bits (270), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 60/249 (24%), Positives = 116/249 (46%), Gaps = 21/249 (8%)

Query: 11  VNSGSGFGSTIDQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRG 69
           V  G+   +  ++ +R  ++ +V+ L+A+ L +T +++             AA   +   
Sbjct: 18  VEKGAALNAFAERTVRQGFVRKVFGLLAVQLALTTVIAGTFVTSTAVKTFVAAHPWVLML 77

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
            ML GFG L+  +                        S     ++  +++A  G+ + + 
Sbjct: 78  GMLAGFGILLTLTLSSSARQ-----------------SHPTNLILLFVFTAAEGVLVGAA 120

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
                +  ++  F +TA    ++++Y  TTK DL   G+ +    +GL L  LV +F+R+
Sbjct: 121 SSASRTDVVLLAFGLTAGITAAMTVYALTTKNDLTMSGAALYSCLWGLLLAGLVGMFVRT 180

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
           SA ++ +SA+G V+FS   AYD Q +       +  A +  + V+GA+ +Y+D I +F+H
Sbjct: 181 SAFNILLSAVGAVVFSVYIAYDVQCL---LGGEHKYAVSPDEYVLGAIAIYLDIINLFMH 237

Query: 250 LLRFLGSRR 258
           +LR L    
Sbjct: 238 ILRLLNEAN 246


>gi|320457924|dbj|BAJ68545.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 300

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 60/239 (25%), Positives = 121/239 (50%), Gaps = 19/239 (7%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
            ++  R  + +VY  M +G+ VT +++ L  I         A+ ++              
Sbjct: 78  YEEARRVSVAKVYGEMTIGILVTAVVAVLGQITGAYYSFLMATGMVGLIG---------- 127

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
                       + + + L +R+  + +  A++M  +Y+AL+G +LSS F+VY   SI  
Sbjct: 128 -------LCVVQIALAVVLGMRVTKMKSATARVMLYMYAALMGFTLSSIFMVYDLGSIGV 180

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              +TAA F +L+++G TTK D+   G  +++G   L +  +V  F++   +   + A+G
Sbjct: 181 ALGVTAAFFFALTMFGMTTKFDMLKAGPILMIGLIVLIISQIVLAFVQVDGMTKIVCAIG 240

Query: 201 LVIFSALTAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           L++F+ +  YD Q  +   ++         ++ S++ AL LY+DF+ +F+++L+ LG+R
Sbjct: 241 LILFAGMAIYDAQSTRALLTEYEAQGPEMVKKISILCALNLYLDFVNMFLYILQLLGNR 299


>gi|189500375|ref|YP_001959845.1| hypothetical protein Cphamn1_1437 [Chlorobium phaeobacteroides BS1]
 gi|189495816|gb|ACE04364.1| protein of unknown function UPF0005 [Chlorobium phaeobacteroides
           BS1]
          Length = 219

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 91/231 (39%), Positives = 139/231 (60%), Gaps = 18/231 (7%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           + +VY  MALGL +T  + F         +   ++  +  G+++   G            
Sbjct: 6   INQVYTWMALGLALTATVGFYTAESQMLRNLIFSNGFVLIGLVVAQLG------------ 53

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
                 + + L+  ++ LS  AA  +F+LYS L GL+LS+ FLVYT  SI  TFFIT+ +
Sbjct: 54  ------IVLALSAGINRLSGSAATGLFILYSGLTGLTLSAVFLVYTYSSIASTFFITSGT 107

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           F ++S++G+TTKRDL  IGS   M   G+ L S+VN+FM++S ++L +S +G+++F+ALT
Sbjct: 108 FAAMSVFGHTTKRDLTKIGSIAFMALIGIILASVVNMFMQNSMLELGISVIGVLLFTALT 167

Query: 209 AYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           AYD Q+IKE  +   D     + SV+GAL LY++FI +F+ LLRFLG  RD
Sbjct: 168 AYDAQRIKEMAAMVTDGESEAKVSVMGALSLYLNFINLFLMLLRFLGVARD 218


>gi|109100970|ref|XP_001089836.1| PREDICTED: transmembrane BAX inhibitor motif-containing protein 1
           isoform 2 [Macaca mulatta]
 gi|109100972|ref|XP_001089952.1| PREDICTED: transmembrane BAX inhibitor motif-containing protein 1
           isoform 3 [Macaca mulatta]
          Length = 311

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 52/256 (20%), Positives = 105/256 (41%), Gaps = 26/256 (10%)

Query: 8   QRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           +R V+   G G   D+ +R  ++ +VY+++++ L +T  +  +     T V+P +A +  
Sbjct: 77  ERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIF----TFVEPVSAFVRR 132

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           N  V    +   + T               I    +          ++  L++  +G   
Sbjct: 133 NVAVYYVSYAVFVVT-------------YLILACCQGPRRRFPWNIILLTLFTFAMGFMT 179

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSL 182
            +   +Y +K+++    ITA    S++++ + TK D         +    L     + S+
Sbjct: 180 GTISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLMVTGIVTSI 239

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           V  F     + +  +A+G + F+   AYDTQ +            +    + GAL +Y D
Sbjct: 240 VLYFKYVYWLHMLYAALGAICFTLFLAYDTQLV----LGNRKHTISPEDYITGALQIYTD 295

Query: 243 FIQIFVHLLRFLGSRR 258
            I IF  +L+ +G R 
Sbjct: 296 IIYIFTFVLQLMGDRN 311


>gi|67517925|ref|XP_658737.1| hypothetical protein AN1133.2 [Aspergillus nidulans FGSC A4]
 gi|3676056|gb|AAC61875.1| unknown [Emericella nidulans]
 gi|40747095|gb|EAA66251.1| conserved hypothetical protein [Aspergillus nidulans FGSC A4]
 gi|259488552|tpe|CBF88078.1| TPA: Putative uncharacterized protein
           [Source:UniProtKB/TrEMBL;Acc:O74710] [Aspergillus
           nidulans FGSC A4]
          Length = 270

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 91/234 (38%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY ++ + L +T +MS +     +  +   +++ +    +   FG L+ T     
Sbjct: 64  QFIRKVYAILTVQLLLTTVMSSISFFSPSYCEWIRSNVWLMMVSVFGAFGFLLVTYWK-- 121

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S  A  +    ++ L   S+S     Y  + +VQ   +T 
Sbjct: 122 ------------------RKSYPANLLFLSAFTILEAYSISVVTSYYQPRIVVQALILTL 163

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFS 205
             F  L+L+   TK D      ++    + L L   V       S ++L   ++  +IFS
Sbjct: 164 GLFVGLTLFACQTKYDFTNWMPYLFGALWFLILFGFVAAFVPHGSTMELIYGSLAALIFS 223

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ I   Y    +        +  ++ LY+D + +F+ +LR L ++ +
Sbjct: 224 GYILVDTQLIMRHYHVEEE--------IAASISLYLDILNLFLAILRILNNQNN 269


>gi|187607245|ref|NP_001120085.1| glutamate receptor, ionotropic, N-methyl D-aspartate-associated
           protein 1 (glutamate binding) [Xenopus (Silurana)
           tropicalis]
 gi|165970821|gb|AAI58527.1| LOC100145094 protein [Xenopus (Silurana) tropicalis]
          Length = 286

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 37/230 (16%), Positives = 86/230 (37%), Gaps = 20/230 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           RA++ +VY  +A+ L +T  +  +        +       I                   
Sbjct: 72  RAFIRKVYLTLAMQLALTVGLICMFIFWKRLKNWVQEYPYIVYA---------------- 115

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +     +   +    +          +   L++A+ G  L +   ++ + +++     T
Sbjct: 116 -LCPAIIILALVLACCQQVRRKVPYNFIFLGLFTAVEGCMLGTIAALFDADAVMWAGGAT 174

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
                 L+++   TK D   +   + +    L    ++   +RS  +++  +++G  IF 
Sbjct: 175 IVVTLGLTIFALQTKWDFTMLSGGLCVALLVLLCFGILCGILRSMYLNIVYASIGTFIFG 234

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
                DTQ I      ++  A +  + +  AL +Y+D I +F+ LL+  G
Sbjct: 235 MYLVVDTQLIV---GGKHRYAVSPEEYIFAALNIYLDIINLFLMLLQIFG 281


>gi|289620694|emb|CBI52825.1| unnamed protein product [Sordaria macrospora]
          Length = 286

 Score =  108 bits (269), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 47/258 (18%), Positives = 91/258 (35%), Gaps = 29/258 (11%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D  +       G        +    ++ +VY ++ + L  TG +S L  +     +    
Sbjct: 56  DEDDIPDDFKFGGSVAEATVEIRHQFIRKVYTILTVQLIATGAVSALSFLSDGYKNWIQ- 114

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
                              S    I++     +   L       S     +    ++ + 
Sbjct: 115 -------------------SHPAMIWVSFAGALVFMLLTFWKRQSYPTNLLFLSGFTLME 155

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
             S+S     + S +++    ITA  F  L+ +   TK D      ++    +GL L S 
Sbjct: 156 AYSISVCVSFFDSATVLLAVVITAGIFVFLTAFACQTKYDFTSWMPYLGGILWGLILTSF 215

Query: 183 VNLF-MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYM 241
           V  F   +S  +L    +  ++FS     DTQ +   +    +        +  A+ LY+
Sbjct: 216 VYAFLPHTSTSELVYGGVAALVFSGYILVDTQLVMRKFHVEEE--------IAAAISLYL 267

Query: 242 DFIQIFVHLLRFLGSRRD 259
           D + +F+ +LR L S+ D
Sbjct: 268 DILNLFLAILRILNSQSD 285


>gi|195485184|ref|XP_002090985.1| GE13413 [Drosophila yakuba]
 gi|194177086|gb|EDW90697.1| GE13413 [Drosophila yakuba]
          Length = 244

 Score =  108 bits (269), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 44/261 (16%), Positives = 96/261 (36%), Gaps = 28/261 (10%)

Query: 7   YQRVVNSGSGFGSTIDQGL--------RAYMIRVYNLMALGLGVTGIMSFLVNILATTVD 58
           YQ+   +G+   +  D+          + ++ +VY ++   L +T     +      + +
Sbjct: 4   YQQGDETGAYTDAEADKSFAFDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQE 63

Query: 59  PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
               +  +    +      ++  +    +    PL                       L+
Sbjct: 64  WVQKNPALFWIALAVLIVTMICMACCESVRRKTPLNFIFLF-----------------LF 106

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
           +      L      Y +  ++    ITAA    L+L+   TK D    G  ++       
Sbjct: 107 TVAESFLLGMVAGQYEADEVLMAVGITAAVALGLTLFALQTKYDFTMCGGVLVACLVVFI 166

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALM 238
           +  ++ +F+    I L  +++G ++FS    YDTQ         +  + +  + +  AL 
Sbjct: 167 IFGIIAIFIPGKVIGLVYASLGALLFSVYLVYDTQL---MLGGNHKYSISPEEYIFAALN 223

Query: 239 LYMDFIQIFVHLLRFLGSRRD 259
           LY+D I IF+++L  +G  R+
Sbjct: 224 LYLDIINIFMYILTIIGLSRN 244


>gi|193599084|ref|XP_001946699.1| PREDICTED: glutamate [NMDA] receptor-associated protein 1-like
           [Acyrthosiphon pisum]
          Length = 323

 Score =  108 bits (269), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 44/252 (17%), Positives = 98/252 (38%), Gaps = 20/252 (7%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
               N+   FG +     + ++ +VY+++   L +T I   +      T         ++
Sbjct: 91  NNSFNAPENFGFSDKTIRKNFICKVYSILMCQLLITLIFVAMATFHEATKLYIREHSGLS 150

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
              ++  FG L+                            +    ++  +++      L+
Sbjct: 151 IIAIIVTFGTLI-----------------ALACCEDLRRKSPTNFILLFVFTLAESFLLA 193

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
                Y    ++    +T     +L+++ + TK D   +G F+ +    L + S+V +F 
Sbjct: 194 VSVSRYYPDQVLLALGLTTLICFALTIFAFQTKIDFTVMGGFLTVAVIVLLVASIVAIFF 253

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIF 247
               + L +++ G +IFS    YDTQ         +  + +  + +  AL +Y+D I IF
Sbjct: 254 PGKLMTLIIASAGAIIFSLYLIYDTQM---MVGGDHKYSISPEEYIFAALTIYVDIINIF 310

Query: 248 VHLLRFLGSRRD 259
           +++L  +G+  D
Sbjct: 311 MYILAIIGASGD 322


>gi|88657820|ref|YP_506844.1| hypothetical protein ECH_0009 [Ehrlichia chaffeensis str. Arkansas]
 gi|88599277|gb|ABD44746.1| putative membrane protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 233

 Score =  108 bits (269), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 90/248 (36%), Positives = 148/248 (59%), Gaps = 21/248 (8%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
           S    G+    GLR Y+++VYN MA+ LG+TGI++F V      +               
Sbjct: 5   SNVQQGAYYSAGLRNYLVKVYNYMAMALGLTGIVAFFVASSPAVI--------------- 49

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
               +++Y +PL W+ +FAP+G+   ++ +L+ LS  A  M+F  ++AL+G+S+S  FLV
Sbjct: 50  ----SMVYNTPLHWVIVFAPMGLVFLMSYKLNVLSFQAILMIFFSFAALVGVSISYVFLV 105

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           YT+ SI + FFI+++ FG ++ YG  TK+DL   G+F+ MG  G+ + SLVNLF+ S  +
Sbjct: 106 YTAASIAKVFFISSSMFGVMAWYGNVTKKDLSQFGTFLFMGVIGIAIASLVNLFLGSGPL 165

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYA--ERQSVIGALMLYMDFIQIFVHL 250
              +S + +V+F+ +TAYD Q+IK+ Y    D   +   + +++GA  LY ++I IF+ L
Sbjct: 166 HFALSVVAVVVFTGMTAYDAQRIKDMYYKFNDGTDSSVNKMAILGATTLYFNYINIFISL 225

Query: 251 LRFLGSRR 258
           L   G R+
Sbjct: 226 LNLQGERK 233


>gi|291392225|ref|XP_002712520.1| PREDICTED: TMBIM1 protein-like [Oryctolagus cuniculus]
          Length = 306

 Score =  108 bits (269), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 49/256 (19%), Positives = 101/256 (39%), Gaps = 26/256 (10%)

Query: 8   QRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           +R V+   G G   D+ +R +++ +VY ++++ L +T  +  +     T V+P    +  
Sbjct: 72  ERAVSDSFGPGEWDDRKVRHSFIRKVYTIISVQLLITVAIIAIF----TFVEPVGKFVRK 127

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           N  V    +   + T                    +          ++  L++  +G   
Sbjct: 128 NVAVYYVSYAVFIVT-------------YLTLACCQGPRRRFPWNIILLTLFTFAMGFMT 174

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSL 182
            +   +Y +K+++    ITA    S++++ + TK D         +    L     +  +
Sbjct: 175 GTISSMYQTKAVILAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLMVTGIVTGI 234

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           V  F     + +  +A+G + F+   AYDTQ +            +    + GAL +Y D
Sbjct: 235 VLYFKYIYWLHMVYAALGAICFTLFLAYDTQLV----LGNRKHTISPEDYITGALQIYTD 290

Query: 243 FIQIFVHLLRFLGSRR 258
            I IF  +L+ +G R 
Sbjct: 291 IIYIFTFVLQLMGDRN 306


>gi|320163945|gb|EFW40844.1| glutamate receptor Gr2 [Capsaspora owczarzaki ATCC 30864]
          Length = 316

 Score =  108 bits (269), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 47/234 (20%), Positives = 92/234 (39%), Gaps = 22/234 (9%)

Query: 26  RAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           R ++ +VY+++ L L V  G ++  +   +          ++   ++LT           
Sbjct: 104 RGFIRKVYSILTLQLLVALGFIALFLFNSSVKHYVQRNQAMLITAIILTF---------- 153

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
                   + +     V           +   L++      L      Y   +++    I
Sbjct: 154 --------VLILAMACVEKIRRQTPYNYIFLGLFTLAESYLLGVTASYYDVDAVLIAVGI 205

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           TA     L+L+ + TK D    G ++      L     + +F+R   + +  +A+G +IF
Sbjct: 206 TAFVTFGLTLFAFQTKWDFTGYGGYLFGALLVLICFGFMCIFIRGEIVRIVYAALGALIF 265

Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           S    YDTQ         + +A +  + V  AL LY+D I +F+ +L  +G+RR
Sbjct: 266 SMYLVYDTQL---MLGGTHKLALSPEEWVFAALNLYLDIINLFLFILSLVGNRR 316


>gi|212704988|ref|ZP_03313116.1| hypothetical protein DESPIG_03056 [Desulfovibrio piger ATCC 29098]
 gi|212671652|gb|EEB32135.1| hypothetical protein DESPIG_03056 [Desulfovibrio piger ATCC 29098]
          Length = 232

 Score =  108 bits (269), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 86/249 (34%), Positives = 134/249 (53%), Gaps = 20/249 (8%)

Query: 13  SGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
           +      +    +  YM +VY  M  GL +T + +F V            +++I   +++
Sbjct: 2   TARTIAQSAVSAVSIYMRQVYMWMTAGLAITAVTAFAVASSPDLQMAILGNMVIMIALIV 61

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
             FG ++  S                    +H +SA  A  +F+ YSAL GL+LSS F+V
Sbjct: 62  AQFGLVIALS------------------AAIHKMSATTATAVFIAYSALTGLTLSSIFVV 103

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           Y   SI   F     +F ++S+YG  TKRDL  +G+F+IMG FG+ + S+VN+F+ SS +
Sbjct: 104 YPIGSIANAFLTATGTFLAMSVYGTVTKRDLTGMGNFLIMGLFGIIIASIVNIFLASSMM 163

Query: 193 DLTMSAMGLVIFSALTAYDTQKIK--EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHL 250
           D  +S +G++IF+ LTAYDTQK++     +   D     R +++GAL LY+DFI +F+ L
Sbjct: 164 DFVISCIGVLIFTGLTAYDTQKLRVFGMNAPVDDATAMRRGALLGALELYLDFINLFLML 223

Query: 251 LRFLGSRRD 259
           LR  G  RD
Sbjct: 224 LRLFGGNRD 232


>gi|317482471|ref|ZP_07941488.1| hypothetical protein HMPREF0177_00882 [Bifidobacterium sp.
           12_1_47BFAA]
 gi|316916131|gb|EFV37536.1| hypothetical protein HMPREF0177_00882 [Bifidobacterium sp.
           12_1_47BFAA]
          Length = 299

 Score =  108 bits (269), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 60/239 (25%), Positives = 121/239 (50%), Gaps = 19/239 (7%)

Query: 21  IDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
            ++  R  + +VY  M +G+ VT +++ L  I         A+ ++              
Sbjct: 77  YEEARRVSVTKVYGEMTIGILVTAVVAVLGQITGAYYSFLMATGMVGLIG---------- 126

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
                       + + + L +R+  + +  A++MF +Y+AL+G +LSS F+VY   SI  
Sbjct: 127 -------LCVVQIALAVVLGMRVTKMKSATARVMFYVYAALMGFTLSSIFMVYDLGSIGV 179

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
               TAA F +L+++G TTK ++   G  +++G   L +  +V  F++   +   + A+G
Sbjct: 180 ALGATAAFFFALTMFGMTTKFNMLKAGPILMIGLIVLIISQIVLAFVQVDGMTKIVCAIG 239

Query: 201 LVIFSALTAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           L++F+ +  YD Q  +   ++         ++ S++ AL LY+DF+ +F+++L+ LG+R
Sbjct: 240 LILFAGMAIYDAQSTRALLTEYEAQGPEMVKKISILCALNLYLDFVNMFLYILQLLGNR 298


>gi|39971245|ref|XP_367013.1| hypothetical protein MGG_03089 [Magnaporthe oryzae 70-15]
 gi|149210839|ref|XP_001522794.1| hypothetical protein MGCH7_ch7g892 [Magnaporthe oryzae 70-15]
 gi|86196847|gb|EAQ71485.1| hypothetical protein MGCH7_ch7g892 [Magnaporthe oryzae 70-15]
 gi|145017058|gb|EDK01421.1| hypothetical protein MGG_03089 [Magnaporthe oryzae 70-15]
          Length = 282

 Score =  108 bits (269), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 46/231 (19%), Positives = 88/231 (38%), Gaps = 29/231 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY+++ + L +TG +S L  +  +  D   A   +    +    G ++ T     
Sbjct: 76  QFIRKVYSILTVQLLITGGVSALGFMSTSYRDWVRAHPGVLWLSLFGAMGMMLLTYW--- 132

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S     +    ++ L   ++S     Y S  ++    +TA
Sbjct: 133 -----------------KRKSYPTNLLFLGGFTLLEAYTISVVVTFYDSSIVLNAVLLTA 175

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV-NLFMRSSAIDLTMSAMGLVIFS 205
             F  L+ + + TK D      ++    +GL L   V      SS  +L   A+  ++FS
Sbjct: 176 GMFVFLTAFAFQTKYDFTSWMPYLFGALWGLVLFGFVAMFLPYSSTAELIYGALAALVFS 235

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
                DTQ +   +    +        +  A+ LY+D I +F+ +LR L S
Sbjct: 236 GYILVDTQLVMRTHHVEEE--------IAAAISLYLDIINLFLAILRILNS 278


>gi|332880894|ref|ZP_08448564.1| hypothetical protein HMPREF9074_04345 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
 gi|332681068|gb|EGJ53995.1| hypothetical protein HMPREF9074_04345 [Capnocytophaga sp. oral
           taxon 329 str. F0087]
          Length = 237

 Score =  108 bits (269), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 78/232 (33%), Positives = 126/232 (54%), Gaps = 20/232 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M  VY  M   L +TG+ +  V   AT +     +  +  G+++                
Sbjct: 24  MRNVYRWMTFALAITGLTAACVAGNATLMQFILGNQAVFLGLII---------------- 67

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
             A L V   L  R+  LS   A ++F+LYS L G +LS+ FLVY   SI  TFF+TA +
Sbjct: 68  --AELVVAFTLIGRVSKLSFTNASLLFILYSILTGATLSTIFLVYEIGSIASTFFVTAGT 125

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SL GY T +DL  +G+++IM   GL + ++ N F+ S+ +D  ++   +++F  LT
Sbjct: 126 FGAMSLVGYFTHKDLSKMGTYLIMALIGLIIATIANWFIASTTLDWGITYALVLVFVGLT 185

Query: 209 AYDTQKIKEAYSDRYDV--AYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQKIK    +         ++ +++G+  LY+DF+ +F+ LL+ LG R+
Sbjct: 186 AYDTQKIKVMLREHGMGLDESTQKLALMGSFTLYLDFLNLFLQLLKILGKRK 237


>gi|159476610|ref|XP_001696404.1| predicted transmembrane protein [Chlamydomonas reinhardtii]
 gi|158282629|gb|EDP08381.1| predicted transmembrane protein [Chlamydomonas reinhardtii]
 gi|294845977|gb|ADF43136.1| NMDA1p [Chlamydomonas reinhardtii]
 gi|294846021|gb|ADF43179.1| NMDA1m [Chlamydomonas reinhardtii]
          Length = 248

 Score =  108 bits (269), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 60/249 (24%), Positives = 115/249 (46%), Gaps = 21/249 (8%)

Query: 11  VNSGSGFGSTIDQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRG 69
           V  G+   +  ++ +R  ++ +V+ L+A+ L +T +++             AA   +   
Sbjct: 18  VEKGAALNAFAERTVRQGFVRKVFGLLAVQLALTTVIAGTFVTSTAVKTFVAAHPWVLML 77

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
            ML GFG L+  +                        S     ++   ++A  G+ + + 
Sbjct: 78  GMLAGFGILLTLTLSSSARQ-----------------SHPTNLILLFAFTAAEGVLVGAA 120

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
                +  ++  F +TA    ++++Y  TTK DL   G+ +    +GL L  LV +F+R+
Sbjct: 121 SSASRTDIVLLAFGLTAGITAAMTVYALTTKNDLTMSGAALYSCLWGLLLAGLVGMFVRT 180

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
           SA ++ +SA+G V+FS   AYD Q +       +  A +  + V+GA+ +Y+D I +F+H
Sbjct: 181 SAFNILLSAVGAVVFSVYIAYDVQCL---LGGEHKYAVSPDEYVLGAIAIYLDIINLFMH 237

Query: 250 LLRFLGSRR 258
           +LR L    
Sbjct: 238 ILRLLNEAN 246


>gi|229577452|ref|NP_081430.3| transmembrane BAX inhibitor motif-containing protein 1 [Mus
           musculus]
 gi|26453457|dbj|BAC43762.1| RECS1 [Mus musculus]
 gi|74184340|dbj|BAE25704.1| unnamed protein product [Mus musculus]
 gi|74222773|dbj|BAE42250.1| unnamed protein product [Mus musculus]
 gi|74225234|dbj|BAE31555.1| unnamed protein product [Mus musculus]
 gi|148667901|gb|EDL00318.1| transmembrane BAX inhibitor motif containing 1, isoform CRA_b [Mus
           musculus]
 gi|148667902|gb|EDL00319.1| transmembrane BAX inhibitor motif containing 1, isoform CRA_b [Mus
           musculus]
 gi|148667903|gb|EDL00320.1| transmembrane BAX inhibitor motif containing 1, isoform CRA_b [Mus
           musculus]
          Length = 309

 Score =  108 bits (269), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 42/261 (16%), Positives = 98/261 (37%), Gaps = 26/261 (9%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
            D    +R  +     G   D+ +R +++ +VY ++++ L +T  +  +   +       
Sbjct: 69  HDYNEEERAGSDSFRPGEWDDRKVRHSFIQKVYCIISVQLLITVAIIAIFTFVEPVGKYV 128

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
             ++ +                          +        +          ++  +++ 
Sbjct: 129 RNNVAVYYVSYAVFL-----------------VTYLTLACCQGPRRRFPWNIILLTIFTL 171

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL--- 177
            +G    +   +Y +K+++    ITA    S++++ + TK D         +    L   
Sbjct: 172 ALGFVTGTISSMYETKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLMVT 231

Query: 178 -FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGA 236
             + S+V +F     + +  +A+G + F+   AYDTQ +            +    + GA
Sbjct: 232 GIVTSIVLIFKYIYWLHMVYAALGAICFTLFLAYDTQLV----LGNRKHTISPEDYITGA 287

Query: 237 LMLYMDFIQIFVHLLRFLGSR 257
           L +Y D + IF  +L+ +GSR
Sbjct: 288 LQIYTDIVYIFTFVLQLVGSR 308


>gi|198429964|ref|XP_002129111.1| PREDICTED: similar to NMDA receptor glutamate-binding chain isoform
           2 [Ciona intestinalis]
          Length = 311

 Score =  108 bits (269), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 43/247 (17%), Positives = 89/247 (36%), Gaps = 24/247 (9%)

Query: 15  SGFGSTIDQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
           +  GS  D+ +R  ++ +VY  + L L VT  +  +   + +      A+  +       
Sbjct: 86  TTRGSFDDKSVRRLFIRKVYITLGLQLLVTFGIVCIFTFIPSVKTFIRANSAMYYVAYAI 145

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
                +       +                         ++  +++  +   + +    Y
Sbjct: 146 FLALYIALVCCPNVR-----------------RKHPTNIIVLAIFTLALSYMVGTIASFY 188

Query: 134 TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAID 193
            + S+V    IT     +++L+   TK D       + +    L L   V +F  + +  
Sbjct: 189 DTMSVVIALGITVGVCVAVTLFSLQTKFDFTKCSGLLFVLVLVLMLFGFVTIFTWNKSWY 248

Query: 194 LTMSA--MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLL 251
           L +    +G ++F+   A+DTQ I               + + GAL LY+D + IF+ +L
Sbjct: 249 LHVVYGSLGALVFTLFLAFDTQLIM----GGKRYELDPEEYIYGALNLYIDVVYIFIFIL 304

Query: 252 RFLGSRR 258
              GS  
Sbjct: 305 SIFGSSN 311


>gi|197100170|ref|NP_001124723.1| transmembrane BAX inhibitor motif-containing protein 1 [Pongo
           abelii]
 gi|55725673|emb|CAH89618.1| hypothetical protein [Pongo abelii]
          Length = 311

 Score =  108 bits (269), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 52/256 (20%), Positives = 105/256 (41%), Gaps = 26/256 (10%)

Query: 8   QRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           +R V+   G G   D+ +R  ++ +VY+++++ L +T  +  +     T V+P +A +  
Sbjct: 77  ERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIF----TFVEPVSAFVRR 132

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           N  V    +   + T               I    +          ++  L++  +G   
Sbjct: 133 NVAVYYVSYAVFVVT-------------YLILACCQGPRRRFPWNIILLTLFTFAMGFMT 179

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSL 182
            +   +Y +K+++    ITA    S++++ + TK D         +    L     + S+
Sbjct: 180 GTISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLMVTGIVTSI 239

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           V  F     + +  +A+G + F+   AYDTQ +            +    + GAL +Y D
Sbjct: 240 VLYFQYVYWLHMLYAALGAICFTLFLAYDTQLV----LGNRKHTISPEDYITGALQIYTD 295

Query: 243 FIQIFVHLLRFLGSRR 258
            I IF  +L+ +G R 
Sbjct: 296 IIYIFTFVLQLMGDRN 311


>gi|297683864|ref|XP_002819585.1| PREDICTED: glutamate [NMDA] receptor-associated protein 1-like,
           partial [Pongo abelii]
          Length = 259

 Score =  108 bits (269), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 96/234 (41%), Gaps = 21/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           +A++ +V+ ++ L L VT     +   +A        ++          F +L+  S   
Sbjct: 47  QAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVRENVWTYYVSYAVFFISLIVLSCCG 106

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      +   + +A +   +      Y +++++    IT
Sbjct: 107 -----------------DFRRKHPWNLVALSVLTASLSYMVGMIASFYNTEAVIMAVGIT 149

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
            A   ++ ++   T+ D       +++    LF+ +++ +F+R+  +++  +++G ++F+
Sbjct: 150 TAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLGALLFT 209

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
              A DTQ +         ++ +  + V  AL LY D I IF+++L  +G  ++
Sbjct: 210 CFLAVDTQLL----LGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 259


>gi|313230915|emb|CBY18912.1| unnamed protein product [Oikopleura dioica]
          Length = 248

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/231 (18%), Positives = 97/231 (41%), Gaps = 28/231 (12%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++ +VY ++ + + +T  +S +            A+  I     +  FG L+        
Sbjct: 45  FLRKVYGILTVQILMTIGVSAICMAFDPVKVFLQANPAIPAVSGIGCFGLLIAL------ 98

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
                          +H  +     ++   ++ L  +S+++    Y +  +++   IT +
Sbjct: 99  --------------MIHRRNFPTNFILLGAFTFLESISIATIVTYYQTPVVIRACLITLS 144

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
            F  L+ +   +K+D    G+ +    + L  +SL+++F  +  +D  +S  G  +FS  
Sbjct: 145 VFCLLTSFTLQSKKDYSSWGAALFSFLWILIGVSLMHIFFPTEIMDTVISFGGAALFSLF 204

Query: 208 TAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             YDT  +            +  + +  A+ LY+D + +F+H+LR LG+ R
Sbjct: 205 IIYDTHMLMR--------RLSAEEYIFAAINLYLDILNLFLHILRILGNDR 247


>gi|38503325|sp|Q8BJZ3|TMBI1_MOUSE RecName: Full=Transmembrane BAX inhibitor motif-containing protein
           1; AltName: Full=Responsive to centrifugal force and
           shear stress gene 1 protein; Short=Protein RECS1
 gi|26346617|dbj|BAC36957.1| unnamed protein product [Mus musculus]
          Length = 309

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/261 (16%), Positives = 98/261 (37%), Gaps = 26/261 (9%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
            D    +R  +     G   D+ +R +++ +VY ++++ L +T  +  +   +       
Sbjct: 69  HDYNEEERAGSDSFRPGEWDDRKVRHSFIQKVYCIISVQLLITVAIIAIFTFVEPVGKYV 128

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
             ++ +                          +        +          ++  +++ 
Sbjct: 129 RNNVAVYYVSYAVFL-----------------VTYLTLACCQGPRRRFPWDIILLTIFTL 171

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL--- 177
            +G    +   +Y +K+++    ITA    S++++ + TK D         +    L   
Sbjct: 172 ALGFVTGTISSMYENKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVLMVT 231

Query: 178 -FLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGA 236
             + S+V +F     + +  +A+G + F+   AYDTQ +            +    + GA
Sbjct: 232 GIVTSIVLIFKYIYWLHMVYAALGAICFTLFLAYDTQLV----LGNRKHTISPEDYITGA 287

Query: 237 LMLYMDFIQIFVHLLRFLGSR 257
           L +Y D + IF  +L+ +GSR
Sbjct: 288 LQIYTDIVYIFTFVLQLVGSR 308


>gi|323343961|ref|ZP_08084188.1| protein of hypothetical function UPF0005 [Prevotella oralis ATCC
           33269]
 gi|323095780|gb|EFZ38354.1| protein of hypothetical function UPF0005 [Prevotella oralis ATCC
           33269]
          Length = 238

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 80/234 (34%), Positives = 136/234 (58%), Gaps = 19/234 (8%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A M +VY  M + L +TG+ ++ V      +    +  +   G+++              
Sbjct: 23  ALMRKVYVWMTMALVITGLTAYGVASNTQLMMAIWSHQVFLFGLII-------------- 68

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
               A L +   ++  ++ LS   A ++F+LYSA  G++LS+ F+VY+   I + FFITA
Sbjct: 69  ----AELAMVFAISAAINRLSLTMATLLFILYSAFNGVTLSAIFVVYSPVIITKVFFITA 124

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
            +FG+++ YGY TKRDL  IG  + M   GL + ++VNLF++S+A DL +S +G+++F  
Sbjct: 125 GTFGAMAAYGYFTKRDLTSIGRLLFMALIGLIIATVVNLFLKSAAFDLILSYIGVLVFVG 184

Query: 207 LTAYDTQKIKEAYSDRYDV-AYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           LTA+D+QKIK   + +  +   A + +++GAL LY+DFI +F++LLR  G   +
Sbjct: 185 LTAWDSQKIKRMLAMQTSMDENAMKIALLGALSLYLDFINLFLYLLRIFGRSNN 238


>gi|126138736|ref|XP_001385891.1| hypothetical protein PICST_84906 [Scheffersomyces stipitis CBS
           6054]
 gi|126093169|gb|ABN67862.1| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 252

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 47/234 (20%), Positives = 95/234 (40%), Gaps = 30/234 (12%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++ +VY+L+A+ +  T ++ F++    +  +   +++ +    M+   G L+ T      
Sbjct: 47  FIRKVYSLLAIQILGTVLVGFIIRSSPSIKEWCFSNMWLFAITMIGSIGFLVAT------ 100

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
                            + S      +   ++      +        S  ++Q   +T  
Sbjct: 101 --------------HFKARSYPTNLFLLGGFTLCEAYLIGLCCAFVESDILIQALLLTFF 146

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM--RSSAIDLTMSAMGLVIFS 205
            F  L+L+ + TK D       + MG + L    LV +F    S  I+L  S +G +IFS
Sbjct: 147 IFIGLTLFAFQTKYDFTSWQGIVGMGLWALIGWGLVMIFFPGHSKTIELIYSGLGALIFS 206

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ+I +      +        ++  + LY+D + +F+ +LR L +R D
Sbjct: 207 VYIIIDTQQIMKTAHLDDE--------IVSTIQLYLDVVNLFLFILRILNNRND 252


>gi|194883508|ref|XP_001975843.1| GG22543 [Drosophila erecta]
 gi|190659030|gb|EDV56243.1| GG22543 [Drosophila erecta]
          Length = 244

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/261 (16%), Positives = 96/261 (36%), Gaps = 28/261 (10%)

Query: 7   YQRVVNSGSGFGSTIDQGL--------RAYMIRVYNLMALGLGVTGIMSFLVNILATTVD 58
           YQ+   +G+   +  D+          + ++ +VY ++   L +T     +      + +
Sbjct: 4   YQQGDETGAYTDAEADKSFAFDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQE 63

Query: 59  PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
               +  +    +      ++  +    +    PL                       L+
Sbjct: 64  WVQKNPALFWIALAVLIVTMICMACCESVRRKTPLNFIFLF-----------------LF 106

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
           +      L      Y +  ++    ITAA    L+L+   TK D    G  ++       
Sbjct: 107 TVAESFLLGMVAGQYQADEVLMAVGITAAVALGLTLFALQTKYDFTMCGGVLVACLVVFI 166

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALM 238
           +  ++ +F+    I L  +++G ++FS    YDTQ         +  + +  + +  AL 
Sbjct: 167 IFGIIAIFIPGKVIGLVYASLGALLFSVYLVYDTQL---MLGGNHKYSISPEEYIFAALN 223

Query: 239 LYMDFIQIFVHLLRFLGSRRD 259
           LY+D I IF+++L  +G  R+
Sbjct: 224 LYLDIINIFMYILTIIGLSRN 244


>gi|15805918|ref|NP_294617.1| hypothetical protein DR_0893 [Deinococcus radiodurans R1]
 gi|15214376|sp|Q9RVX8|Y893_DEIRA RecName: Full=Uncharacterized protein DR_0893
 gi|6458614|gb|AAF10471.1|AE001942_3 conserved hypothetical protein [Deinococcus radiodurans R1]
          Length = 231

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 80/235 (34%), Positives = 124/235 (52%), Gaps = 22/235 (9%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           +R +M R Y+ MA GL +T  +++L                          G  M  + L
Sbjct: 19  VRTFMARTYSWMAAGLALTAGVAYLTAQNE---------------------GLAMQVASL 57

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
           R   + A L +   L++    LSA  A  +F+ Y+AL GL+ S+    Y+  +++  F +
Sbjct: 58  RLPLMLAQLALVFVLSMFAQRLSAAVAGALFVGYAALTGLTFSALLFAYSPAAVITAFAV 117

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           +A +FG +S+ G+  K+DL  +G F +    GL +  LVNLF+ SSA+ L +S +G+ +F
Sbjct: 118 SAGTFGLMSVAGFVIKKDLSAMGRFFLFAVLGLVVAMLVNLFVGSSALSLGISMIGVFLF 177

Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           + LTAYDTQ ++           AER S+ GAL LY+DFI IF+ LL   G+ RD
Sbjct: 178 AGLTAYDTQMLRNLALSGISGEQAERASINGALALYLDFINIFLFLLNI-GNSRD 231


>gi|194754513|ref|XP_001959539.1| GF11999 [Drosophila ananassae]
 gi|190620837|gb|EDV36361.1| GF11999 [Drosophila ananassae]
          Length = 247

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/267 (17%), Positives = 99/267 (37%), Gaps = 28/267 (10%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGL--------RAYMIRVYNLMALGLGVTGIMSFLVNI 52
           MS   ++Q    +G+   +  D+          + ++ +VY ++   L +T     +   
Sbjct: 1   MSSDNHFQYGDETGAYTDAEADKSFAFDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTF 60

Query: 53  LATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAK 112
              + +    +  +    +      ++  +    +    PL                   
Sbjct: 61  SKASQEWVQKNPALFWIALAVLIVTMICMACCESVRRKTPLNFIFLF------------- 107

Query: 113 MMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIM 172
               L++      L      Y +  ++    ITAA    L+L+   TK D    G  ++ 
Sbjct: 108 ----LFTVAESFLLGMVAGQYEANEVLMAVGITAAVALGLTLFALQTKWDFTMCGGVLVA 163

Query: 173 GAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQS 232
                 +   V +F+  S I +  +++G ++FS    YDTQ +       +  + +  + 
Sbjct: 164 CLVVFVIFGFVAIFVAGSVIHMVYASLGALLFSVYLVYDTQLMM---GGSHKYSISPEEY 220

Query: 233 VIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +  AL LY+D I IF+++L  +G  R+
Sbjct: 221 IFAALNLYLDIINIFMYILAIIGLSRN 247


>gi|258649258|ref|ZP_05736727.1| membrane protein [Prevotella tannerae ATCC 51259]
 gi|260850443|gb|EEX70312.1| membrane protein [Prevotella tannerae ATCC 51259]
          Length = 236

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 87/247 (35%), Positives = 128/247 (51%), Gaps = 20/247 (8%)

Query: 14  GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
                ++      A M  VY  MAL L +TG+M+  V      V    A+  +  G++L 
Sbjct: 8   NYTSTASRPAAFAALMRDVYAWMALALSLTGLMAMFVVQQPQLVQLIFANRFVFYGLLLA 67

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
             G                  + ++L+  L  +S   A ++F+LYS L G +LS  F VY
Sbjct: 68  EVG------------------LVMYLSACLMEMSFAKAGILFVLYSILNGATLSCVFFVY 109

Query: 134 TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAID 193
           T++SI  TFF+TA  FG+L+L G   KRDL   G F+ M   GL + S+VNLF  SS + 
Sbjct: 110 TTESIAVTFFVTAGMFGALALLGTFIKRDLSSFGRFLYMALIGLIIASVVNLFFASSTLY 169

Query: 194 LTMSAMGLVIFSALTAYDTQKIKEAYSDRYDV--AYAERQSVIGALMLYMDFIQIFVHLL 251
              +  G+ IF  LT YDT+KI+E      +     + + ++IG+L LY+DFI +F++LL
Sbjct: 170 WITTYAGVFIFIGLTVYDTKKIRELLYLYGEERNEESMKMALIGSLQLYLDFINLFLYLL 229

Query: 252 RFLGSRR 258
           R  G RR
Sbjct: 230 RIFGRRR 236


>gi|56090429|ref|NP_001007714.1| transmembrane BAX inhibitor motif-containing protein 1 [Rattus
           norvegicus]
 gi|50925671|gb|AAH79087.1| Transmembrane BAX inhibitor motif containing 1 [Rattus norvegicus]
 gi|149016100|gb|EDL75346.1| transmembrane BAX inhibitor motif containing 1, isoform CRA_a
           [Rattus norvegicus]
 gi|149016101|gb|EDL75347.1| transmembrane BAX inhibitor motif containing 1, isoform CRA_a
           [Rattus norvegicus]
 gi|149016102|gb|EDL75348.1| transmembrane BAX inhibitor motif containing 1, isoform CRA_a
           [Rattus norvegicus]
          Length = 309

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/261 (16%), Positives = 101/261 (38%), Gaps = 26/261 (9%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
            D    +R  +   G G   D+ +R  ++ +VY ++++ L +T  +  +   +    +  
Sbjct: 69  HDYSEEERAGSDSFGPGEWDDRKVRHTFIQKVYCIISVQLLITVAIIAVFTFVEPVSEYV 128

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
            +++ +                          +   I +  +          ++  +++ 
Sbjct: 129 RSNVAVYYVSYAVFI-----------------VTYLILVCCQGPRRRFPWNIILLTIFTL 171

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
            +G    +   +Y +K+++    ITA    S++++ + TK D       + +    L + 
Sbjct: 172 ALGFMTGAISSMYETKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLICVLGIVLAVT 231

Query: 181 ----SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGA 236
               S+V  F     + +  + +G + F+   AYDTQ +            +    + GA
Sbjct: 232 GAVTSVVLFFEYIYWLHMVYAGLGAICFTLFLAYDTQLV----LGNRKHTISPEDYITGA 287

Query: 237 LMLYMDFIQIFVHLLRFLGSR 257
           L +Y D + IF  +L+ +G+R
Sbjct: 288 LQIYTDIVYIFTFVLQLVGNR 308


>gi|332206607|ref|XP_003252389.1| PREDICTED: glutamate [NMDA] receptor-associated protein 1-like
           [Nomascus leucogenys]
          Length = 313

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/233 (19%), Positives = 96/233 (41%), Gaps = 20/233 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           RA++I+V+ L++  L +T +++ +             +      +    F  L+  +   
Sbjct: 101 RAFIIKVFLLLSFQLLLTAVITGVFIFWEALKVWVLKNPWFIYTIFPAFFAVLIILACCG 160

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +                      A  ++  L++AL GL L +  + Y ++ ++     T
Sbjct: 161 NLR-----------------RQVPANYILLGLFTALQGLLLGAISVFYKAEEVLWATAAT 203

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
                +L+L+   TK D   +   + +  F L +  ++ +F+RS  + L  + +G V+FS
Sbjct: 204 TLVTLALTLFALQTKWDFTLLNGALFVFCFVLLIYGIILIFVRSYWLHLLYAGLGTVLFS 263

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
                D Q         +  +    + V  AL +Y+D I +F+ +LR +G  R
Sbjct: 264 LYLVMDVQL---MLGGHHHYSLNPEEYVFAALNIYLDIINLFIFILRLIGLGR 313


>gi|149711090|ref|XP_001491439.1| PREDICTED: similar to transmembrane BAX inhibitor motif containing
           1 isoform 1 [Equus caballus]
          Length = 316

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/256 (16%), Positives = 100/256 (39%), Gaps = 26/256 (10%)

Query: 8   QRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           +R V+   G G   D+ +R A++ +VY+++++ L +T  +  +   +    +    ++ +
Sbjct: 82  ERAVSDSFGAGEWDDRKVRHAFIRKVYSIISIQLLITVAIIAIFTFVRPVGEFVRKNLFV 141

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                                     +        +          ++  +++  +G   
Sbjct: 142 YYISYAVFL-----------------VTYLTLACCQGPRRRFPWNIILLTIFTLALGFMT 184

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
            +   VY +K+++    ITA    S++++ + TK D         +    + +  +V   
Sbjct: 185 GTISSVYETKAVIIAMIITAVVSISVTVFCFQTKVDFTSCTGLFCVLGIVMMVTGIVTAI 244

Query: 187 MRS----SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           + S      + +  +A+G + F+   AYDTQ +            +    + GAL +Y D
Sbjct: 245 VLSFKYIYWLHMVYAALGAICFTLFLAYDTQLV----LGNRSHTISPEDYITGALQIYTD 300

Query: 243 FIQIFVHLLRFLGSRR 258
            I IF  +L+ +G+R 
Sbjct: 301 IIYIFTFVLQLVGNRN 316


>gi|320537870|ref|ZP_08037785.1| hypothetical protein HMPREF9554_02539 [Treponema phagedenis F0421]
 gi|320145289|gb|EFW36990.1| hypothetical protein HMPREF9554_02539 [Treponema phagedenis F0421]
          Length = 234

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 76/233 (32%), Positives = 122/233 (52%), Gaps = 18/233 (7%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           + ++  VY  M   L ++G  +FLV      +     + ++  G+++             
Sbjct: 20  QRFLAAVYGWMVAALAISGFSAFLVINSEAALLFIFGNKLVFFGLII------------- 66

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                A + +   L+  +  +S   A + F+ YS L G++LS+ F +YT  SI + F  T
Sbjct: 67  -----AEVLLVAGLSAGIRKISFTTAALAFIGYSILNGITLSAIFFIYTGGSITRIFLTT 121

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A  F  +S+YG TT  DL   G ++IM   GL + SLVN+F+RSS+ D  +S + + +F+
Sbjct: 122 ALMFSVMSIYGMTTNTDLNSAGRYLIMAVIGLVIASLVNMFLRSSSFDWLLSFITVGVFT 181

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            LTAYD+QKI +            + ++IGAL LY+DFI IF+ LLR  G +R
Sbjct: 182 GLTAYDSQKILQISQHARQDDAYRKVALIGALKLYLDFINIFLALLRLFGKKR 234


>gi|163789887|ref|ZP_02184323.1| predicted inner membrane protein [Carnobacterium sp. AT7]
 gi|159874827|gb|EDP68895.1| predicted inner membrane protein [Carnobacterium sp. AT7]
          Length = 236

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 76/252 (30%), Positives = 117/252 (46%), Gaps = 18/252 (7%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
                     +     L  +   +Y  M LGL +TGI +F  +  +  ++    +     
Sbjct: 2   NTPRREVSNQAVNTTSLSKFFASIYIYMTLGLSITGITAFYASQSSFILNLVFGTRFGML 61

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
              +     +M  +                        SA A+ + F+ ++ + G++LSS
Sbjct: 62  AFFIAEIALVMKLASNG-----------------AKLRSASASIIGFIAFAVINGITLSS 104

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFM 187
            FL+Y   SI   F  TAASF  +SL G+TTK+DL  +G  +     GL +  LVN  F+
Sbjct: 105 IFLMYDLGSIGAAFISTAASFAGMSLVGFTTKKDLTTLGGQLRGALIGLIIAMLVNGFFL 164

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIF 247
           +S   D+ +S + +VIF   TAYDTQK+K+ Y+           ++ GAL LY+DFI IF
Sbjct: 165 KSGPADMVLSFITVVIFIGFTAYDTQKLKDLYTRYSGEQNLGALAISGALSLYLDFINIF 224

Query: 248 VHLLRFLGSRRD 259
           + LLR  G  RD
Sbjct: 225 IGLLRIFGGGRD 236


>gi|330997501|ref|ZP_08321350.1| hypothetical protein HMPREF9442_02449 [Paraprevotella xylaniphila
           YIT 11841]
 gi|329570532|gb|EGG52256.1| hypothetical protein HMPREF9442_02449 [Paraprevotella xylaniphila
           YIT 11841]
          Length = 237

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 78/232 (33%), Positives = 127/232 (54%), Gaps = 20/232 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M  VY  M   L +TG+ +  V   AT +     +  +  G+++                
Sbjct: 24  MRNVYRWMTFALAITGLTAACVAGNATLMQFILGNQAVFLGLII---------------- 67

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
             A L V   L  R+  LS   A ++F+LYS L G++LS+ FLVY   SI  TFF+TA +
Sbjct: 68  --AELVVAFTLIGRVSKLSFTNASLLFILYSILTGVTLSTIFLVYEIGSIASTFFVTAGT 125

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG++SL GY T +DL  +G+++IM   GL + ++ N F+ S+ +D  ++   +++F  LT
Sbjct: 126 FGTMSLVGYFTHKDLSKMGTYLIMALIGLIIATIANWFIASTTLDWGITYALVLVFVGLT 185

Query: 209 AYDTQKIKEAYSDRYDV--AYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQKIK    +         ++ +++G+  LY+DF+ +F+ LL+ LG R+
Sbjct: 186 AYDTQKIKAMLREHGMGLDESTQKLALMGSFTLYLDFLNLFLQLLKILGKRK 237


>gi|148222785|ref|NP_001086255.1| MGC84338 protein [Xenopus laevis]
 gi|49256307|gb|AAH74388.1| MGC84338 protein [Xenopus laevis]
          Length = 311

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/234 (18%), Positives = 84/234 (35%), Gaps = 25/234 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++   L VT  +  L     T  +P    I  N G     +     T    
Sbjct: 96  RGFIRKVYTILTTQLLVTVAVVALF----TFCNPVKEYIQANPGWYWASYAVFFST---- 147

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                      +               ++  +++  I          Y +KS++    IT
Sbjct: 148 ---------YLVLACCSGPRRKFPWNLILLCIFTLSIAYMTGMLSSYYNTKSVILCLGIT 198

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSLVNLFMRSSAIDLTMSAMGL 201
           A    S++L+ + +K D       + + +  L      + ++  F            +G 
Sbjct: 199 ALVCMSVTLFSFQSKIDFTSCQGVLFVLSMVLLFSGIFIVILIPFQYIPWGHAIYGVLGA 258

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           ++F+   A+DTQ +          + +  + + GAL +Y+D I IF  LL+  G
Sbjct: 259 IVFTMFLAFDTQLLM----GSRRYSLSPEEYIFGALNIYLDIIYIFSFLLQLFG 308


>gi|296205572|ref|XP_002749826.1| PREDICTED: transmembrane BAX inhibitor motif-containing protein
           1-like [Callithrix jacchus]
          Length = 311

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 48/256 (18%), Positives = 104/256 (40%), Gaps = 26/256 (10%)

Query: 8   QRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           +R V+   G G   D+ +R  ++ +VY+++++ L +T  +  +     T V+P +A +  
Sbjct: 77  ERAVSDSFGAGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIF----TFVEPVSAFVRK 132

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
           N  V    +   +             +        +          ++  L++  +G   
Sbjct: 133 NVAVYYVSYAVFI-------------ITYLTLACCQGPRRRFPWNIILLTLFTFAMGFMT 179

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSL 182
            +   +Y +++++    ITA    +++++ + TK D         +    L     + S+
Sbjct: 180 GTISSMYQTRAVIIAMIITAVVSIAVTIFCFQTKVDFTSCTGLFCVLGIVLMVTGIVTSI 239

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           V  F     + +  +A+G + F+   AYDTQ +            +    + GAL +Y D
Sbjct: 240 VLYFKYIYWLHMLYAALGAICFTLFLAYDTQLV----LGNRKHTISPEDYITGALQIYTD 295

Query: 243 FIQIFVHLLRFLGSRR 258
            I IF  +L+ +G R 
Sbjct: 296 IIYIFTFVLQLMGDRN 311


>gi|149705933|ref|XP_001493356.1| PREDICTED: similar to N-methyl-D-aspartate receptor-associated
           protein CG3798-PC [Equus caballus]
          Length = 444

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/254 (17%), Positives = 97/254 (38%), Gaps = 20/254 (7%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA 61
           +I       ++ +  G   D  +R A++++V+ +++  L VT  ++ +            
Sbjct: 63  EISEETTQDDNNAAAGPFSDSSVRRAFIVKVFLILSAQLVVTVAITSVFVFWKALRVWVR 122

Query: 62  ASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
                   ++   F  L+  +    I                         ++  +++ L
Sbjct: 123 NHAWFTYAILPAFFVVLIILACCGKIR-----------------RQVPGNYILLGVFTVL 165

Query: 122 IGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS 181
            GL L +  + Y ++ ++     TA    SL+L+   TK D   +   + +  F L +  
Sbjct: 166 QGLLLGAVTVFYNAEEVLWATAATALLTLSLTLFALQTKWDFTLLNGVLFVLLFVLLIFG 225

Query: 182 LVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYM 241
           +  +F+RS    L  + +G V+FS     D Q +       +       + V  AL +Y+
Sbjct: 226 IFLIFIRSYWAQLLYAGLGTVVFSLYMVMDVQLMVG--GQHHHSDLDPEEYVFAALNIYL 283

Query: 242 DFIQIFVHLLRFLG 255
           D I + + +L  +G
Sbjct: 284 DIINLLLFILELIG 297


>gi|310797737|gb|EFQ32630.1| hypothetical protein GLRG_07644 [Glomerella graminicola M1.001]
          Length = 280

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/244 (20%), Positives = 90/244 (36%), Gaps = 30/244 (12%)

Query: 14  GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
           GS   +TID     ++ +VY ++ + L VTG +S +  +         A           
Sbjct: 62  GSVAEATIDIR-NQFIRKVYAILTVQLLVTGGVSTISFLNDGYKAWIQAH---------- 110

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
                        +F      + + L       S     +    ++ +   S+S     Y
Sbjct: 111 ----------PGLVFGSLLGAMVMMLLTFWKRKSYPTNLLFLSAFTLMEAYSISVIVSFY 160

Query: 134 TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV-NLFMRSSAI 192
               ++   F+TA  F  L+ +   TK D      ++    + L + S +   F  SS  
Sbjct: 161 KVGLVLNALFLTAGIFIFLTAFACQTKYDFTSWVPYLGGALWALVIFSFMYMFFPSSSTG 220

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
           +L    +  +IFSA    DTQ I   +    +        +  ++ LY+D I +F+ +LR
Sbjct: 221 ELVYGGIAALIFSAYILVDTQLIMRHHHVEEE--------IAASISLYLDIINLFLAILR 272

Query: 253 FLGS 256
            L S
Sbjct: 273 ILNS 276


>gi|301167689|emb|CBW27272.1| putative transmembrane protein [Bacteriovorax marinus SJ]
          Length = 236

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 88/248 (35%), Positives = 134/248 (54%), Gaps = 22/248 (8%)

Query: 15  SGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           +    +I +    +M  VY  M+ G+ +T  +SF V+     V     +  I  G+++  
Sbjct: 7   TRSEQSISEENARFMSGVYKWMSFGIILTSFISFYVSQSKELVSLIIGNKFIFYGLLIAQ 66

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
            GA+ Y S                   ++ ++S+ AA +++LLY+AL GL+LS  FL+YT
Sbjct: 67  LGAVFYLS------------------AKVKTISSMAATIIYLLYAALTGLTLSLIFLIYT 108

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS---SA 191
           S+SI   F +TA SF  LSL+GY TKRDLGPIG+F  M  +G+    ++ +F  S   S 
Sbjct: 109 SESIQSAFILTAFSFAGLSLFGYVTKRDLGPIGTFCHMALWGMIGFGILTIFFPSLMTSG 168

Query: 192 IDLTMSAMGLVIFSALTAYDTQKIKE-AYSDRYDVAYAERQSVIGALMLYMDFIQIFVHL 250
                   G++IFS LTAYDTQKIK              ++++ GAL LY+DFI +F+ +
Sbjct: 169 ASKIYGICGVLIFSGLTAYDTQKIKSSNIIGNEGTDEDRKETIYGALTLYLDFINLFLSI 228

Query: 251 LRFLGSRR 258
           LR +G R+
Sbjct: 229 LRLMGRRK 236


>gi|99034725|ref|ZP_01314657.1| hypothetical protein Wendoof_01000528 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 247

 Score =  107 bits (267), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 93/248 (37%), Positives = 147/248 (59%), Gaps = 25/248 (10%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MS +RN Q + + G  + +    GLR+Y+ +VYN MAL LGVTG+++FL           
Sbjct: 8   MSYMRNEQDIRSQGVYYSA----GLRSYLTKVYNYMALALGVTGLVAFLTVFSGL----- 58

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                         F  +     L  + + +P+ +  +++ R+  LSA +A  +F  +S 
Sbjct: 59  --------------FQVIYSNPVLSLVVMLSPVALVFYMSYRIQHLSAQSAVTIFFSFSV 104

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLS  F+VYT+++I + FFIT+  F S++LYG TTKRDL  +GSF+IMG +GL + 
Sbjct: 105 LMGLSLSYVFIVYTAENIARAFFITSIMFSSMALYGNTTKRDLTSMGSFLIMGVWGLIIA 164

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVA--YAERQSVIGALM 238
           S+VNLF+ SS +   +S + +++F+ +TAYD Q+IK+ Y    D +     + +++GA  
Sbjct: 165 SIVNLFLGSSPLHFAISFISVIVFTLMTAYDAQRIKDVYYKHNDGSEVATTKLAILGATN 224

Query: 239 LYMDFIQI 246
           LY DFI I
Sbjct: 225 LYFDFINI 232


>gi|320589442|gb|EFX01903.1| bax inhibitor family protein [Grosmannia clavigera kw1407]
          Length = 285

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 92/255 (36%), Gaps = 29/255 (11%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N       G             ++ +VY ++ + L  T  +S +            +   
Sbjct: 58  NMPDDFKFGGSVAEATIDIRNQFVRKVYAILTVQLLATMALSAVSFFSDGYRTWIQSHPG 117

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           +   V ++ FGA+ +     W                    S     +    ++ L   S
Sbjct: 118 L---VFVSLFGAMGFLGLTYWKRK-----------------SYPTNLLFLAGFTFLEAYS 157

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL-SLVN 184
           +S     Y +  ++    +TA  F  L+L+   TK D      ++  G +GL L   +  
Sbjct: 158 VSVIVSFYNASIVLNAVVLTAGIFVFLTLFACQTKYDFTSWMPYLFGGLWGLILFGFMAM 217

Query: 185 LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
            F  +S  +L    +  +IFS     DTQ +   +    +        +  A+ LY+D I
Sbjct: 218 FFPYNSTAELIYGGLTALIFSGYILVDTQLVLRKHHIEEE--------IAAAISLYLDII 269

Query: 245 QIFVHLLRFLGSRRD 259
            +F+ +LR L S+++
Sbjct: 270 NLFLAILRILNSQQN 284


>gi|297289835|ref|XP_002803605.1| PREDICTED: glutamate [NMDA] receptor-associated protein 1-like,
           partial [Macaca mulatta]
          Length = 308

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/233 (19%), Positives = 94/233 (40%), Gaps = 20/233 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           RA++I+V+ L++  L +T +++ +             +           F  L+  +   
Sbjct: 96  RAFIIKVFLLLSAQLLLTAVITSVFIFWEALKVWVLKNPWFIYATFPAFFVVLIILACCG 155

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +                      A  ++   ++AL GL L +  + Y ++ ++     T
Sbjct: 156 NLR-----------------RQVPANYILLGFFTALEGLLLGAISVFYKAEEVLWATAAT 198

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
                +L+L+   TK D   +   + +  F L +  ++ +F+RS  + L  + +G V+FS
Sbjct: 199 TLVTLALTLFALQTKWDFTLLNGVLFVFCFVLLIYGIILIFVRSYWLHLLYAGLGTVLFS 258

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
                D Q         +  +    + V  AL +Y+D I +F+ +LR +G  R
Sbjct: 259 FYLVMDVQL---MLGGHHHYSLDPEEYVFAALNIYLDIINLFIFILRLIGLGR 308


>gi|73667550|ref|YP_303566.1| hypothetical protein Ecaj_0937 [Ehrlichia canis str. Jake]
 gi|72394691|gb|AAZ68968.1| protein of unknown function UPF0005 [Ehrlichia canis str. Jake]
          Length = 234

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 87/252 (34%), Positives = 144/252 (57%), Gaps = 21/252 (8%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
              ++     +    GLR Y+++VYN MA+ LG+TGI++F V+  +              
Sbjct: 2   DNYSNVRFQSAYYSVGLRNYLVKVYNYMAMALGLTGIVAFFVSSSSA------------- 48

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
                   + +Y +PL W+ +FAP+G+   ++ +L+  S      +F  ++AL+G+S+S 
Sbjct: 49  ------LMSAIYNTPLHWVVMFAPIGLVFLMSYKLNVFSFQTVLTVFFSFAALMGVSISY 102

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            FLVYTS SI + FFI+++ FG ++ YG  TK+DL   G+F+ MG  G+ L SLVNLF+ 
Sbjct: 103 IFLVYTSASIAKVFFISSSMFGIMAWYGNVTKKDLSQFGTFLFMGLVGIVLASLVNLFLH 162

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVA--YAERQSVIGALMLYMDFIQI 246
           S  +   +S + +V+F+ +TAYD Q+IK+ Y    D       + +++GA  LY +++ I
Sbjct: 163 SGPLHFAISIVAVVLFTGMTAYDAQRIKDVYYKFNDGTDVSVNKMAILGATTLYFNYVNI 222

Query: 247 FVHLLRFLGSRR 258
           F+ LL   G RR
Sbjct: 223 FLSLLNLQGERR 234


>gi|310780224|ref|YP_003968556.1| protein of unknown function UPF0005 [Ilyobacter polytropus DSM
           2926]
 gi|309749547|gb|ADO84208.1| protein of unknown function UPF0005 [Ilyobacter polytropus DSM
           2926]
          Length = 234

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 80/253 (31%), Positives = 129/253 (50%), Gaps = 23/253 (9%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
           +R+ N        IDQ +   +  V+  M LGL VT   S         ++         
Sbjct: 3   ERMQNRSYISTEEIDQLVTKKIAGVFGWMVLGLFVTLATSIFTLTNPVLLNLAY------ 56

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
                             + FI   L +   L++R++ +S   ++ +FL YSAL G++LS
Sbjct: 57  ---------------KYMFAFIIGELALVFILSMRVYHMSTAKSRALFLFYSALNGITLS 101

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
              +VYT  SI+ TF    A F  +++YGYTTK DL   G+ + +G   L ++S+VN+F+
Sbjct: 102 LIAIVYTGVSILYTFAGAMAIFLIMAIYGYTTKEDLSKFGNLLKVGLISLIIVSVVNIFL 161

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKE--AYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           +S  +   +S MG++IF  L  YD  +IK     +   D++  ++ S+IGAL LY+DFI 
Sbjct: 162 KSPTLYWIISYMGVLIFIGLIGYDVNRIKNNITVAVSQDISVVDKVSIIGALALYLDFIN 221

Query: 246 IFVHLLRFLGSRR 258
           +F++LLR  G +R
Sbjct: 222 LFLYLLRIFGKKR 234


>gi|242790417|ref|XP_002481552.1| Bax Inhibitor family protein [Talaromyces stipitatus ATCC 10500]
 gi|218718140|gb|EED17560.1| Bax Inhibitor family protein [Talaromyces stipitatus ATCC 10500]
          Length = 268

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/234 (17%), Positives = 92/234 (39%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY+++ + + +T ++S +     +      +   +    ++     ++ T     
Sbjct: 62  QFIRKVYSILTVQILLTTVLSSVSFFSDSYRQWIQSHFWLMIVSLVGAIAFMLLTYWK-- 119

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S     +    ++AL   S+S     Y ++ +VQ   IT 
Sbjct: 120 ------------------RKSYPTNLLFLSGFTALEAYSISVVTSFYDARIVVQALVITL 161

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL-SLVNLFMRSSAIDLTMSAMGLVIFS 205
             F +L+++   TK D      ++  G + L +   +   F  +S ++L    +  +IFS
Sbjct: 162 GIFVALTIFACQTKYDFTHWMPYLFGGLWLLIIFGFMAAFFPYNSGVELVYGGVAALIFS 221

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ I   Y    +        +  ++ LY+D I +F+ +LR L S+ +
Sbjct: 222 GYVLVDTQLIMRHYHVEEE--------IAASISLYLDIINLFLSILRILNSQNN 267


>gi|281347490|gb|EFB23074.1| hypothetical protein PANDA_014153 [Ailuropoda melanoleuca]
          Length = 279

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 47/228 (20%), Positives = 95/228 (41%), Gaps = 28/228 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY++++L + +T + +       +       S  +     L   G ++  +    
Sbjct: 74  AFLRKVYSILSLQVLLTTVTASFFLYFESIRTFVHESPALILVFALGSLGLILALT---- 129

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                           ++         +   ++    L+++     Y    I+Q F +T 
Sbjct: 130 ----------------VNRHKHPLNLYLLFGFTLFEALTVAFVVTFYDVYIILQAFILTT 173

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
           A F  L+ Y   +KRD    G+ +    + L L  ++ LF  S  ++L ++A+G ++F  
Sbjct: 174 AVFLGLTGYTLQSKRDFTKFGAGLFAVLWILCLSGILKLFFYSQTVELVLAAVGALLFCG 233

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
              YDT  +            +  + V+ A+ LY+D I +F+HLLRFL
Sbjct: 234 FIIYDTHSLMH--------RLSPEEYVLAAISLYLDVINLFLHLLRFL 273


>gi|85116480|ref|XP_965057.1| hypothetical protein NCU02463 [Neurospora crassa OR74A]
 gi|28926859|gb|EAA35821.1| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 287

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/234 (18%), Positives = 86/234 (36%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY ++ + L  TG +S L  +     +                       S    
Sbjct: 81  QFIRKVYTILTVQLIATGAVSALSFLSDGYRNWIQ--------------------SHPAM 120

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
           I++     +   L       S     +    ++ L   ++S     + S +++    ITA
Sbjct: 121 IWVSFAGALVFMLLTFWKRQSYPTNLLFLSGFTLLEAYTISVCVSFFDSTTVLLAVVITA 180

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMSAMGLVIFS 205
             F  L+ +   TK D      ++    +GL +   +  F   +S  +L    +  ++FS
Sbjct: 181 GIFVFLTAFACQTKYDFTSWMPYLGGALWGLIITGFIYAFLPHTSTSELVYGGVAALVFS 240

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ +   Y    +        +  A+ LY+D + +F+ +LR L S+ D
Sbjct: 241 GYILVDTQLVMRKYHVEEE--------IAAAISLYLDILNLFLAILRILNSQSD 286


>gi|119953323|ref|YP_945532.1| integral membrane protein [Borrelia turicatae 91E135]
 gi|119862094|gb|AAX17862.1| integral membrane protein [Borrelia turicatae 91E135]
          Length = 231

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 80/235 (34%), Positives = 133/235 (56%), Gaps = 19/235 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LMA+GL ++ I ++  +           + +    ++L  FG         
Sbjct: 15  NKFLAQVFGLMAIGLLISAIFAYTTSENPAMRAIIFTNPMSYIAMILVQFG--------- 65

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                    +   ++  +  +S+  A  +FL YSAL G++LSS F++YT  SI  TF IT
Sbjct: 66  ---------LVYAISGAIEKISSGTATALFLGYSALTGVTLSSVFMIYTQSSIFYTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           + +F ++S YGYTT  DL  +GS+ IMG +G+ + S+ N+F RSS ++  +S +G+++F+
Sbjct: 117 SLTFLAMSFYGYTTSTDLTKMGSYFIMGLWGIIIASIFNIFFRSSGLNFLISILGVILFT 176

Query: 206 ALTAYDTQKIKEAYSDRYDV-AYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +      D      R +V+ +L LY+DFI +F++LLRFLG R+D
Sbjct: 177 GLTAYDVQNISKMNRMLEDGTEIKSRMAVVASLKLYLDFINLFLYLLRFLGERKD 231


>gi|212534534|ref|XP_002147423.1| Bax Inhibitor family protein [Penicillium marneffei ATCC 18224]
 gi|210069822|gb|EEA23912.1| Bax Inhibitor family protein [Penicillium marneffei ATCC 18224]
          Length = 268

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/234 (18%), Positives = 88/234 (37%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY+++ + + +T ++S +     +       +  +    +      +  T     
Sbjct: 62  QFIRKVYSILTVQILLTTVLSGISFFSDSYRRWIQGNFWLMIVSLFGAIAFMFLTYWK-- 119

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S     +    ++AL   S+S     Y +  +VQ   IT 
Sbjct: 120 ------------------RKSYPTNLLFLSGFTALEAYSISVVTSYYDAHIVVQALIITL 161

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL-SLVNLFMRSSAIDLTMSAMGLVIFS 205
             F +L+L+   TK D      ++    + L +   +   F  +S ++L    +  +IFS
Sbjct: 162 GIFVALTLFACQTKYDFTHWMPYLFGALWLLIIFGFMAAFFPYNSGMELVYGGVSALIFS 221

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ I   Y    +        +  A+ LY+D I +F+ +LR L S+ +
Sbjct: 222 GYVLVDTQLIMRHYHVEEE--------IAAAISLYLDIINLFLSILRILNSQNN 267


>gi|19922136|ref|NP_610824.1| CG3814, isoform A [Drosophila melanogaster]
 gi|7303389|gb|AAF58447.1| CG3814, isoform A [Drosophila melanogaster]
 gi|51092047|gb|AAT94437.1| RE58310p [Drosophila melanogaster]
 gi|220952162|gb|ACL88624.1| CG3814-PA [synthetic construct]
          Length = 239

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/259 (16%), Positives = 94/259 (36%), Gaps = 20/259 (7%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MS   ++Q    +   F        + ++ +VY ++   L +T     +      + +  
Sbjct: 1   MSSDNHFQYDAEADKSFAFDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQEWV 60

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
             +  +    +      ++  +    +    PL                       L++ 
Sbjct: 61  QKNPALFWIALAVLIVTMICMACCESVRRKTPLNFIFLF-----------------LFTV 103

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
                L      + +  ++    ITAA    L+L+   TK D    G  ++       + 
Sbjct: 104 AESFLLGMVAGQFEADEVLMAVGITAAVALGLTLFALQTKYDFTMCGGVLVACLVVFIIF 163

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
            ++ +F+    I L  +++G ++FS    YDTQ         +  + +  + +  AL LY
Sbjct: 164 GIIAIFIPGKVIGLVYASLGALLFSVYLVYDTQL---MLGGNHKYSISPEEYIFAALNLY 220

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +D I IF+++L  +G  R+
Sbjct: 221 LDIINIFMYILTIIGLSRN 239


>gi|254292462|ref|YP_003058485.1| hypothetical protein Hbal_0086 [Hirschia baltica ATCC 49814]
 gi|254040993|gb|ACT57788.1| protein of unknown function UPF0005 [Hirschia baltica ATCC 49814]
          Length = 244

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 79/252 (31%), Positives = 134/252 (53%), Gaps = 25/252 (9%)

Query: 14  GSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
                 ++D GLR++M+ +YN MALGL ++ +++ +V  +                    
Sbjct: 12  AGAADMSVDAGLRSFMLGIYNKMALGLVISAVLAMVVGTVPAVT---------------- 55

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
              A++  +PL ++  F PL +    +  + + S     +++    AL+G+ + +    Y
Sbjct: 56  ---AVVLGTPLYYVVAFGPLAILFGSSFMMKNPSPTGTAVVYWSVVALLGMGMGALVYRY 112

Query: 134 TS-----KSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
                   ++ + FF+TA +FG LSL+GYTTK+DL   G+F+IMG  G+ + S+VN+FM+
Sbjct: 113 AGIPDGFTTVAKAFFVTATAFGGLSLFGYTTKKDLSGFGTFLIMGLIGIIIASIVNMFMQ 172

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD-RYDVAYAERQSVIGALMLYMDFIQIF 247
           SS +   +S  G++IFS LTAYDTQ++K  Y     D       +  GAL LY++FI +F
Sbjct: 173 SSMMSFIISVGGVLIFSGLTAYDTQRLKHTYYALGGDSRSMAVATNYGALSLYLNFINLF 232

Query: 248 VHLLRFLGSRRD 259
             +L  +G   D
Sbjct: 233 QFILALMGGGDD 244


>gi|332186250|ref|ZP_08387995.1| uncharacterized UPF0005 family protein [Sphingomonas sp. S17]
 gi|332013618|gb|EGI55678.1| uncharacterized UPF0005 family protein [Sphingomonas sp. S17]
          Length = 216

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 91/231 (39%), Positives = 137/231 (59%), Gaps = 15/231 (6%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M+ VYN MA G+ +TGI++ L      +                      M   PL+++ 
Sbjct: 1   MLSVYNYMASGVLLTGIVALLFAWGGASSPAAQ---------------VFMSGGPLKYVI 45

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           +FAPLG    L++    +     +M+F  ++ ++GLSLS+ FLVY+  SI   FF TAA 
Sbjct: 46  MFAPLGFVFALSMGQSRMKTSTMQMLFWAFAVVMGLSLSTIFLVYSGASIAGAFFATAAG 105

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           F +LSLYGYTTKRDL   G+F+I+G  GL + SL+NLF++S  + L +S +G+++F+ LT
Sbjct: 106 FAALSLYGYTTKRDLSAFGTFLIIGLVGLIVASLINLFLQSGTMALVISFVGVLLFAGLT 165

Query: 209 AYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           AYDTQ+ K  Y +    +  +R  ++ AL LY+DFI +F+ +LR  GS RD
Sbjct: 166 AYDTQRTKSLYYEVRGTSMQDRVVIMSALSLYLDFINMFLFILRLTGSSRD 216


>gi|187918401|ref|YP_001883964.1| integral membrane protein [Borrelia hermsii DAH]
 gi|119861249|gb|AAX17044.1| integral membrane protein [Borrelia hermsii DAH]
          Length = 231

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 81/235 (34%), Positives = 133/235 (56%), Gaps = 19/235 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +V+ LMA+GL ++ I ++  +           + +    ++L  FG         
Sbjct: 15  NKFLAQVFGLMAIGLLISAIFAYTTSENQIMKAIIFTNPMSYIAMLLVQFG--------- 65

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                    +   ++  +  +S+  A  +FL YSAL G++LSS F++YT  SI  TF IT
Sbjct: 66  ---------LVYAISGAIEKISSSTATALFLGYSALTGVTLSSVFMIYTQGSIFYTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           + +F ++S YGYTT  DL  +GS+ IMG +G+ + S+ N+F RSS ++  +S +G+++F+
Sbjct: 117 SLTFLAMSFYGYTTSTDLTKMGSYFIMGLWGIIIASIFNIFFRSSGLNFLISILGVILFT 176

Query: 206 ALTAYDTQKIKEAYSDRYDV-AYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +      D      R +V+ +L LY+DFI +F++LLRFLG RRD
Sbjct: 177 GLTAYDVQNISKMNRMLEDGTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRD 231


>gi|152992996|ref|YP_001358717.1| hypothetical protein SUN_1409 [Sulfurovum sp. NBC37-1]
 gi|151424857|dbj|BAF72360.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 233

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 82/233 (35%), Positives = 129/233 (55%), Gaps = 20/233 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           +  VY+ M +GL ++G+ +F+V   A                       L     + W+ 
Sbjct: 19  LNSVYHWMMIGLLISGLSAFMVIHSAPL------------------LHLLFGNPYMIWVL 60

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
               LG+ I ++  ++ +    A+++F+L+S + G++L+S FL+YT  SIV TFFI AA+
Sbjct: 61  FLIELGLVIAISAGINKMDISTARILFILFSVVDGMTLASIFLIYTEASIVTTFFIAAAT 120

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG +SLYGY T  DL   GS +  G  G+ +  +VN F++S   +  +S +G++IF  LT
Sbjct: 121 FGVMSLYGYFTDTDLSSWGSLLFAGLIGIIIALVVNFFLQSPMFEWWISVIGVIIFVGLT 180

Query: 209 AYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           AYDTQKIK         D     R +++GAL LY+DFI +FV +L F G+ R+
Sbjct: 181 AYDTQKIKAMGEAMAGDDAQSLSRVAIVGALALYLDFINLFVMMLEFFGNERN 233


>gi|297681093|ref|XP_002818270.1| PREDICTED: glutamate [NMDA] receptor-associated protein 1-like
           [Pongo abelii]
          Length = 328

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/233 (19%), Positives = 96/233 (41%), Gaps = 20/233 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           RA++I+V+ L+++ L +T +++ +             +      +    F  L+  +   
Sbjct: 116 RAFIIKVFLLLSVQLLLTAVITGVFIFWEALKVWVLKNPWFIYAIFPAFFAVLIILACCG 175

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +                      A  ++   ++AL GL L +  + Y ++ ++     T
Sbjct: 176 NLR-----------------RQVPANYILLGFFTALQGLLLGAISVFYKAEEVLWATAAT 218

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
                +L+L+   TK D   +   + +  F L +  ++ +F+RS  + L  + +G V+FS
Sbjct: 219 TLVTLALTLFALQTKWDFTLLNGALFVFCFVLLIYGIILIFVRSYWLHLLYAGLGTVLFS 278

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
                D Q         +  +    + V  AL +Y+D I +F+ +LR +G  R
Sbjct: 279 LYLVMDVQL---MLGGHHHYSLDPEEYVFAALNIYLDIINLFIFILRLIGLGR 328


>gi|42520766|ref|NP_966681.1| hypothetical protein WD0950 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410506|gb|AAS14615.1| membrane protein, putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 240

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 94/248 (37%), Positives = 148/248 (59%), Gaps = 25/248 (10%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MS +RN Q + + G  + +    GLR+Y+ +VYN MAL LGVTG+++FL           
Sbjct: 1   MSYMRNEQDIRSQGVYYSA----GLRSYLTKVYNYMALALGVTGLVAFLTVFSGL----- 51

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                         F  +     L  + + +P+ +  +++ R+  LSA +A  +F  +S 
Sbjct: 52  --------------FQVIYSNPVLSLVVMLSPVALVFYMSYRIQHLSAQSAVTIFFSFSV 97

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLS  F+VYT+++I + FFIT+  FGS++LYG TTKRDL  +GSF+IMG +GL + 
Sbjct: 98  LMGLSLSYVFIVYTAENIARAFFITSIMFGSMALYGNTTKRDLTSMGSFLIMGVWGLIIA 157

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVA--YAERQSVIGALM 238
           S+VNLF+ SS +   +S + +++F+ +TAYD Q+IK+ Y    D +     + +++GA  
Sbjct: 158 SIVNLFLGSSPLHFAISFISVIVFTLMTAYDAQRIKDVYYKHNDGSEVATTKLAILGATN 217

Query: 239 LYMDFIQI 246
           LY DFI I
Sbjct: 218 LYFDFINI 225


>gi|24653219|ref|NP_725236.1| CG3814, isoform B [Drosophila melanogaster]
 gi|18447052|gb|AAL68117.1| AT21555p [Drosophila melanogaster]
 gi|21627287|gb|AAM68611.1| CG3814, isoform B [Drosophila melanogaster]
 gi|220949676|gb|ACL87381.1| CG3814-PB [synthetic construct]
 gi|220958898|gb|ACL91992.1| CG3814-PB [synthetic construct]
          Length = 244

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/261 (16%), Positives = 96/261 (36%), Gaps = 28/261 (10%)

Query: 7   YQRVVNSGSGFGSTIDQGL--------RAYMIRVYNLMALGLGVTGIMSFLVNILATTVD 58
           YQ+   +G+   +  D+          + ++ +VY ++   L +T     +      + +
Sbjct: 4   YQQGDETGAYTDAEADKSFAFDDQSIRKGFIRKVYLILMCQLLITFGFVSVFTFSKASQE 63

Query: 59  PDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLY 118
               +  +    +      ++  +    +    PL                       L+
Sbjct: 64  WVQKNPALFWIALAVLIVTMICMACCESVRRKTPLNFIFLF-----------------LF 106

Query: 119 SALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF 178
           +      L      + +  ++    ITAA    L+L+   TK D    G  ++       
Sbjct: 107 TVAESFLLGMVAGQFEADEVLMAVGITAAVALGLTLFALQTKYDFTMCGGVLVACLVVFI 166

Query: 179 LLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALM 238
           +  ++ +F+    I L  +++G ++FS    YDTQ         +  + +  + +  AL 
Sbjct: 167 IFGIIAIFIPGKVIGLVYASLGALLFSVYLVYDTQL---MLGGNHKYSISPEEYIFAALN 223

Query: 239 LYMDFIQIFVHLLRFLGSRRD 259
           LY+D I IF+++L  +G  R+
Sbjct: 224 LYLDIINIFMYILTIIGLSRN 244


>gi|157103171|ref|XP_001647853.1| nmda receptor glutamate-binding chain [Aedes aegypti]
 gi|157128728|ref|XP_001661494.1| nmda receptor glutamate-binding chain [Aedes aegypti]
 gi|108872491|gb|EAT36716.1| nmda receptor glutamate-binding chain [Aedes aegypti]
 gi|108884685|gb|EAT48910.1| nmda receptor glutamate-binding chain [Aedes aegypti]
          Length = 248

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/226 (22%), Positives = 88/226 (38%), Gaps = 20/226 (8%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY ++ + L +T     L    A        +  +     +T F  L+  +    
Sbjct: 42  AFIRKVYLILTVQLAITMAFISLFMYHAPARIWTMQNPWVGTIAFVTMFAVLIIMAC--- 98

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                                     +   +++A  GL L      Y S  ++    IT 
Sbjct: 99  --------------CGEMRRKTPHNFIFLAMFTAAQGLMLGIVATAYDSNEVLMAVGITC 144

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
           A    L+L+ + TK D   +G F+ +G   +F+  ++  F   SA     SA G ++FS 
Sbjct: 145 AICVGLTLFSFQTKWDFTVMGGFLFVGLLVVFIFGIIVAFFPGSAASSVYSACGALLFSL 204

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
              YDTQ         +  + +  + +  AL LY+D I IF+ +LR
Sbjct: 205 YLIYDTQL---MIGGNHKYSISPEEYIFAALNLYLDIINIFLFILR 247


>gi|149715393|ref|XP_001491162.1| PREDICTED: similar to CGI-119 protein [Equus caballus]
          Length = 238

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 52/228 (22%), Positives = 98/228 (42%), Gaps = 28/228 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY +++L + +T + S L     +       S ++   + L  FG L+  +    
Sbjct: 33  AFLRKVYTILSLQVLLTTVTSALFLYFESIRTFVHESPVLILVLSLGSFGVLLALT---- 88

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                           LH         +   ++ L  L+++     Y    ++Q F +T 
Sbjct: 89  ----------------LHRHKHPLNLYLLSGFTLLEALTVAFVVTFYDVYIVLQAFVLTT 132

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
           A F  L++Y   +KRD    G+ +    + L L  ++  F  S  ++L ++A+G ++F  
Sbjct: 133 AVFLGLTVYTLQSKRDFSKFGAGLFTALWILCLSGILKFFFHSETVELVIAAVGALLFCG 192

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
              YDT  +            +  + V  A+ LY+D I +F+HLLRFL
Sbjct: 193 FIVYDTHSLMH--------RLSPEEYVFAAIDLYLDIINLFLHLLRFL 232


>gi|288800217|ref|ZP_06405675.1| membrane protein [Prevotella sp. oral taxon 299 str. F0039]
 gi|288332430|gb|EFC70910.1| membrane protein [Prevotella sp. oral taxon 299 str. F0039]
          Length = 237

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 80/241 (33%), Positives = 129/241 (53%), Gaps = 19/241 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           + +            +     A M +VY  M L L +TG+ ++ V      +    +S  
Sbjct: 2   DRETFDRMIEEREEQMSLAFPALMRKVYVWMTLALIITGVTAYGVASSPGLIYTLTSSEY 61

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           +                   W  +   LG+  F++ R+ +LS   A ++F++YS L G++
Sbjct: 62  L------------------FWGCLLGELGLVYFISSRIMNLSLTTATLLFIVYSILNGVT 103

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           +S  FLVYT  SI   FFITA +FG +SL GYTT+RDL  +G  ++M   GL + S+ N+
Sbjct: 104 MSFIFLVYTMSSIANVFFITAGTFGVMSLIGYTTRRDLSKMGQLLMMALVGLIIASVANI 163

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDV-AYAERQSVIGALMLYMDFI 244
           FM+S  + L +S +G+V+F  LTA+DTQKIK   +   D+   A++ +++GAL LY+DF+
Sbjct: 164 FMKSDTLSLMVSYIGVVLFVGLTAWDTQKIKRMLAQADDITEDAQKIALLGALTLYLDFV 223

Query: 245 Q 245
            
Sbjct: 224 N 224


>gi|291457704|ref|ZP_06597094.1| inner membrane protein YbhL [Bifidobacterium breve DSM 20213]
 gi|291380757|gb|EFE88275.1| inner membrane protein YbhL [Bifidobacterium breve DSM 20213]
          Length = 273

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 73/263 (27%), Positives = 132/263 (50%), Gaps = 27/263 (10%)

Query: 5   RNYQRVVNSGSGFGSTI--------DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATT 56
           +NYQ          + I        ++  RA + +VY  M +G+ VT I++F+  +    
Sbjct: 27  QNYQYAAQGTGAGTTAINTTMTYSYEEARRASVTKVYGEMTIGVIVTAIVAFIGQMTGAY 86

Query: 57  VDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFL 116
               A++  I                          +G+ + L  R+  + +  A++MF 
Sbjct: 87  YAFLASTGAIGLI-----------------ALCVVQVGLAVVLGARVTKMKSGTARVMFY 129

Query: 117 LYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFG 176
           +Y+AL+G +LSS F+VY+  SIV    ITAA F +L+++G TTK ++   G  +++G   
Sbjct: 130 VYAALMGFTLSSIFMVYSLGSIVTALGITAAFFFALTMFGMTTKINMLKAGPILMIGLIV 189

Query: 177 LFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR--YDVAYAERQSVI 234
           L +  LV +F+    +   + A+GL++F+ +T YD Q  +   S          +R S++
Sbjct: 190 LIISQLVLMFLHVDGMTQIVCALGLILFAGMTIYDAQSTRALLSQYEAQGPEMVKRVSIL 249

Query: 235 GALMLYMDFIQIFVHLLRFLGSR 257
            AL LY+DF+ +F+++L+ LG+R
Sbjct: 250 CALNLYLDFVNMFLYILQLLGNR 272


>gi|303248181|ref|ZP_07334445.1| protein of unknown function UPF0005 [Desulfovibrio fructosovorans
           JJ]
 gi|302490445|gb|EFL50354.1| protein of unknown function UPF0005 [Desulfovibrio fructosovorans
           JJ]
          Length = 237

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 90/240 (37%), Positives = 136/240 (56%), Gaps = 21/240 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
           + L A+M  VY  M +GL VT   S  V    + +     + +I  G+++          
Sbjct: 16  EVLNAFMRGVYGWMCMGLLVTAAASAFVVSSPSILQAVFGNQLIYIGLII---------- 65

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                   A L + + L   ++ LSA AA  MFLLYSAL G++LS  F++Y    I+  F
Sbjct: 66  --------AELAMVVGLAAAINRLSATAATSMFLLYSALNGVTLSVIFVIYAKAVIINAF 117

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            ++A  FG++SLYG  TKRDL  +GSFM MG  G+ + S+VN+F +S+ +D  +S +G++
Sbjct: 118 LVSAGMFGAMSLYGLLTKRDLTSLGSFMFMGLIGIIIASIVNIFTKSAMMDFIISCVGVL 177

Query: 203 IFSALTAYDTQKIKEA--YSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL-GSRRD 259
           +F  LTAYDTQK+K     +   D     R +++GAL LY+DFI +F+ +LR   GS R+
Sbjct: 178 VFIGLTAYDTQKLKVMGDMAPADDATAVRRGTILGALTLYLDFINLFLMMLRLFSGSNRN 237


>gi|225631080|ref|ZP_03787813.1| hypothetical protein WUni_002590 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225591225|gb|EEH12374.1| hypothetical protein WUni_002590 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 240

 Score =  106 bits (265), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 94/248 (37%), Positives = 148/248 (59%), Gaps = 25/248 (10%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MS +RN Q + + G  + +    GLR+Y+ +VYN MAL LGVTG+++FL           
Sbjct: 1   MSYMRNEQDIRSQGVYYSA----GLRSYLTKVYNYMALALGVTGLVAFLTVFSGL----- 51

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                         F  +     L  + + +P+ +  +++ R+  LSA +A  +F  +S 
Sbjct: 52  --------------FQVIYSNPVLSLVVMLSPVALVFYMSYRIQHLSAQSAVAIFFSFSV 97

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLS  F+VYT+++I + FFIT+  FGS++LYG TTKRDL  +GSF+IMG +GL + 
Sbjct: 98  LMGLSLSYVFIVYTAENIARAFFITSIMFGSMALYGNTTKRDLTSMGSFLIMGVWGLIIA 157

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVA--YAERQSVIGALM 238
           S+VNLF+ SS +   +S + +++F+ +TAYD Q+IK+ Y    D +     + +++GA  
Sbjct: 158 SIVNLFLGSSPLHFAISFISVIVFTLMTAYDAQRIKDVYYKHNDGSEVATTKLAILGATN 217

Query: 239 LYMDFIQI 246
           LY DFI I
Sbjct: 218 LYFDFINI 225


>gi|203284444|ref|YP_002222184.1| hypothetical protein BDU_540 [Borrelia duttonii Ly]
 gi|203287978|ref|YP_002222993.1| hypothetical protein BRE_543 [Borrelia recurrentis A1]
 gi|201083887|gb|ACH93478.1| conserved hypothetical integral membrane protein [Borrelia duttonii
           Ly]
 gi|201085198|gb|ACH94772.1| conserved hypothetical integral membrane protein [Borrelia
           recurrentis A1]
          Length = 231

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 80/235 (34%), Positives = 136/235 (57%), Gaps = 19/235 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++  V+ LM++GL ++ I ++  +  A        + +    ++L  FG +   S   
Sbjct: 15  NKFLAHVFGLMSVGLLISAIFAYTTSENAIIRAIIFTNPMSYIAIILIQFGFVYAISGA- 73

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                            ++ +S+  A  +FL+YSAL G++LSS F++YT  SI  TF IT
Sbjct: 74  -----------------INRISSGTATALFLMYSALTGVTLSSIFMIYTQGSIFYTFGIT 116

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           + +F ++S YG+TT  DL  +GS+ +MG +G+ + S++N+F RSS ++  +S +G+++F+
Sbjct: 117 SLTFLAMSFYGHTTSTDLTKMGSYFMMGLWGIIIASILNMFFRSSGLNFLISILGVILFT 176

Query: 206 ALTAYDTQKIKEAYSDRYDV-AYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            LTAYD Q I +  +   D      R +V+ +L LY+DFI +F++LLRFLG RRD
Sbjct: 177 GLTAYDVQNISKMDNMLEDGTEIKNRMAVVASLKLYLDFINLFLYLLRFLGQRRD 231


>gi|221130112|ref|XP_002160142.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 374

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/230 (15%), Positives = 87/230 (37%), Gaps = 20/230 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           +A++ +VY ++   L V+  +  L  ++         ++ +     +     ++  +   
Sbjct: 159 QAFIRKVYAILFCQLLVSVGIVCLFVLVHPINSYVKKNVAMFWMAWIATIVLMIAIACCE 218

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +                   +     +M  L++      +      Y    ++    I 
Sbjct: 219 NVR-----------------RTFPMNFIMLSLFTLCESYLIGVVSAHYNVNEVLLAMGIV 261

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A    +++++ + TK D   +G F+++    L    +  +F  S  + L  + +G +IF 
Sbjct: 262 AVVSLAITIFAFQTKYDFTMMGGFLLVLVIVLLCFGIFTIFFHSKIVRLVYACLGALIFG 321

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
               YDTQ +          + +    +  AL LY+D + +F+++L  +G
Sbjct: 322 LYLVYDTQLMM---GGEKKYSISPEDYIFAALNLYLDIVMLFIYILEIVG 368


>gi|319760475|ref|YP_004124413.1| hypothetical protein BVAF_345 [Candidatus Blochmannia vafer str.
           BVAF]
 gi|318039189|gb|ADV33739.1| putative membrane protein [Candidatus Blochmannia vafer str. BVAF]
          Length = 236

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 80/236 (33%), Positives = 138/236 (58%), Gaps = 20/236 (8%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           ++ ++ +V+  M+ GL +T  +++  +     +    ++ II  G+++            
Sbjct: 19  IQPFISQVFGWMSCGLLLTAFVAWYTSKSPVVLQLLFSNQIIFFGLVI------------ 66

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
                 + L +   L+  +  L+   A  +F+LYS L GL+LSS F++YT+ SI  TF +
Sbjct: 67  ------SQLALVFVLSGMVIKLNGSLATTLFMLYSVLTGLTLSSVFILYTTSSISSTFLV 120

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           T+  FG+++LYGYTTKRDL   G+ ++M   G+ L SLVNL+++++AI   ++ +G+++F
Sbjct: 121 TSGMFGAMTLYGYTTKRDLSSFGNLLLMALIGIMLASLVNLWVKNTAIMWIITYVGVLVF 180

Query: 205 SALTAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
             LTAYD QKIK   +     D     + S+IGAL LY+DFI +F+ ++R  G+RR
Sbjct: 181 VGLTAYDMQKIKSIGASLSIEDQDQFRKYSIIGALTLYLDFINLFLMMVRIFGNRR 236


>gi|158294325|ref|XP_556168.3| AGAP005529-PC [Anopheles gambiae str. PEST]
 gi|157015512|gb|EAL39852.3| AGAP005529-PC [Anopheles gambiae str. PEST]
          Length = 241

 Score =  106 bits (264), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 51/253 (20%), Positives = 95/253 (37%), Gaps = 20/253 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y     S  GF        R ++ +VY+++ + L +T     L      T         +
Sbjct: 9   YDPETGSVKGFEFNDQSIRRGFIRKVYSILTVQLAITLGFITLFLYHRPTKLWVQNHPEM 68

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
               +      L+  +    +                    A    +   L++      L
Sbjct: 69  FWIALGVMVVTLISMACCGDVR-----------------RKAPMNFIFLTLFTLAQAFLL 111

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                 ++S+ ++    ITAA    L+L+ + TK D   +G  + +    L L  L+ +F
Sbjct: 112 GVTTANFSSQEVMLAVGITAAVCLGLTLFAFQTKWDFTVMGGILFVAVLILMLFGLIAIF 171

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
                I L  ++ G +IFS    YDTQ         +  + +  + +  AL LY+D + I
Sbjct: 172 FPGKTITLVYASAGALIFSIYLVYDTQL---MLGGEHKYSISPEEYIFAALNLYLDIVNI 228

Query: 247 FVHLLRFLGSRRD 259
           F+++L  +G+ RD
Sbjct: 229 FLYILTIIGASRD 241


>gi|312868880|ref|ZP_07729066.1| putative membrane protein [Lactobacillus oris PB013-T2-3]
 gi|311095620|gb|EFQ53878.1| putative membrane protein [Lactobacillus oris PB013-T2-3]
          Length = 235

 Score =  106 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 61/234 (26%), Positives = 108/234 (46%), Gaps = 17/234 (7%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL  ++ ++Y LM   + ++ + ++LV                   V    F A +  +
Sbjct: 15  SGLNRFLTKMYGLMTFAVLISALTAWLVAN-----------------VFANQFTAFLTNN 57

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                 I        F      + S   + ++ ++ + + G++ +     YT   I   F
Sbjct: 58  RWGIWLIILLPIFLTFGISFNATRSPGVSFVLLIITAIIYGITFAFIAGSYTGADIATAF 117

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
             +A  F +++L G  + RD   +GS+      GL +  LVNLF+ S A++  +S + ++
Sbjct: 118 VSSAGIFLTMALIGTFSHRDFSRLGSYATAALVGLIIAMLVNLFLHSPAVNYVLSVIAVI 177

Query: 203 IFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           IF+ LTA+D Q++K  Y+   D       +V+GAL LY+DFI +FV LL   GS
Sbjct: 178 IFTILTAWDAQRMKSIYTGYGDELSVNGLAVLGALQLYLDFINLFVSLLDIFGS 231


>gi|213514762|ref|NP_001134878.1| Transmembrane BAX inhibitor motif-containing protein 1 [Salmo
           salar]
 gi|209736794|gb|ACI69266.1| Transmembrane BAX inhibitor motif-containing protein 1 [Salmo
           salar]
          Length = 305

 Score =  106 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 51/237 (21%), Positives = 101/237 (42%), Gaps = 25/237 (10%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY ++A  L VT  +  +     T V+   A +I N  V  T F     T     
Sbjct: 90  AFIRKVYLILAAQLIVTVSIVAVF----TFVEEVRAFVIRNPAVYWTSFAVYFVT----- 140

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                     I +  +          ++  +++  +     +    Y +K++  T  ITA
Sbjct: 141 --------YCILVCCKGPRRRFPWNFVLLAIFTLAMSYMTGTISSYYDTKAVFLTIGITA 192

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSLVNLFMRSSAIDLTMSAMGLV 202
                ++++ + TK D    G    + A  +     + ++V  F     + +  +A+G V
Sbjct: 193 IVCIIVTIFCFQTKVDFTSCGGLFSILAIVVLVTGIITAIVLSFKYVPWLHMLYAAIGAV 252

Query: 203 IFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +++   AY+TQ +         ++ +  + V GAL LY+D +QIF+ LL+ +G+  D
Sbjct: 253 VYTLFLAYNTQLLI----GNRKLSISPEEYVFGALSLYVDIVQIFIFLLQLVGASTD 305


>gi|46580874|ref|YP_011682.1| membrane protein [Desulfovibrio vulgaris str. Hildenborough]
 gi|120601821|ref|YP_966221.1| hypothetical protein Dvul_0772 [Desulfovibrio vulgaris DP4]
 gi|46450294|gb|AAS96942.1| membrane protein, putaive [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120562050|gb|ABM27794.1| protein of unknown function UPF0005 [Desulfovibrio vulgaris DP4]
 gi|311234568|gb|ADP87422.1| protein of unknown function UPF0005 [Desulfovibrio vulgaris RCH1]
          Length = 233

 Score =  106 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 96/255 (37%), Positives = 142/255 (55%), Gaps = 25/255 (9%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           Y R + S +   +T      AYM  VY+ M LGL VT   ++ V      +     +  +
Sbjct: 2   YNRTMGSAARVEAT-----NAYMRGVYSWMTLGLAVTAAAAWGVASSEALIAFIFGNTFV 56

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++  F  ++  S                    +  LSA  A  +FLLYSAL GL+L
Sbjct: 57  FFGLIIAEFALVIGIS------------------AGIARLSAGMASGLFLLYSALNGLTL 98

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS  LVY   ++ Q F  TA  F  +S+YG TTKRDL  +GSF++MG FG+ L S+VN+F
Sbjct: 99  SSILLVYAQSAVFQAFITTAGMFAVMSIYGATTKRDLTSMGSFLMMGLFGIILASVVNIF 158

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFI 244
           MRSS ++  +SA+G+++F+ LTAYDTQK+K    +    D     R +++GAL LY+DF+
Sbjct: 159 MRSSMMEFIISAVGVLVFTGLTAYDTQKLKAFGENAPMDDAVAIRRGTILGALTLYLDFV 218

Query: 245 QIFVHLLRFLGSRRD 259
            +F+ ++R  GS RD
Sbjct: 219 NLFIMMVRLFGSSRD 233


>gi|116491262|ref|YP_810806.1| integral membrane protein, interacts with FtsH [Oenococcus oeni
           PSU-1]
 gi|290890809|ref|ZP_06553876.1| hypothetical protein AWRIB429_1266 [Oenococcus oeni AWRIB429]
 gi|116091987|gb|ABJ57141.1| Integral membrane protein, interacts with FtsH [Oenococcus oeni
           PSU-1]
 gi|290479581|gb|EFD88238.1| hypothetical protein AWRIB429_1266 [Oenococcus oeni AWRIB429]
          Length = 240

 Score =  106 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 62/258 (24%), Positives = 112/258 (43%), Gaps = 20/258 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           ++NY           ST + GL A+  R Y  M   L +T  +++ +             
Sbjct: 1   MQNYSDNRIIKDVTDSTNESGLAAFFQRTYAYMGAALLITFGLAYALAY----------- 49

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                               L WI +       +FL  R    +   A    L ++ + G
Sbjct: 50  -----PFYAEFVRFYASNGALTWIVLAIAQLAVVFLIGRNALKNPALAFGGLLAFAVVEG 104

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           +   + F +Y  +SIV  F + A  FG+++LYG+ TK++L  +   +      L +  +V
Sbjct: 105 IFFGAIFAMYDLQSIVSAFLMAAVDFGAMALYGFFTKKNLSRLAPILFGAMIALMVGLVV 164

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALMLYM 241
           ++F+        MS +G+++FS   AYD  ++K+ Y              ++ GAL LY+
Sbjct: 165 SIFV--PGFSFIMSVLGVLVFSVYAAYDNNRLKQMYFELQGQGNQTINGLAISGALSLYL 222

Query: 242 DFIQIFVHLLRFLGSRRD 259
           DF+ +F++LLR  G++R+
Sbjct: 223 DFVNLFLYLLRIFGNQRN 240


>gi|317486260|ref|ZP_07945093.1| hypothetical protein HMPREF0179_02451 [Bilophila wadsworthia 3_1_6]
 gi|316922506|gb|EFV43759.1| hypothetical protein HMPREF0179_02451 [Bilophila wadsworthia 3_1_6]
          Length = 233

 Score =  106 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 94/233 (40%), Positives = 133/233 (57%), Gaps = 20/233 (8%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           +M  VY  M +GL VT   +F V                          A+   +    I
Sbjct: 19  FMRHVYQWMTVGLLVTAGTAFFVASSPAL------------------LSAIFGNTFGLII 60

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
              A   + + L+  +  LSA+AA  +F++YSAL+G  LSS  LVYT  S++ TF   AA
Sbjct: 61  LAIAVFAMPLVLSGMISRLSAFAATALFVVYSALMGAFLSSVLLVYTGASVMSTFVTCAA 120

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
            FG +S+YG  TKRDL  +GSFM+MG FGL +  +VN+F++SSA+   +SA+G+VIF+ L
Sbjct: 121 MFGGMSIYGTVTKRDLTGMGSFMMMGLFGLIIAMIVNIFLQSSAMTFVISALGVVIFTGL 180

Query: 208 TAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           TAYDTQKI+    +    D     R +++GAL LY+DFI +F+ LLR +G RR
Sbjct: 181 TAYDTQKIRAFGENAPLDDATAIRRGALLGALTLYLDFINLFLMLLRLMGDRR 233


>gi|195109857|ref|XP_001999498.1| GI24550 [Drosophila mojavensis]
 gi|193916092|gb|EDW14959.1| GI24550 [Drosophila mojavensis]
          Length = 263

 Score =  106 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 86/234 (36%), Gaps = 20/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++   L +T     +        +  A ++ +    M T    ++      
Sbjct: 50  RGFIRKVYMILLGQLVITFGAVAVFVYSEDAKNFAAQNLWLFWVAMGTMLLTMLSMICCE 109

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +                         +   +++      L      +  K ++    IT
Sbjct: 110 RVR-----------------RETPTNFIFLGMFTVAESFLLGVAASRFAPKEVLMAIGIT 152

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           AA   +L+++   TK D   +G  +I     L    ++ +FM    I L  S  G V+FS
Sbjct: 153 AAICLALTVFALQTKYDFTMMGGILIACLVALLFFGVLTIFMHGKIISLMYSTAGAVLFS 212

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
               YDTQ +       +  A +  + +   L LY+D I IF+ +L  LG  +D
Sbjct: 213 IYLVYDTQLMM---GGTHKYAISPEEYIFATLNLYLDVINIFLDILNILGITQD 263


>gi|50806769|ref|XP_424507.1| PREDICTED: similar to Fas apoptotic inhibitory molecule 2 [Gallus
           gallus]
          Length = 311

 Score =  106 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 44/240 (18%), Positives = 90/240 (37%), Gaps = 29/240 (12%)

Query: 26  RAYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           R ++ +VY ++ + L VT  I++F                           G +   S  
Sbjct: 95  RVFIRKVYAILMVQLLVTLVIVAFFTFCEPVK-------------------GYVQVHSGW 135

Query: 85  RWIFIFAPL-GVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
            W           I               ++  +++  +          Y +KS++    
Sbjct: 136 YWASYAVFFVTYLILACCSGPRRYFPWNLILLSIFTLSMAYLTGMLSSYYDTKSVLLCLG 195

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSLVNLFMRSSAIDLTMSAM 199
           ITA    S++++ + TK D       + +    L     +L+++  +     +    + +
Sbjct: 196 ITALVCLSVTIFSFQTKFDFTSYQGILFVMLMVLFFGGIILAVILPYKYVPWLHAIYALL 255

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           G +IF+   A+DTQ +          + +  + + GAL +Y+D I IF  LL+F GS ++
Sbjct: 256 GAIIFTMFLAFDTQMLM----GNRRYSLSPEEYIFGALNIYLDIIYIFSFLLQFFGSSQE 311


>gi|115379432|ref|ZP_01466533.1| stationary phase anti-death Family (SAD), acetate uptake
           [Stigmatella aurantiaca DW4/3-1]
 gi|115363571|gb|EAU62705.1| stationary phase anti-death Family (SAD), acetate uptake
           [Stigmatella aurantiaca DW4/3-1]
          Length = 208

 Score =  106 bits (263), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 82/230 (35%), Positives = 121/230 (52%), Gaps = 22/230 (9%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M RVY  M  GL +TG+ +         ++                          R   
Sbjct: 1   MSRVYGWMFAGLMLTGVTALYTVSNEALLNQVLQ---------------------WRMGL 39

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           + A LGV + L+     LS   A  +FL YSAL G++LS +FL+YT+ SI Q   +T   
Sbjct: 40  LLAELGVVLALSFLAPRLSGPVAAALFLGYSALTGMTLSIYFLIYTAGSIGQALLLTGGV 99

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG+LSLYG  TK+DL    +F+ MG  G+ L  + N+F+RS  +    +   +++F+ LT
Sbjct: 100 FGALSLYGTLTKKDLSAWAAFLFMGLVGVLLAGVANIFIRSEGMSFVTACACVIVFAGLT 159

Query: 209 AYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           AYDTQK+++ ++     + A   SV+GAL LY+DFI +F+ LLR  G RR
Sbjct: 160 AYDTQKLRQMHAATG-YSSAATISVVGALTLYLDFINLFLALLRLFGRRR 208


>gi|300361692|ref|ZP_07057869.1| integral membrane protein [Lactobacillus gasseri JV-V03]
 gi|300354311|gb|EFJ70182.1| integral membrane protein [Lactobacillus gasseri JV-V03]
          Length = 237

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 61/251 (24%), Positives = 110/251 (43%), Gaps = 17/251 (6%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
                        + GL  ++ ++Y LMAL + V+ + S+L   +      +        
Sbjct: 3   NFDQEPERRHLVDESGLNTFLSKLYGLMALAVLVSAVSSYLTMTVFAKQMLN-------- 54

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
                    LM   P    F+         +     + S   + ++ +L + + G++ + 
Sbjct: 55  ---------LMNHHPWAMWFLLLLPIALTLIINFNATRSPGMSFVLLMLTAIIYGVTFAF 105

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
               YT + I   F  +A+ F  +++ G  TKRDL  IGS+      GL +  L+N F++
Sbjct: 106 IAGAYTGEDIASAFVASASVFIVMAILGIVTKRDLSRIGSYASAALIGLIVAMLINFFLK 165

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFV 248
           +  ID   S + ++IF+ LTA+D Q++K  Y            +V+GAL LY+DF+ +F+
Sbjct: 166 NPTIDYIFSFIAVIIFTILTAWDAQRMKNIYLQFGGELSTNGLAVLGALQLYLDFVNLFL 225

Query: 249 HLLRFLGSRRD 259
             L   GS  +
Sbjct: 226 QFLDIFGSNDN 236


>gi|195123949|ref|XP_002006464.1| GI21062 [Drosophila mojavensis]
 gi|193911532|gb|EDW10399.1| GI21062 [Drosophila mojavensis]
          Length = 244

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 45/256 (17%), Positives = 93/256 (36%), Gaps = 21/256 (8%)

Query: 5   RNYQRVVNSGSGFGSTIDQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
            N            +  DQ +R  ++ +VY ++ + L +T     +    +        +
Sbjct: 9   NNGVYGDPEADKSFAFDDQTIRKGFIRKVYMILMVQLLITFGFVSIFTFSSAAQGWVERN 68

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
             +    +      ++  +    +    PL                       L++    
Sbjct: 69  PALLWIALAVLIVTMISMACCESVRRKTPLNFIFLF-----------------LFTLAES 111

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
             L      Y ++ ++    ITAA    L+++   TK D    G  ++       +  +V
Sbjct: 112 FLLGMIAGQYKAEEVLMAVGITAAVSLGLTIFALQTKYDFTMCGGVLVACLVVFIIFGIV 171

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
            +F+    I L  +++G ++FS    YDTQ         +  A +  + +  AL LY+D 
Sbjct: 172 AIFVPGQIIGLVYASLGALLFSVYLVYDTQL---MLGGNHKYAISPEEYIFAALNLYLDI 228

Query: 244 IQIFVHLLRFLGSRRD 259
           I IF+++L  +G  R+
Sbjct: 229 INIFMYILTIIGLARN 244


>gi|225867933|ref|YP_002743881.1| membrane protein [Streptococcus equi subsp. zooepidemicus]
 gi|225701209|emb|CAW98141.1| putative membrane protein [Streptococcus equi subsp. zooepidemicus]
          Length = 229

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 73/239 (30%), Positives = 116/239 (48%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D GL  +  +VY+L+ +G+G++  +S+L+                          ++
Sbjct: 8   TQSDAGLSHFFAKVYSLVGMGVGLSAFVSYLMLF-----------------PFRQNLVSI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P+ +        V +F+       +  AA  +FL+YSAL G +LS     Y   ++
Sbjct: 51  ILDHPMVYYGAAIVELVLVFVASGAARRNTPAALPLFLVYSALNGFTLSFIIAAYAQTTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +Q F  +AA F ++SL G   KRDL  I   M     G+ + SLVNLF+ S  +   +S 
Sbjct: 111 LQAFISSAAVFFAMSLLGVKVKRDLSGIRKAMFAALIGIIVASLVNLFIGSDLMSYVISL 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L A D Q IK+ Y      A  +  +V  AL LY+DFI +F+ LLR LG  
Sbjct: 171 ISVLIFSGLIASDNQMIKQVYQASNGQA-GDGWAVAMALSLYLDFINLFISLLRLLGRN 228


>gi|148544614|ref|YP_001271984.1| hypothetical protein Lreu_1398 [Lactobacillus reuteri DSM 20016]
 gi|184153972|ref|YP_001842313.1| hypothetical protein LAR_1317 [Lactobacillus reuteri JCM 1112]
 gi|227363733|ref|ZP_03847842.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri MM2-3]
 gi|325682943|ref|ZP_08162459.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri MM4-1A]
 gi|148531648|gb|ABQ83647.1| protein of unknown function UPF0005 [Lactobacillus reuteri DSM
           20016]
 gi|183225316|dbj|BAG25833.1| conserved hypothetical protein [Lactobacillus reuteri JCM 1112]
 gi|227071227|gb|EEI09541.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri MM2-3]
 gi|324977293|gb|EGC14244.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri MM4-1A]
          Length = 235

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 59/235 (25%), Positives = 106/235 (45%), Gaps = 17/235 (7%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           L  ++ ++Y LM L + ++ + ++LV                   V    F A M  +  
Sbjct: 17  LNKFLTKMYGLMTLAVLLSALTAWLVMT-----------------VFAQQFTAFMVNNRW 59

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
               I     +         + S      + +L + + G++ +     Y    I   F  
Sbjct: 60  GMWLIILLPIILTLGINFNATRSPGLCLFLLILTAIVYGITFAFIAGAYAGTDIATAFVS 119

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           +A+ F ++++ G  + RD   IGS+      GL +  LVN F++S  I+  +S + ++IF
Sbjct: 120 SASVFLTMAIIGTFSHRDFTRIGSYASAALIGLIIAMLVNFFVQSPMINYLLSIVAVIIF 179

Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +ALTA+D Q++K  Y +      +   +V+GAL LY+DFI +F+  L   GS  D
Sbjct: 180 TALTAWDAQRMKNIYIECNGQVSSNGLAVLGALQLYLDFINLFISFLDIFGSSND 234


>gi|225871151|ref|YP_002747098.1| membrane protein [Streptococcus equi subsp. equi 4047]
 gi|225700555|emb|CAW95045.1| putative membrane protein [Streptococcus equi subsp. equi 4047]
          Length = 229

 Score =  105 bits (262), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 72/239 (30%), Positives = 115/239 (48%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D GL  +  +VY+L+ +G+G++  +S+L+                          ++
Sbjct: 8   TQSDAGLSHFFAKVYSLVGMGVGLSAFVSYLMLF-----------------PFRQNLVSI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P+ +        V +F+       +  AA  +FL+YSAL G +LS     Y   ++
Sbjct: 51  VLDHPMVYYGAAIVELVLVFVASGAARRNTPAALPLFLVYSALNGFTLSFIIAAYAQTTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +Q F  +AA F ++SL G   KRDL  I   M     G+ + SLVNLF+ S  +   +S 
Sbjct: 111 LQAFISSAAVFFAMSLLGVKVKRDLSGIRKAMFAALIGIIVASLVNLFIGSDLMSYVISL 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L A D Q IK+ Y         +  +V  AL LY+DFI +F+ LLR LG  
Sbjct: 171 ISVLIFSGLIASDNQMIKQVYQASNGQ-VGDGWAVAMALSLYLDFINLFISLLRLLGRN 228


>gi|302828320|ref|XP_002945727.1| hypothetical protein VOLCADRAFT_72329 [Volvox carteri f.
           nagariensis]
 gi|300268542|gb|EFJ52722.1| hypothetical protein VOLCADRAFT_72329 [Volvox carteri f.
           nagariensis]
          Length = 243

 Score =  105 bits (262), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 57/249 (22%), Positives = 113/249 (45%), Gaps = 21/249 (8%)

Query: 11  VNSGSGFGSTIDQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRG 69
           V  G    +  ++ +R  ++ +V+ L+A  L +T  ++       T      A+  I   
Sbjct: 14  VEKGGVINAFAERTIRQGFVRKVFGLLAAQLALTTAIASFFVFSPTVKTYLVANPWILLV 73

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
            ++  FG ++  +         PL +                  +   ++A  G+ + + 
Sbjct: 74  SLIASFGIILTFTFSSSARQSHPLNLI-----------------LLFAFTAAEGVLVGAA 116

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
                + ++V  F +TA    +++++  TTK D+   GS +  G  GL    LV  F+++
Sbjct: 117 SSHARTDAVVLAFGLTAGITAAMAIWALTTKHDITTSGSALYAGLLGLIFAGLVGFFVQT 176

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
           +A ++ +S +G V+FS   AYD Q +       +  A +  + V+GA+ +Y+D I +F+H
Sbjct: 177 TAFNIAVSGIGAVLFSIYIAYDVQCL---LGGDHKYAVSPDEYVMGAIAIYLDVINLFMH 233

Query: 250 LLRFLGSRR 258
           +LR L S R
Sbjct: 234 ILRLLSSNR 242


>gi|40018604|ref|NP_954547.1| transmembrane BAX inhibitor motif-containing protein 4 [Rattus
           norvegicus]
 gi|38014718|gb|AAH60596.1| Transmembrane BAX inhibitor motif containing 4 [Rattus norvegicus]
 gi|149066838|gb|EDM16571.1| transmembrane BAX inhibitor motif containing 4, isoform CRA_a
           [Rattus norvegicus]
          Length = 238

 Score =  105 bits (261), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 48/228 (21%), Positives = 96/228 (42%), Gaps = 28/228 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY++++L + +T + S L     T       S  +     L   G +   +    
Sbjct: 33  AFLRKVYSILSLQVLLTTVTSALFLYFETLRTFVHDSPALIVVFALGSLGLIFALT---- 88

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                           LH  +      +   ++    L++++    Y    ++  F +TA
Sbjct: 89  ----------------LHRHTHPLNLYLLFAFTLSEALTVATVVTFYDGHLVLHAFILTA 132

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
           A F  L+ Y   +KRD    G+ +    + L L   + +F  S  ++L ++++G ++F  
Sbjct: 133 AVFLGLTAYTLQSKRDFSKFGAGLFACLWILCLAGFLKVFFYSQTVELVLASLGALLFCG 192

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
              YDT  +            +  + V+ A+ LY+D I +F+HLL+FL
Sbjct: 193 FIIYDTHSLMH--------RLSPEEYVLAAISLYLDIINLFLHLLKFL 232


>gi|119026053|ref|YP_909898.1| hypothetical protein BAD_1035 [Bifidobacterium adolescentis ATCC
           15703]
 gi|154488822|ref|ZP_02029671.1| hypothetical protein BIFADO_02130 [Bifidobacterium adolescentis
           L2-32]
 gi|118765637|dbj|BAF39816.1| hypothetical protein [Bifidobacterium adolescentis ATCC 15703]
 gi|154082959|gb|EDN82004.1| hypothetical protein BIFADO_02130 [Bifidobacterium adolescentis
           L2-32]
          Length = 293

 Score =  105 bits (261), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 61/246 (24%), Positives = 118/246 (47%), Gaps = 20/246 (8%)

Query: 15  SGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTG 74
           +    + ++   A + R Y  M +GL VT  ++ L       +    +  +I        
Sbjct: 64  AQATYSYERAEHASVTRAYGEMTIGLLVTAAVAILTQATGAYIALIQSLGVIG------- 116

Query: 75  FGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYT 134
                      W      + + I+L  R+  +    A++MF +Y+A++G SLS+ F+ Y 
Sbjct: 117 ----------AWAPFVVEIVIAIYLGARIEKIKPSTARVMFYVYAAIMGFSLSTIFMAYD 166

Query: 135 SKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS-LVNLFMRSSAID 193
             +I  +  + A  F +L++ G TTK ++   G  +++G   L +   L+ +F     + 
Sbjct: 167 LGTIGISLALCAGFFFALTMLGMTTKVNMLKAGPILLVGLIVLIVAEVLLMIFAPGQTML 226

Query: 194 LTMSAMGLVIFSALTAYDTQKIKEAYSDRYDV--AYAERQSVIGALMLYMDFIQIFVHLL 251
           + +SA+GLV+F+ +T YD Q  +  ++          ++ S+I AL LY+DFI +F+++L
Sbjct: 227 MVISAIGLVLFAGMTVYDAQATRALFAQYAGQGEDMVKKVSIICALNLYLDFINMFLYIL 286

Query: 252 RFLGSR 257
           +  G R
Sbjct: 287 QLFGDR 292


>gi|116617822|ref|YP_818193.1| integral membrane protein, interacts with FtsH [Leuconostoc
           mesenteroides subsp. mesenteroides ATCC 8293]
 gi|116096669|gb|ABJ61820.1| Integral membrane protein, interacts with FtsH [Leuconostoc
           mesenteroides subsp. mesenteroides ATCC 8293]
          Length = 239

 Score =  105 bits (261), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 69/249 (27%), Positives = 113/249 (45%), Gaps = 17/249 (6%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
                 +     + +D+G+RA+  + Y+ M + + +T +  F+V                
Sbjct: 1   MDNFNMNARRDVTGVDEGMRAFFKQTYSFMGIAVLLTAVTGFIVQN-------------- 46

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                L     L+  + +  + +     + I +  R    +   A  + + ++ + GL+L
Sbjct: 47  ---FFLEQVAKLLVGNVIGLLALLGIQMLIITMIGRATFKNPARAFGLLMAFAVVEGLTL 103

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                VYT  S+V  F   +A FG ++ YG  TKRDL  +GS +     GL + S+ N+F
Sbjct: 104 GVLLAVYTGASVVMAFVSASAVFGGMAAYGVFTKRDLTGLGSILFGLLIGLLIASIANMF 163

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
             S  + L +S   +V+FS  TAYD Q +K  YS     A     +V GAL LY+DF+ I
Sbjct: 164 FYSGIVSLLLSWASVVVFSLFTAYDNQNLKVMYSQFAGQADTTGLAVNGALRLYLDFVNI 223

Query: 247 FVHLLRFLG 255
           F  LLR  G
Sbjct: 224 FFALLRIFG 232


>gi|222152575|ref|YP_002561750.1| membrane protein [Streptococcus uberis 0140J]
 gi|222113386|emb|CAR41032.1| putative membrane protein [Streptococcus uberis 0140J]
          Length = 229

 Score =  105 bits (261), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 64/239 (26%), Positives = 113/239 (47%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D GL  +  ++Y+L+ +G+G++  +S+L+                          ++
Sbjct: 8   TETDAGLNRFFAKIYSLVGMGVGLSAFVSYLMLF-----------------PFRENLISI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P  +    A   + +F+       +   A  +FL+YSAL G +LS     YT  ++
Sbjct: 51  ISQHPFVYYGAAAVELILVFIASSAAQRNTPMALPLFLIYSALNGFTLSFIIAAYTGTTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           ++ F  +AA F +++  G   K+DL  +   M+    G+ L S++N+FM S  +   +S 
Sbjct: 111 LEAFVSSAAVFFAMAFIGARVKKDLSGMRKAMMAALIGIILASVINIFMGSGTMSFIISI 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L A D Q IK  Y         +  +V  AL LY+DFI +F+ LLR  G  
Sbjct: 171 ISVLIFSGLIASDNQMIKRVYEANNGQ-VGDGWAVAMALSLYLDFINLFISLLRIFGRN 228


>gi|33519803|ref|NP_878635.1| putative permease [Candidatus Blochmannia floridanus]
 gi|33504148|emb|CAD83410.1| integral membrane protein interacts with FtsH [Candidatus
           Blochmannia floridanus]
          Length = 236

 Score =  105 bits (261), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 81/254 (31%), Positives = 135/254 (53%), Gaps = 20/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R            +  ++ Y+ +V+  M+ GL +T  +++  +I              
Sbjct: 1   MDRFPRFQGTLSDRDNTIIQPYISQVFGWMSCGLLLTAFVAWYTSITPAV---------- 50

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                      L     + +  I + L +   L+  +  LS   A  +F+LYS L GL+L
Sbjct: 51  --------LQLLFSNQIIFFGLIISQLALVFTLSGMVTRLSGSLATTLFMLYSVLTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS F++YTS SI  TF +T+  FG++++YGYTTK+DL  +G+ + MG  G+ L SLVN++
Sbjct: 103 SSIFILYTSSSISGTFIVTSGMFGAMTVYGYTTKKDLSSLGNLLFMGLIGMVLASLVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFI 244
           +++  I   ++ +G+++F  LTAYD QKIK   S     D     + S+IGAL LY+DFI
Sbjct: 163 LKNPTIMWIITYIGVILFVGLTAYDMQKIKSIGSSLSIEDQDQFRKYSIIGALTLYLDFI 222

Query: 245 QIFVHLLRFLGSRR 258
            +F+ ++R  G++R
Sbjct: 223 NLFMMMIRIFGNKR 236


>gi|195027179|ref|XP_001986461.1| GH20517 [Drosophila grimshawi]
 gi|193902461|gb|EDW01328.1| GH20517 [Drosophila grimshawi]
          Length = 246

 Score =  105 bits (261), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 44/241 (18%), Positives = 90/241 (37%), Gaps = 21/241 (8%)

Query: 19  STIDQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
           +  DQ +R  ++ +VY ++ + L +T     +      T      +  +    +      
Sbjct: 25  AFDDQTIRKGFIRKVYLILMMQLLITFGFVSVFTFSEATQKWAQTNYWLVWVALAVLIVT 84

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           ++  +    +    PL                       L++      L      Y +  
Sbjct: 85  MICMACCESVRRKTPLNFIFLF-----------------LFTLAESFLLGVIAGTYEADE 127

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           ++    ITAA    L+L+   TK D    G  ++       +  ++ +F+    I L  +
Sbjct: 128 VLMAVGITAAVSLGLTLFALQTKYDFTMCGGVLVACLVVFIIFGIIAIFIPGKIIGLVYA 187

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           ++G ++FS    YDTQ         +  + +  + +  AL LY+D + IF++LL  +G  
Sbjct: 188 SLGALLFSVYLVYDTQL---MLGGNHKYSISPEEYIFAALNLYLDIVNIFMYLLTIIGLA 244

Query: 258 R 258
           R
Sbjct: 245 R 245


>gi|296414197|ref|XP_002836789.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295631628|emb|CAZ80980.1| unnamed protein product [Tuber melanosporum]
          Length = 274

 Score =  105 bits (261), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 88/234 (37%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY ++ + L VT I S +     +       +  +    +    G L  T     
Sbjct: 68  AFVRKVYAILTVQLIVTAIFSSISFFNDSFKTWIQTNTWMLFIALFGSLGFLGLT----- 122

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S     +    ++ +   +++     Y  + +++   IT 
Sbjct: 123 ---------------FWKRHSYPMNLIFLSGFTLVEAYTVAIVTSFYDYRIVLEAVIITG 167

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV-NLFMRSSAIDLTMSAMGLVIFS 205
             F  L+L+   TK D     S++    + L +L  V   F  +  ++L  S +  ++FS
Sbjct: 168 LLFAGLTLFAMQTKYDFSSWHSYLYGALWLLIVLGFVSMFFPHNGWVELMYSGIAALLFS 227

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           A   +DTQ I        +        +  A+ LY+D I +F+ +LR L S  D
Sbjct: 228 AYILFDTQMIMRRMHVEEE--------IAAAIALYLDIINLFLAILRILNSSND 273


>gi|50545972|ref|XP_500523.1| YALI0B05280p [Yarrowia lipolytica]
 gi|49646389|emb|CAG82754.1| YALI0B05280p [Yarrowia lipolytica]
          Length = 261

 Score =  105 bits (261), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 91/236 (38%), Gaps = 30/236 (12%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++ +VY ++   +  T I   ++             + +    +    G L+      
Sbjct: 53  NNFIKQVYTIVTAQIATTAIFGAIIVFNPPITMWILEHMWVYYVTIFGSLGCLIA----- 107

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                S      +  +++   GL++ +   +  SK ++Q   IT
Sbjct: 108 ---------------CIWKQNSYPLNMTLLGVFTLCQGLAIGTVCSLMDSKVVLQAVAIT 152

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV-NLFMRSSAIDLTMSAMGLVIF 204
              F  L+L+ + TK DL  +   +    +GL  + LV      SSA++L  S++G ++F
Sbjct: 153 LVLFFGLTLFAFQTKYDLTSMAGILSACLWGLIGVGLVGMFVPFSSAVELIYSSIGALVF 212

Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS-RRD 259
           S     DTQ I               Q +  A+ +Y+D + +F+++LR L    RD
Sbjct: 213 SGYILVDTQMIIRKLH--------PDQVIPAAINIYLDILNLFLYILRILNEINRD 260


>gi|225718652|gb|ACO15172.1| Transmembrane BAX inhibitor motif-containing protein 4 [Caligus
           clemensi]
          Length = 246

 Score =  104 bits (260), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 96/226 (42%), Gaps = 28/226 (12%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++ +VY L+ + L +T +++ +            A+  +                    +
Sbjct: 44  FLRKVYGLLVVQLVLTTLIAGVCLFTPAVKTAVQANSWL--------------------V 83

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
            +   L + I L + ++        ++   ++ +   ++      +    +++ FFITA 
Sbjct: 84  MVAFILSIGILLALHVNRHKTPLNLILLAAFTVVEAYTVGVIVSFFDKLVVIEAFFITAT 143

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
               L+L+ + T +D    GS + +G + L +   +NLFM  +  DL M+  G ++FSA 
Sbjct: 144 VVVGLTLFTFNTSKDFTKWGSALFIGLWVLIIGGTLNLFMGGTGFDLLMTIGGTILFSAF 203

Query: 208 TAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
             +DTQ I E          +  + +   + LY+D I +F+ +L+ 
Sbjct: 204 IVFDTQMIMEK--------VSPEEYISATINLYLDIINLFIEILKL 241


>gi|119572691|gb|EAW52306.1| glutamate receptor, ionotropic, N-methyl D-asparate-associated
           protein 1 (glutamate binding), isoform CRA_c [Homo
           sapiens]
          Length = 304

 Score =  104 bits (260), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 72/143 (50%), Gaps = 4/143 (2%)

Query: 117 LYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFG 176
           + +A +   +      Y +++++    IT A   ++ ++   T+ D       +++    
Sbjct: 166 VLTASLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVV 225

Query: 177 LFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGA 236
           LF+ +++ +F+R+  +++  +++G ++F+   A DTQ +         ++ +  + V  A
Sbjct: 226 LFIFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAA 281

Query: 237 LMLYMDFIQIFVHLLRFLGSRRD 259
           L LY D I IF+++L  +G  ++
Sbjct: 282 LNLYTDIINIFLYILTIIGRAKE 304


>gi|260816793|ref|XP_002603272.1| hypothetical protein BRAFLDRAFT_60532 [Branchiostoma floridae]
 gi|229288590|gb|EEN59283.1| hypothetical protein BRAFLDRAFT_60532 [Branchiostoma floridae]
          Length = 279

 Score =  104 bits (260), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 44/259 (16%), Positives = 87/259 (33%), Gaps = 23/259 (8%)

Query: 3   DIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAA 62
           D  +      + +          R ++ +VY ++   L VT     +   +         
Sbjct: 42  DPESSGSSDENFASSAFNDKAIRRQFIKKVYLVLTAQLLVTFGFVCIFKFVPEVHQFARE 101

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
           +  +                    +                         +M  L++  +
Sbjct: 102 NPGLYWAGYAVFIVTYFALVCCPTVR-----------------RKYPMNVIMLSLFTLAM 144

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
              +      Y   S++    IT      +SL+   TK D    G F+ +G   LF+  L
Sbjct: 145 SYMVGIITSYYDIYSVLMAVGITCLVCFGVSLFAMQTKYDFTGCGGFLFVGVLVLFIFGL 204

Query: 183 VN--LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLY 240
           +    F     +    + +G ++F+   AYDTQ +            +  + + GAL LY
Sbjct: 205 IALITFPWVPILQTVYAGLGALLFALFLAYDTQLVV----GGKRHELSPEEYIAGALQLY 260

Query: 241 MDFIQIFVHLLRFLGSRRD 259
           +D + IF+ +L+ +GSR +
Sbjct: 261 LDIVYIFLFILQLVGSRGN 279


>gi|169780746|ref|XP_001824837.1| bax Inhibitor family protein [Aspergillus oryzae RIB40]
 gi|238505064|ref|XP_002383761.1| Bax Inhibitor family protein [Aspergillus flavus NRRL3357]
 gi|83773577|dbj|BAE63704.1| unnamed protein product [Aspergillus oryzae]
 gi|220689875|gb|EED46225.1| Bax Inhibitor family protein [Aspergillus flavus NRRL3357]
          Length = 271

 Score =  104 bits (260), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 47/234 (20%), Positives = 92/234 (39%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY ++   L +T IMS +     +      ++  +    +    G ++ T     
Sbjct: 65  QFVRKVYAILTAQLLLTTIMSSISFFSDSYRLWIQSNFWLMIVSVFGALGFMLVTYWK-- 122

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S  A  +    ++ L   S+S     Y ++ +VQ   +T 
Sbjct: 123 ------------------RKSYPANLLFLTAFTVLEAYSISVVTSFYDARIVVQALILTL 164

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMSAMGLVIFS 205
             F +L+L+   TK D      ++    + L L   V  F   SS ++L  S +  +IFS
Sbjct: 165 GMFVALTLFACQTKYDFTNWMPYLFGALWFLILFGFVAAFLPNSSTVELIYSGLAALIFS 224

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ I   Y    +        +  ++ LY+D + +F+ +LR L ++++
Sbjct: 225 GYILVDTQLIMRHYHVEEE--------IAASISLYLDILNLFLAILRILNNQQN 270


>gi|194466863|ref|ZP_03072850.1| protein of unknown function UPF0005 [Lactobacillus reuteri 100-23]
 gi|194453899|gb|EDX42796.1| protein of unknown function UPF0005 [Lactobacillus reuteri 100-23]
          Length = 235

 Score =  104 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 58/235 (24%), Positives = 105/235 (44%), Gaps = 17/235 (7%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           L  ++ ++Y LM L + ++ + ++LV                   V    F A M  +  
Sbjct: 17  LNKFLTKMYGLMTLAVLLSALTAWLVMT-----------------VFAQQFTAFMVNNRW 59

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
               I     +         + S      + +L + + G++ +     Y    I   F  
Sbjct: 60  GMWLIILLPIILTLGINFNATRSPGLCLFLLILTAIVYGITFAFIAGAYAGTDIATAFVS 119

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           +A  F ++++ G  + RD   IGS+      GL +  LVN F++S  I+  +S + ++IF
Sbjct: 120 SAGVFLTMAIIGTFSHRDFTRIGSYASAALIGLIIAMLVNFFVQSPMINYLLSIVAVIIF 179

Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +ALTA+D Q++K  Y +      +   +V+GAL LY+DFI +F+  L   GS  +
Sbjct: 180 TALTAWDAQRMKNIYIECNGQVSSNGLAVLGALQLYLDFINLFISFLDIFGSSNE 234


>gi|58697095|ref|ZP_00372540.1| integral membrane protein [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58698909|ref|ZP_00373773.1| membrane protein [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225630620|ref|YP_002727411.1| hypothetical protein WRi_008910 [Wolbachia sp. wRi]
 gi|58534574|gb|EAL58709.1| membrane protein [Wolbachia endosymbiont of Drosophila ananassae]
 gi|58536619|gb|EAL59942.1| integral membrane protein [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|225592601|gb|ACN95620.1| hypothetical protein WRi_008910 [Wolbachia sp. wRi]
          Length = 240

 Score =  104 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 93/248 (37%), Positives = 147/248 (59%), Gaps = 25/248 (10%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MS +RN Q + + G  + +    GLR+Y+ +VYN MAL LGVTG+++FL           
Sbjct: 1   MSYMRNEQDIRSQGVYYSA----GLRSYLTKVYNYMALALGVTGLVAFLTVFSGL----- 51

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                         F  +     L  + + +P+ +  +++ R+  LSA +A  +F  +S 
Sbjct: 52  --------------FQVIYSNPVLSLVVMLSPVALVFYMSYRIQHLSAQSAVTIFFSFSV 97

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLS  F+VYT+++I + FFIT+  FGS++LYG TTKRDL  +GSF+IMG  G+ + 
Sbjct: 98  LMGLSLSYIFIVYTAENIARAFFITSIMFGSMALYGNTTKRDLTSMGSFLIMGVLGIIIA 157

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVA--YAERQSVIGALM 238
           S+VNLF+ SS +   +S + +++F+ +TAYD Q+IK+ Y    D +     + +++GA  
Sbjct: 158 SIVNLFLGSSPLYFAISFISVIVFTLMTAYDAQRIKDVYYKHNDGSEVATTKLAILGATN 217

Query: 239 LYMDFIQI 246
           LY DFI I
Sbjct: 218 LYFDFINI 225


>gi|332522236|ref|ZP_08398488.1| putative membrane protein [Streptococcus porcinus str. Jelinkova
           176]
 gi|332313500|gb|EGJ26485.1| putative membrane protein [Streptococcus porcinus str. Jelinkova
           176]
          Length = 229

 Score =  104 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 68/239 (28%), Positives = 111/239 (46%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           S  D GL  +  ++Y L+  G+G++  +S+L+                          A+
Sbjct: 8   SETDTGLSQFFAKIYGLVGAGVGLSAFVSYLMLY-----------------PFRDNLVAI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P  +        V +FL       +   A  +FL YSAL G +LS     YT  ++
Sbjct: 51  IANHPFVYYGAIILELVLVFLASGAAQRNTPMALPLFLFYSALNGFTLSFIIAAYTQTTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +Q F  +AA F ++S+ G  TK+DL      ++    G+ + S+VNLF+ S  ++  +S 
Sbjct: 111 LQAFISSAAVFFTMSMIGLLTKKDLSGFSKALMAALIGIIVASVVNLFIGSGGLNFIISI 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L A D  +IK  Y         +  +V  AL LY+DFI +F+ LLR  G  
Sbjct: 171 VSVLIFSGLIAVDNNRIKAVYQATNGQ-VGDGWAVAMALSLYLDFINLFISLLRIFGRN 228


>gi|195382880|ref|XP_002050156.1| GJ21986 [Drosophila virilis]
 gi|194144953|gb|EDW61349.1| GJ21986 [Drosophila virilis]
          Length = 244

 Score =  104 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 45/256 (17%), Positives = 93/256 (36%), Gaps = 21/256 (8%)

Query: 5   RNYQRVVNSGSGFGSTIDQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
            N            +  DQ +R  ++ +VY ++ + L +T     +      T +    +
Sbjct: 9   NNGVYADAEADKSFAFDDQTIRKGFIRKVYLILMVQLLITFGFVSVFTFSKATQEWAMHN 68

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
             +    +      ++  +    +    PL                       L++    
Sbjct: 69  PALFWIALAVLLVTMICMACCESVRRKTPLNFIFLF-----------------LFTLAES 111

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
             L      Y +  ++    ITAA    L+++   TK D    G  ++       +  ++
Sbjct: 112 FLLGIVAGQYQADEVLMAVGITAAVSLGLTIFALQTKYDFTMCGGVLVACLVVFLIFGII 171

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
            +F+    I L  +++G ++FS    YDTQ         +  A +  + +  AL LY+D 
Sbjct: 172 AIFIPGQIIGLVYASLGALLFSVYLVYDTQL---MLGGNHRYAISPEEYIFAALNLYLDI 228

Query: 244 IQIFVHLLRFLGSRRD 259
           I IF+++L  +G  R+
Sbjct: 229 INIFMYILTIIGLARN 244


>gi|167471049|ref|ZP_02335753.1| hypothetical protein YpesF_25027 [Yersinia pestis FV-1]
          Length = 223

 Score =  104 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 81/241 (33%), Positives = 128/241 (53%), Gaps = 20/241 (8%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
             R   S          G++AYM +VY  M  GL +T ++++      + +    ++ I+
Sbjct: 1   MDRYPRSNGSIVERAGSGIQAYMAQVYGWMTCGLLLTAVVAWYAANTPSIIFALQSNQIL 60

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
             G+++   G +   S                    ++ LS  AA  +F+LYSAL GL+L
Sbjct: 61  FFGLIIAQLGLVFVISG------------------MVNRLSGTAATSLFMLYSALTGLTL 102

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           SS  ++YT  SI  TF I A  FG++S YGYTTKRDL  +GS + MG  G+ L SLVN++
Sbjct: 103 SSILIMYTGASIASTFVICAGMFGAMSFYGYTTKRDLSGMGSMLFMGLIGIILASLVNIW 162

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRY--DVAYAERQSVIGALMLYMDFI 244
           ++S A+   ++ +G+++F  LTAYDTQK+K   +     +     + S++GA   Y+DFI
Sbjct: 163 LKSPALMWVVTYIGVLVFVGLTAYDTQKLKNLGAQLDVNEKDSFRKCSLVGASTGYLDFI 222

Query: 245 Q 245
            
Sbjct: 223 N 223


>gi|251781825|ref|YP_002996127.1| integral membrane protein [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242390454|dbj|BAH80913.1| integral membrane protein [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
          Length = 229

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 66/239 (27%), Positives = 114/239 (47%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D GL  +  ++Y+L+ +G+G++  +S+L+                          ++
Sbjct: 8   TQSDAGLNQFFAKIYSLVGMGIGLSAFVSYLMLY-----------------PFRDNLVSI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P+ +        + +F+       +  AA  +FL+YSAL G +LS    +YT  ++
Sbjct: 51  IANQPMVYYGAVIIELILVFVASGAARKNTPAALPLFLIYSALNGFTLSFIIAIYTQTTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            Q F  +A  F ++S+ G  TKRD+  +   M     G+ + SL+NLF+ S  +   +S 
Sbjct: 111 FQAFVSSAVVFFAMSVLGVKTKRDMTGLRKAMFAALIGIIVASLINLFIGSGMMSYVISI 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L A D Q IK  Y         +  +V  AL LY+DFI +F+ LLR  G  
Sbjct: 171 ISVLIFSGLIASDNQMIKRVYQATNGQ-VGDGWAVAMALSLYLDFINLFISLLRLFGRN 228


>gi|42519089|ref|NP_965019.1| hypothetical protein LJ1163 [Lactobacillus johnsonii NCC 533]
 gi|41583376|gb|AAS08985.1| hypothetical protein LJ_1163 [Lactobacillus johnsonii NCC 533]
          Length = 238

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 57/251 (22%), Positives = 112/251 (44%), Gaps = 17/251 (6%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
                        + GL +++ ++Y  MAL + V+ + ++L   +  +            
Sbjct: 3   NFDQEPERRHLVDESGLNSFLSKIYGYMALAVFVSALSAYLTMTVFASQMV--------- 53

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
                   +LM   P     +     V  F      + +  A+ ++ ++ + + G++ + 
Sbjct: 54  --------SLMVHHPWTMWLLLLIPIVLTFAINFQATRNPVASFILLMITAIVYGVTFAF 105

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
               YT + I   F  +A  F  +++ G  TK+DL   GS+      GL +  L+N+F++
Sbjct: 106 IAGTYTGQDIASAFIASATVFVVMAILGTVTKKDLSRWGSYASAALIGLIVAMLINMFLK 165

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFV 248
           SSA +   S + ++IF+ LTA+D Q++K  Y            +++GAL LY+DF+ +F+
Sbjct: 166 SSAANYIFSFIAVIIFTVLTAWDAQRMKNIYLQFGGELPTNGLAIVGALQLYLDFVNLFL 225

Query: 249 HLLRFLGSRRD 259
             L   GS  +
Sbjct: 226 QFLTIFGSNDN 236


>gi|326468829|gb|EGD92838.1| hypothetical protein TESG_00403 [Trichophyton tonsurans CBS 112818]
 gi|326481440|gb|EGE05450.1| bax Inhibitor family protein [Trichophyton equinum CBS 127.97]
          Length = 275

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/234 (20%), Positives = 90/234 (38%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY+++ + L +T  +S +    A       +   +  G ++     ++ T     
Sbjct: 69  QFIRKVYSILTVQLILTTALSSVSFFNAKYKSWVQSHSWLMIGSLIGAIVFMLLTYWK-- 126

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S     +    ++ L G ++S     Y SK ++Q   IT 
Sbjct: 127 ------------------RKSYPTNLLFLSGFTLLEGYAISVITSFYDSKIVMQALVITM 168

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFS 205
             F  L+L+   TK D      ++    + L +   V   F     +DL   A+G +IFS
Sbjct: 169 GLFIGLTLFACQTKYDFTGWMPYLFGALWFLVIFGFVAAFFPVGKTMDLIYGAVGALIFS 228

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ +   Y    +        +  A+ LY+D I +F+ +LR L ++ +
Sbjct: 229 GYILVDTQLVMRHYHVEEE--------IAAAISLYLDIINLFLSILRILNNQSN 274


>gi|195978749|ref|YP_002123993.1| integral membrane protein [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|195975454|gb|ACG62980.1| integral membrane protein [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
          Length = 230

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 73/239 (30%), Positives = 116/239 (48%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D GL  +  +VY+L+ +G+G++  +S+L+                          ++
Sbjct: 9   TQSDAGLSHFFAKVYSLVGMGVGLSAFVSYLMLF-----------------PFRQNLVSI 51

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P+ +        V +F+       +  AA  +FL+YSAL G +LS     Y   ++
Sbjct: 52  ILDHPMVYYGAAIVELVLVFVASGAARRNTPAALPLFLVYSALNGFTLSFIIAAYAQTTV 111

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +Q F  +AA F ++SL G   KRDL  I   M     G+ + SLVNLF+ S  +   +S 
Sbjct: 112 LQAFISSAAVFFAMSLLGVKVKRDLSGIRKAMFAALIGIIVASLVNLFIGSDLMSYVISL 171

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L A D Q IK+ Y      A  +  +V  AL LY+DFI +F+ LLR LG  
Sbjct: 172 ISVLIFSGLIASDNQMIKQVYQASNGQA-GDGWAVAMALSLYLDFINLFISLLRLLGRN 229


>gi|315619785|gb|EFV00304.1| conserved hypothetical protein [Escherichia coli 3431]
 gi|323172098|gb|EFZ57737.1| hypothetical protein ECLT68_3339 [Escherichia coli LT-68]
 gi|332767948|gb|EGJ98134.1| hypothetical protein SF293071_0904 [Shigella flexneri 2930-71]
          Length = 207

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 86/225 (38%), Positives = 131/225 (58%), Gaps = 20/225 (8%)

Query: 36  MALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGV 95
           M +GL +T  +++     A  ++    + +   G+++                  A L +
Sbjct: 1   MTVGLLLTAFVAWYAANSAAVMELLFTNRVFLIGLII------------------AQLAL 42

Query: 96  FIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLY 155
            I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ SI  TF +TA  FG++SLY
Sbjct: 43  VIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAASIASTFVVTAGMFGAMSLY 102

Query: 156 GYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKI 215
           GYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+++F  LTAYDTQK+
Sbjct: 103 GYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVIVFVGLTAYDTQKL 162

Query: 216 KEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           K         D +   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 163 KNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFGNRR 207


>gi|145237608|ref|XP_001391451.1| bax Inhibitor family protein [Aspergillus niger CBS 513.88]
 gi|134075925|emb|CAK48119.1| unnamed protein product [Aspergillus niger]
          Length = 272

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 92/234 (39%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY ++   L +T I+S +            ++  +    +    G ++ T     
Sbjct: 66  QFIRKVYAILTAQLLLTTILSSISFFSPNYRLWIQSNFWLMMVSVFGALGFMLVTYWK-- 123

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S  A  +    ++ L   S+S     Y ++ ++Q   +T 
Sbjct: 124 ------------------RKSYPANLLFLSGFTLLEAYSISVVTSFYDARLVIQALILTL 165

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR-SSAIDLTMSAMGLVIFS 205
             F +L+L+   TK D      ++  G + L L   V +F   +S ++L    +  +IFS
Sbjct: 166 GLFVALTLFACQTKYDFTNWMPYLFGGLWFLILFGFVAVFFPANSTVELIYGGLAALIFS 225

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           A    DTQ +   Y    +        +  ++ LY+D + +F+ +LR L S+ +
Sbjct: 226 AYILVDTQLVMRHYHVEEE--------IAASISLYLDILNLFLAILRILNSQNN 271


>gi|229817421|ref|ZP_04447703.1| hypothetical protein BIFANG_02683 [Bifidobacterium angulatum DSM
           20098]
 gi|229785210|gb|EEP21324.1| hypothetical protein BIFANG_02683 [Bifidobacterium angulatum DSM
           20098]
          Length = 287

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 63/232 (27%), Positives = 114/232 (49%), Gaps = 20/232 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           + R Y  M +GL VT  ++ +  +    +   A + II                   +  
Sbjct: 72  VTRSYGEMTIGLLVTAAVAIVTQMTGLYIAFIAKTGIIG-----------------VFAP 114

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           +   + + I L  R+  +    A++MF +Y+AL+G SLS  F VY   +I     + A  
Sbjct: 115 LVIEIVLAIALGARITKMKTSTARVMFYIYAALMGFSLSVIFAVYDLGTIGIALALCAGF 174

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS-LVNLFMRSSAIDLTMSAMGLVIFSAL 207
           F +L++ G TTK DL   G  + +G   L +   L+ +F       + +SA+GL++F+  
Sbjct: 175 FFALTMLGMTTKVDLLKAGPILGVGLIVLIIAEVLLMIFAPGQTTLMLVSAIGLILFAGF 234

Query: 208 TAYDTQKIKEAYSDR--YDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           T YD Q+ +  ++     D    ++ S++ AL LY+DF+ +F+++L+ LG+R
Sbjct: 235 TVYDAQQTRAIFAQYSGQDPEIIKKISILCALNLYLDFVNMFLYILQLLGNR 286


>gi|329667372|gb|AEB93320.1| integral membrane protein [Lactobacillus johnsonii DPC 6026]
          Length = 237

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 60/251 (23%), Positives = 112/251 (44%), Gaps = 17/251 (6%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
                        + GL +++ ++Y  MAL + V+ + ++L                   
Sbjct: 3   NFDQEPERRHLVDEAGLNSFLSKIYGYMALAVFVSALSAYLTMT---------------- 46

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
            V      +LM   P     +     V  F      + +  A+ ++ ++ + + G++ + 
Sbjct: 47  -VFARQMVSLMVHHPWTMWLLLLIPIVLTFAINFQATRNPVASFILLMVTAIIYGVTFAF 105

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
               YT + I   F  +A  F  +++ G  TK+DL   GS+      GL +  L+N+F++
Sbjct: 106 IAGTYTGQDIASAFVASATVFVVMAILGTVTKKDLSRWGSYASAALIGLIVAMLINMFLK 165

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFV 248
           SSA +   S + ++IF+ LTA+D Q++K  Y        A   +V+GAL LY+DF+ +F+
Sbjct: 166 SSAANYIFSFIAVIIFTVLTAWDAQRMKNIYLQFGGEVSANGLAVMGALQLYLDFVNLFL 225

Query: 249 HLLRFLGSRRD 259
             L   GS  +
Sbjct: 226 QFLTIFGSNDN 236


>gi|160915437|ref|ZP_02077648.1| hypothetical protein EUBDOL_01445 [Eubacterium dolichum DSM 3991]
 gi|158432557|gb|EDP10846.1| hypothetical protein EUBDOL_01445 [Eubacterium dolichum DSM 3991]
          Length = 251

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 72/243 (29%), Positives = 123/243 (50%), Gaps = 20/243 (8%)

Query: 18  GSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
             + + GLR ++   +  M +GL  + +++ LV++        ++               
Sbjct: 28  SVSYESGLRRHVAHTFLWMTIGLLTSALVALLVSLTDLVWVIYSS--------------- 72

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
               S   WI + A  GV I L  R+ S+    A+++FL Y+ L G++ S+    Y   +
Sbjct: 73  ----SWTPWILLIAQFGVVIALAARITSMKPSMARILFLAYAILTGVTFSTLGFAYDLGT 128

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           I   F ITA  FG L+  G TTK +L   G  +++G F L +  L+ +   ++   +  +
Sbjct: 129 IGAAFLITAVYFGCLAFIGLTTKINLLRFGPILMIGLFALIVCELLLMLFGANTNTMVFA 188

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVA-YAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           A+GL++F+ +TAYD QK+K  Y+         +R S+  A  LY+DFI IF+++L+FLG 
Sbjct: 189 ALGLLLFTGITAYDAQKMKVLYTQYQGDEVMLKRLSIYSAFDLYLDFINIFLYVLQFLGD 248

Query: 257 RRD 259
           R D
Sbjct: 249 RND 251


>gi|296817631|ref|XP_002849152.1| FBL4 [Arthroderma otae CBS 113480]
 gi|238839605|gb|EEQ29267.1| FBL4 [Arthroderma otae CBS 113480]
          Length = 275

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 90/234 (38%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY+++ + L +T  +S +            +   +  G ++     ++ T     
Sbjct: 69  QFIRKVYSILTVQLILTTALSSVSFFNTRYKSWVQSHSWLMIGSLIGAIVFMLLTYWK-- 126

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S     +    ++ L G ++S     Y SK ++Q   +T 
Sbjct: 127 ------------------RKSYPTNLLFLSGFTLLEGYAISVITSFYDSKIVMQALILTM 168

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFS 205
             F  L+L+   TK D      ++  G + L +   V   F     +DL   A+G +IFS
Sbjct: 169 GLFIGLTLFACQTKYDFTGWMPYLFGGLWFLVIFGFVAAFFPMGKTMDLVYGAVGALIFS 228

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ +   Y    +        +  A+ LY+D I +F+ +LR L ++ +
Sbjct: 229 GYILVDTQLVMRHYHVEEE--------IAAAISLYLDIINLFLSILRILNNQSN 274


>gi|195151450|ref|XP_002016660.1| GL11699 [Drosophila persimilis]
 gi|194110507|gb|EDW32550.1| GL11699 [Drosophila persimilis]
          Length = 304

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 93/234 (39%), Gaps = 21/234 (8%)

Query: 22  DQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           DQ +R  ++ +VY+++ + L  T     L      T      + ++     +     L+ 
Sbjct: 87  DQTIRKGFIRKVYSILLVQLLFTCGTIALFLYHEPTKMFVQKNPVVLIVAAVLNIIVLIM 146

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
              +  +                   +     +   +++  + L L     V  +  ++ 
Sbjct: 147 IVCIEGVR-----------------RAHPTNLVCLGIFTVTMSLMLGCVSSVMNANLVLI 189

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              +TA     LS+Y   TK D   +G  ++     + +  L N+ M S   ++ MS++ 
Sbjct: 190 AVGVTAFLVIGLSVYAIQTKVDYTAMGGVLVTFVMCIIIFGLSNMLMPSLTENIVMSSLM 249

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
            +I      YDTQ+I       ++  ++  + V  AL LY+D ++I V++LR L
Sbjct: 250 AIIACFFLIYDTQQIV---GGNHEYQFSPEEYVFAALTLYVDVVRILVYILRIL 300


>gi|156547974|ref|XP_001605147.1| PREDICTED: similar to MGC88883 protein [Nasonia vitripennis]
          Length = 252

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/232 (17%), Positives = 97/232 (41%), Gaps = 28/232 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY L+++ L +T I++ +  ++         +           FG L+       
Sbjct: 48  AFIRKVYGLLSMQLLMTVIIAGIFCLVEPVKFYVTHTGWPIMTSFFVTFGILIAL----- 102

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                           +      +  ++   ++ +   ++     +Y    +++  FIT 
Sbjct: 103 ---------------HIKRRDHPSNLILLACFTLVQACTIGIVVSLYDVFLVLEALFITL 147

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
               +L+ + + TKRD   + + +  G   L +  L+ +F+ SS ++L +   G ++FS 
Sbjct: 148 TVVIALTAFTFQTKRDFSAMHAGLFSGLCVLLIGGLLQVFILSSLMELLLCVGGAMLFSF 207

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
              +DTQ + +          +  + ++  + +Y+D I +F+++LR L   R
Sbjct: 208 FIIFDTQLLMKT--------LSPEEYILATINIYLDIINLFLYILRILAIAR 251


>gi|41055066|ref|NP_957502.1| glutamate receptor, ionotropic, N-methyl D-aspartate-associated
           protein 1 (glutamate binding) [Danio rerio]
 gi|31419541|gb|AAH53253.1| Zgc:64102 [Danio rerio]
          Length = 328

 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/224 (15%), Positives = 80/224 (35%), Gaps = 21/224 (9%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +V+++++L L +T     +             +        L             
Sbjct: 125 RVFIRKVFSVLSLQLAITTAFVAIFTFEPHVKLFVMQNSWTYWVGYLVFL---------- 174

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                  +  F+ L             +   + +  +   +      Y +  ++    IT
Sbjct: 175 -------VPYFVILCCGEFRRKHPWNLICLSVLTLAMSYMVGVISSFYDTDIVIMAIGIT 227

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
                ++ ++   TK D       + +    LF+  ++ +   S  +DL  S +G ++F+
Sbjct: 228 VVVCFTVIIFSMQTKYDFTSCYGVLFVCGIVLFVFGILCIIFYSKIMDLIYSTLGALLFT 287

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVH 249
              A DTQ +        +++ +  + +  +L LY+D IQIF+ 
Sbjct: 288 CFLAVDTQLL----LGNKNLSLSPEEYIFASLNLYLDIIQIFLS 327


>gi|195431042|ref|XP_002063557.1| GK21973 [Drosophila willistoni]
 gi|194159642|gb|EDW74543.1| GK21973 [Drosophila willistoni]
          Length = 299

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 48/240 (20%), Positives = 94/240 (39%), Gaps = 21/240 (8%)

Query: 19  STIDQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGA 77
           +  DQ +R  ++ +VY ++ + L +T  +  L      T      +  +    M++    
Sbjct: 80  AFNDQSIRKGFIRKVYGILLVQLLITCGVIALFIYHEPTKWFVRQNQYVLGVAMVSNIIV 139

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           ++  +                        S     +    ++  + L L +      S+ 
Sbjct: 140 MLSMAC-----------------CETARRSFPLNFICLGFFTVTMSLLLGAVASSLDSQD 182

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           ++    IT      LS+Y   TK D    G  ++     LF+LSLV  F  S   ++ ++
Sbjct: 183 VLMAVGITVLLVVGLSIYAIQTKYDFTAWGGVLVSCILCLFVLSLVGAFNPSIFSNIAIA 242

Query: 198 AMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + G +I   L  YDTQ I       +   +     +  AL LY+D ++IF+++LR +  +
Sbjct: 243 SFGALIACFLLIYDTQLIM---GGNHKYQFNPEDYIFAALTLYVDIVRIFLYVLRLVARK 299


>gi|119479461|ref|XP_001259759.1| Bax Inhibitor family protein [Neosartorya fischeri NRRL 181]
 gi|119407913|gb|EAW17862.1| Bax Inhibitor family protein [Neosartorya fischeri NRRL 181]
          Length = 270

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 93/234 (39%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY ++ + L +T IMS +     +      ++  +    +    G ++ T     
Sbjct: 64  QFIRKVYAILTIQLLLTTIMSSISFFSESYRLWIQSNFWLMMVSVFGALGFMLVTYWK-- 121

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S  A  +    ++ L   S+S     Y ++ +VQ   +T 
Sbjct: 122 ------------------RKSYPANLLFLSGFTLLEAYSISVVTSFYDARIVVQALILTL 163

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFS 205
             F +L+L+   TK D      ++  G + L L   ++  F  +S  +L    +  +IFS
Sbjct: 164 GIFVALTLFACQTKYDFTNWMPYLFGGLWFLILFGFMSAFFPYNSTAELIYGGLAALIFS 223

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           A    DTQ +   Y    +        +  A+ LY+D + +F+ +LR L ++ +
Sbjct: 224 AYILVDTQLVMRHYHVEEE--------IAAAISLYLDILNLFLAILRILNNQNN 269


>gi|315048883|ref|XP_003173816.1| hypothetical protein MGYG_03987 [Arthroderma gypseum CBS 118893]
 gi|311341783|gb|EFR00986.1| hypothetical protein MGYG_03987 [Arthroderma gypseum CBS 118893]
          Length = 275

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 89/234 (38%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY+++ + L +T  +S +    A       +   +  G ++              
Sbjct: 69  QFVRKVYSILTVQLILTTALSSVSFFNAKYKSWVQSHSWLMIGSLIG------------- 115

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                   +   L       S     +    ++ L G ++S     Y SK ++Q   IT 
Sbjct: 116 -------AIVFMLLTYWKRKSYPTNLLFLSGFTLLEGYAISVITSFYDSKIVMQALVITM 168

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFS 205
             F  L+L+   TK D      ++    + + +   V   F     +DL   A+G ++FS
Sbjct: 169 GLFIGLTLFACQTKYDFTGWMPYLFGALWFMVIFGFVAAFFPVGKTMDLIYGAVGALVFS 228

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ +   Y    +        +  A+ LY+D I +F+ +LR L ++ +
Sbjct: 229 GYILVDTQLVMRHYHVEEE--------IAAAISLYLDIINLFLSILRILNNQSN 274


>gi|225683445|gb|EEH21729.1| transmembrane BAX inhibitor motif-containing protein
           [Paracoccidioides brasiliensis Pb03]
          Length = 275

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 86/234 (36%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY ++ + L +T ++S +                +                    
Sbjct: 69  QFVRKVYFILTIQLLLTTVLSSISFFSENYRTWIQTHPWL-------------------- 108

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
           + + A   +           S     M    ++ L   ++S     Y ++ ++Q   +T 
Sbjct: 109 MLVSAISALVFMGLTYWKRKSYPTNLMFLGGFTILEAYAISVTTSFYDARIVIQALVLTL 168

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL-SLVNLFMRSSAIDLTMSAMGLVIFS 205
             F +L+L+   TK D      ++    + + +   +     +SS +DL    +  ++FS
Sbjct: 169 GIFVALTLFACQTKYDFTSWMPYLFGALWLVIIFGFMAAFLPKSSKMDLVYGVVIALLFS 228

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ +   Y    +        +  ++ LY+D I +F+ +LR L S+ D
Sbjct: 229 GYILVDTQLVMRHYHVEEE--------IAASISLYLDIINLFLAILRILNSQND 274


>gi|270284051|ref|ZP_05965467.2| putative membrane protein [Bifidobacterium gallicum DSM 20093]
 gi|270278004|gb|EFA23858.1| putative membrane protein [Bifidobacterium gallicum DSM 20093]
          Length = 285

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 62/232 (26%), Positives = 120/232 (51%), Gaps = 20/232 (8%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           + R Y  M +GL +T  ++F+  +    +    A+ +I                    + 
Sbjct: 70  VTRTYGEMTIGLLITAAVAFITQMTGAYISFIRATGLIG-----------------ILLV 112

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
               +G+ ++L VR+  + A  A++ F +++AL+G +LS+ F+ Y+  +I     +TA  
Sbjct: 113 AGVQIGLAVYLGVRVMKMQASTARIWFYVFAALMGFTLSTIFMAYSLGTIGVALLVTAGF 172

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLS-LVNLFMRSSAIDLTMSAMGLVIFSAL 207
           F +L+++G TTK ++   G  +++G   L +   +V          + ++A+G+V+F+ L
Sbjct: 173 FFALTMFGMTTKGNMLKAGPVLLIGLIVLIVAEVIVMFIFPGDTAMMIITALGIVVFAGL 232

Query: 208 TAYDTQKIKEAYSDRYDV--AYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           T YDTQ +K  ++          +R S++ AL LY+DFI +F+++LR  GSR
Sbjct: 233 TIYDTQFMKRVFAQYSSQGPEAIKRLSILCALNLYLDFINMFLYILRLFGSR 284


>gi|311255302|ref|XP_003126168.1| PREDICTED: fas apoptotic inhibitory molecule 2-like [Sus scrofa]
          Length = 274

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/238 (16%), Positives = 84/238 (35%), Gaps = 25/238 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++ + L VT  +  L        D   A+           F          
Sbjct: 58  RVFIRKVYTILLIQLLVTLGVVALFTFCDPVKDYVQANPGWYWASYAVFFAT-------- 109

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      ++  +++  +          Y + S++    IT
Sbjct: 110 ---------YLTLACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLGIT 160

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAMGL 201
           A    S++++ + TK D       + +    LF    +L+++  F     +    + +G 
Sbjct: 161 ALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAVLGA 220

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            +F+   A+DTQ +          + +  + + GAL +Y+D I IF   L+  G+ R+
Sbjct: 221 GVFTLFLAFDTQLLM----GSRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE 274


>gi|57092469|ref|XP_531662.1| PREDICTED: similar to Z-protein (S1R protein) [Canis familiaris]
          Length = 238

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/228 (20%), Positives = 95/228 (41%), Gaps = 28/228 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY++++L + +T + +       +       S  +     L   G +   +    
Sbjct: 33  AFLRKVYSILSLQVLLTSVTASFFLYFESVRTFVHESPALILVFALGSLGLIFALT---- 88

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                           ++         +   ++    L+++     Y    I+Q F +T 
Sbjct: 89  ----------------VNRHKHPLNLYLLFGFTLFEALTVAFVVTFYDVYIILQAFILTT 132

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
           A F  L++Y   +KRD    G+ +    + L L  ++ LF  S  ++L ++A+G ++F  
Sbjct: 133 AVFLGLTVYTLQSKRDFSKFGAGLFAVLWILCLSGILKLFFYSQTLELVLAAVGALLFCG 192

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
              YDT  +            +  + V+ A+ LY+D I +F+HLLRFL
Sbjct: 193 FIIYDTHSLMH--------RLSPEEYVLAAISLYLDVINLFLHLLRFL 232


>gi|291389507|ref|XP_002711362.1| PREDICTED: transmembrane BAX inhibitor motif containing 4-like
           [Oryctolagus cuniculus]
          Length = 238

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 49/228 (21%), Positives = 95/228 (41%), Gaps = 28/228 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY++++L + +T + S +     +      AS  +     L   G +   +    
Sbjct: 33  AFLRKVYSILSLQVLLTTVTSAIFLYCESIRVFVHASPALILVFALGSLGFIFALT---- 88

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                           L+         +   ++ L  L++      Y    ++Q F +T 
Sbjct: 89  ----------------LNRHKHPLNLYLLFGFTLLEALTVGIAVTFYDVYVVLQAFILTT 132

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
           A F  L+ Y   +KRD    G+ +    + L L  ++  F  S  ++L ++A+G ++F  
Sbjct: 133 AVFLGLTAYTLQSKRDFSKFGAGLFAVLWILCLSGILKSFFNSETMELVLAAVGALLFCG 192

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
              YDT  +            +  + V+ A+ LY+D I +F+HLLRFL
Sbjct: 193 FIIYDTHSLMHK--------LSPEEYVLAAISLYLDIINLFLHLLRFL 232


>gi|56417258|ref|YP_154332.1| hypothetical protein AM1276 [Anaplasma marginale str. St. Maries]
 gi|222475622|ref|YP_002564039.1| hypothetical protein AMF_964 [Anaplasma marginale str. Florida]
 gi|254995427|ref|ZP_05277617.1| hypothetical protein AmarM_05848 [Anaplasma marginale str.
           Mississippi]
 gi|255003615|ref|ZP_05278579.1| hypothetical protein AmarPR_05318 [Anaplasma marginale str. Puerto
           Rico]
 gi|255004744|ref|ZP_05279545.1| hypothetical protein AmarV_05698 [Anaplasma marginale str.
           Virginia]
 gi|56388490|gb|AAV87077.1| hypothetical protein AM1276 [Anaplasma marginale str. St. Maries]
 gi|222419760|gb|ACM49783.1| Conserved hypothetical protein [Anaplasma marginale str. Florida]
          Length = 233

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 93/251 (37%), Positives = 150/251 (59%), Gaps = 21/251 (8%)

Query: 10  VVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRG 69
              S    G+    GLR+Y+++VYN MA  LG+TG+++ + +                  
Sbjct: 2   NDYSAQFQGAYYCAGLRSYLVKVYNYMAAALGLTGVVALMTSFS---------------- 45

Query: 70  VMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSF 129
               G  +++Y +PL W+   AP+ +  FL+ R+HS+S  A   +F  ++A +GLSLS  
Sbjct: 46  ---HGLMSVLYGTPLHWVVSLAPIVMVFFLSSRVHSMSVQAVFAVFFGFAATMGLSLSYM 102

Query: 130 FLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS 189
           F+VYT+ SI + FFI++A FG ++ YG TTKRDL   G+F+IMG  G+ + S+VN+FM S
Sbjct: 103 FMVYTAHSIARVFFISSAMFGVMAFYGNTTKRDLSKFGTFLIMGVVGILIASVVNIFMAS 162

Query: 190 SAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVA--YAERQSVIGALMLYMDFIQIF 247
             +   +S + +V+F+A+TA+D Q+IK+ Y    D +   + + +V+GA  LY ++I IF
Sbjct: 163 GPLHFAISVVAVVVFTAMTAFDAQRIKDMYYRFNDGSEVTSSKMAVMGATSLYFNYINIF 222

Query: 248 VHLLRFLGSRR 258
           + LL  +G RR
Sbjct: 223 LSLLHLMGDRR 233


>gi|116629636|ref|YP_814808.1| integral membrane protein, interacts with FtsH [Lactobacillus
           gasseri ATCC 33323]
 gi|116095218|gb|ABJ60370.1| Integral membrane protein, interacts with FtsH [Lactobacillus
           gasseri ATCC 33323]
          Length = 244

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 63/251 (25%), Positives = 112/251 (44%), Gaps = 17/251 (6%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
               +        + G+  ++ R+Y LMAL + V+ + S+L   +      +        
Sbjct: 10  NFDQNPERRHLVDESGVNIFLSRLYGLMALAVLVSALSSYLTMTVFARQMVN-------- 61

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
                    LM   P    F+         +     + S   + ++ +L + + G++ + 
Sbjct: 62  ---------LMNYHPWAMWFLLLLPIALTLIINFNATRSPGMSFVLLMLTAIVYGVTFAF 112

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
               YT + I   F  +A+ F  +++ G  TKRDL  IGS+      GL +  L+NLF++
Sbjct: 113 IAGAYTGEDIASAFIASASVFIVMAILGTVTKRDLSRIGSYASAALIGLIVAMLINLFLK 172

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFV 248
           +  ID   S + ++IF+ LTA+D Q+IK  Y            +V+GAL LY+DF+ +F+
Sbjct: 173 NPTIDYIFSFIAVIIFTILTAWDAQRIKNIYLQFGGELSTNGLAVLGALQLYLDFVNLFL 232

Query: 249 HLLRFLGSRRD 259
             L   GS  +
Sbjct: 233 QFLDIFGSNDN 243


>gi|149632261|ref|XP_001510640.1| PREDICTED: similar to CGI-119 protein [Ornithorhynchus anatinus]
          Length = 238

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 95/228 (41%), Gaps = 28/228 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY++++L + +T + + +             S  +    +L  FG ++  +    
Sbjct: 33  AFLRKVYSILSLQILLTTVTAAVFLYSEAVRTFVHQSPALILVSVLGSFGLIIALT---- 88

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                            +         +   ++ L  L+++     Y    ++Q F +TA
Sbjct: 89  ----------------FYRHKHPTNLYLLFGFTLLEALTVAVTVTFYEVHVVLQAFMLTA 132

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
           A F  L+ Y   +KRD    G+ +    + L L   + LF  S  ++L  +A+G ++F  
Sbjct: 133 AVFLGLTAYTLQSKRDFSKFGAGLFAFLWILLLSGFLRLFFYSETVELIFAALGALLFCG 192

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
              YDT  +            +  + ++ ++ LY+D I +F+HLLR L
Sbjct: 193 FIIYDTHSLMHK--------LSPEEYILASINLYLDIINLFLHLLRVL 232


>gi|322411171|gb|EFY02079.1| hypothetical protein SDD27957_01975 [Streptococcus dysgalactiae
           subsp. dysgalactiae ATCC 27957]
          Length = 229

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 66/239 (27%), Positives = 114/239 (47%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D GL  +  ++Y+L+ +G+G++  +S+L+                          ++
Sbjct: 8   TQSDTGLNQFFAKIYSLVGMGIGLSAFVSYLMLY-----------------PFRDNLVSI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P+ +        + +F+       +  AA  +FL+YSAL G +LS    +YT  ++
Sbjct: 51  IANQPMVYYGAVIIELILVFVASGAARKNTPAALPLFLIYSALNGFTLSFIIAIYTQTTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            Q F  +A  F ++S+ G  TKRD+  +   M     G+ + SL+NLF+ S  +   +S 
Sbjct: 111 FQAFVSSAVVFFAMSVLGVKTKRDMTGLRKAMFAALIGIIVASLINLFIGSGMMSYVISI 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L A D Q IK  Y         +  +V  AL LY+DFI +F+ LLR  G  
Sbjct: 171 ISVLIFSGLIASDNQMIKRVYQATNGQ-VGDGWAVAMALSLYLDFINLFISLLRLFGRN 228


>gi|240277780|gb|EER41288.1| bax Inhibitor family protein [Ajellomyces capsulatus H143]
 gi|325093861|gb|EGC47171.1| bax inhibitor family protein [Ajellomyces capsulatus H88]
          Length = 276

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 46/231 (19%), Positives = 93/231 (40%), Gaps = 29/231 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY +++L +  T ++S +  +  +      +   +                    
Sbjct: 70  QFIRKVYFILSLQILFTTVVSCVSFVSDSYRSWIQSHSWL-------------------- 109

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
           + + A   +           S  A  +   +++AL   ++S     Y ++ ++    +T 
Sbjct: 110 VLVSAVSALVFMGLTYWKRKSYPANLIFLSIFTALEAYAISVVTSFYDARVVLLALILTQ 169

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM-RSSAIDLTMSAMGLVIFS 205
             F +L+L+   TK D      ++  G + L L   V  FM  SS ++L   A+  ++FS
Sbjct: 170 GIFVALTLFACQTKYDFTSWVPYLFGGLWFLILFGFVAAFMGPSSKVELVYGAVTALLFS 229

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           A    DTQ I   Y    +        +  A+ LY+D + +F+ +LR L S
Sbjct: 230 AYVLVDTQLIMRHYHVEEE--------IAAAISLYLDIVNLFLAILRILNS 272


>gi|195154104|ref|XP_002017962.1| GL17451 [Drosophila persimilis]
 gi|194113758|gb|EDW35801.1| GL17451 [Drosophila persimilis]
          Length = 245

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 91/238 (38%), Gaps = 21/238 (8%)

Query: 22  DQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           DQ +R  ++ +VY ++ + L +T     +      T +    +  +    ++     ++ 
Sbjct: 27  DQSIRKGFIRKVYLILMVQLLITFGFVSVFTFSKGTQEWVQKNPYLVWIALVVLIVTMIS 86

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            +    +    PL                       L++      L      Y +  ++ 
Sbjct: 87  MACCESVRRKTPLNFIFLF-----------------LFTIAESFLLGMVAGQYEANEVLM 129

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              ITAA    L+++   TK D    G  ++       +  ++ +F+    I L  +++G
Sbjct: 130 AVGITAAVSLGLTIFALQTKWDFTMCGGVLVACLVVFIIFGIIAIFIPGQVIGLVYASLG 189

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            ++FS    YDTQ         +  + +  + +  AL LY+D + IF+++L  +G  R
Sbjct: 190 ALLFSVYLVYDTQL---MLGGNHKYSISPEEYIFAALNLYLDIVNIFMYILTIIGLAR 244


>gi|125810813|ref|XP_001361640.1| GA17704 [Drosophila pseudoobscura pseudoobscura]
 gi|54636816|gb|EAL26219.1| GA17704 [Drosophila pseudoobscura pseudoobscura]
          Length = 245

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 91/238 (38%), Gaps = 21/238 (8%)

Query: 22  DQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           DQ +R  ++ +VY ++ + L +T     +      T +    +  +    ++     ++ 
Sbjct: 27  DQSIRKGFIRKVYLILMVQLLITFGFVSVFTFSKGTQEWVQKNPYLVWIALVVLIVTMIS 86

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            +    +    PL                       L++      L      Y +  ++ 
Sbjct: 87  MACCESVRRKTPLNFIFLF-----------------LFTIAESFLLGMVAGQYEANEVLM 129

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              ITAA    L+++   TK D    G  ++       +  ++ +F+    I L  +++G
Sbjct: 130 AVGITAAVSLGLTIFALQTKWDFTMCGGVLVACLVVFIIFGIIAIFIPGQVIGLVYASLG 189

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            ++FS    YDTQ         +  + +  + +  AL LY+D + IF+++L  +G  R
Sbjct: 190 ALLFSVYLVYDTQL---MLGGNHKYSISPEEYIFAALNLYLDIVNIFMYILTIIGLAR 244


>gi|167523950|ref|XP_001746311.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163775073|gb|EDQ88698.1| predicted protein [Monosiga brevicollis MX1]
          Length = 268

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 45/233 (19%), Positives = 90/233 (38%), Gaps = 18/233 (7%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY ++   L  T +M+       T      +S  I         G          
Sbjct: 53  AFLRKVYGIVCAQLLCTTLMAAFFVSSPTVKTFVQSSPTIYTLASWVMIG---------L 103

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                       LN +L +             + +    + +    Y    +++   +T+
Sbjct: 104 TVALMVFRKSSPLNYQLLTAFVRTTHASCASMTLVTSYVVGTTVTFYELPVVIEAALLTS 163

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR-SSAIDLTMSAMGLVIFS 205
                L+ + + TK D   + SF++ G + +  +SL+  F   SS ++L  S +G ++FS
Sbjct: 164 VITVGLTAFAFQTKHDFTFLNSFLVTGLWLMIGISLIMWFFPPSSTVELAYSVIGALLFS 223

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           A    DTQ +            +  + ++ A+ LY+D I +F+ +LR +  R 
Sbjct: 224 AFIVVDTQLMLNK--------LSPEEYILCAINLYLDIINLFLEILRIMSKRN 268


>gi|225557226|gb|EEH05513.1| bax inhibitor family protein [Ajellomyces capsulatus G186AR]
          Length = 276

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 45/231 (19%), Positives = 92/231 (39%), Gaps = 29/231 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY +++L +  T ++S +  +  +      +   +                    
Sbjct: 70  QFIRKVYFILSLQILFTTVVSCVSFVSDSYRSWIQSHSWL-------------------- 109

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
           + + A   +           S     +   +++AL   ++S     Y ++ ++    +T 
Sbjct: 110 VLVSAVSALVFMGLTYWKRKSYPTNLIFLSIFTALEAYAISVVTSFYDARVVLLALILTQ 169

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM-RSSAIDLTMSAMGLVIFS 205
             F +L+L+   TK D      ++  G + L L   V  FM  SS ++L   A+  ++FS
Sbjct: 170 GIFVALTLFACQTKYDFTSWVPYLFGGLWFLILFGFVAAFMGPSSKVELVYGAVTALLFS 229

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           A    DTQ I   Y    +        +  A+ LY+D + +F+ +LR L S
Sbjct: 230 AYVLVDTQLIMRHYHVEEE--------IAAAISLYLDIVNLFLAILRILNS 272


>gi|19745517|ref|NP_606653.1| hypothetical protein spyM18_0408 [Streptococcus pyogenes MGAS8232]
 gi|50913673|ref|YP_059645.1| integral membrane protein [Streptococcus pyogenes MGAS10394]
 gi|56808575|ref|ZP_00366306.1| COG0670: Integral membrane protein, interacts with FtsH
           [Streptococcus pyogenes M49 591]
 gi|71902956|ref|YP_279759.1| integral membrane protein [Streptococcus pyogenes MGAS6180]
 gi|94987930|ref|YP_596031.1| integral membrane protein [Streptococcus pyogenes MGAS9429]
 gi|94989804|ref|YP_597904.1| integral membrane protein [Streptococcus pyogenes MGAS10270]
 gi|94991814|ref|YP_599913.1| integral membrane protein [Streptococcus pyogenes MGAS2096]
 gi|139474364|ref|YP_001129080.1| hypothetical protein SpyM51557 [Streptococcus pyogenes str.
           Manfredo]
 gi|209558856|ref|YP_002285328.1| hypothetical protein Spy49_0295 [Streptococcus pyogenes NZ131]
 gi|306827959|ref|ZP_07461226.1| membrane protein [Streptococcus pyogenes ATCC 10782]
 gi|73921108|sp|Q5XDQ1|Y327_STRP6 RecName: Full=Uncharacterized membrane protein M6_Spy0327
 gi|73921125|sp|Q8P2D4|Y408_STRP8 RecName: Full=Uncharacterized membrane protein spyM18_0408
 gi|19747635|gb|AAL97152.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232]
 gi|50902747|gb|AAT86462.1| Integral membrane protein [Streptococcus pyogenes MGAS10394]
 gi|71802051|gb|AAX71404.1| integral membrane protein [Streptococcus pyogenes MGAS6180]
 gi|94541438|gb|ABF31487.1| integral membrane protein [Streptococcus pyogenes MGAS9429]
 gi|94543312|gb|ABF33360.1| Integral membrane protein [Streptococcus pyogenes MGAS10270]
 gi|94545322|gb|ABF35369.1| Integral membrane protein [Streptococcus pyogenes MGAS2096]
 gi|134272611|emb|CAM30878.1| putative membrane protein [Streptococcus pyogenes str. Manfredo]
 gi|209540057|gb|ACI60633.1| Membrane protein, putative [Streptococcus pyogenes NZ131]
 gi|304429878|gb|EFM32920.1| membrane protein [Streptococcus pyogenes ATCC 10782]
          Length = 229

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 66/239 (27%), Positives = 114/239 (47%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D GL  +  ++Y+L+ +G+G++  +S+L+                          ++
Sbjct: 8   TQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLY-----------------PFRENLISI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P+ +        + +F+       +  AA  +FL+YSAL G +LS   + Y   ++
Sbjct: 51  LVNQPMIYYGAAIIELILVFVASGAARKNTPAALPIFLIYSALNGFTLSFIIVAYAQTTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            Q F  +AA F ++S+ G  TKRD+  +   M     G+ + SL+NLF+ S  +   +S 
Sbjct: 111 FQAFLSSAAVFFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISV 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L A D Q IK  Y         +  +V  AL LY+DFI +F+ LLR  G  
Sbjct: 171 ISVLIFSGLIASDNQMIKRVYQATNGQ-VGDGWAVAMALSLYLDFINLFISLLRIFGRN 228


>gi|66472562|ref|NP_001018428.1| hypothetical protein LOC553618 [Danio rerio]
 gi|63102398|gb|AAH95247.1| Zgc:110410 [Danio rerio]
 gi|182888968|gb|AAI64457.1| Zgc:110410 protein [Danio rerio]
          Length = 256

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 46/230 (20%), Positives = 93/230 (40%), Gaps = 20/230 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY  + + L +T  +        T  D    +      +M   F  ++      
Sbjct: 44  RGFIRKVYLTLMIQLLITVGIICAFLYWETLSDWVKDTYWFTYTMMGVTFALVIVLVCCG 103

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            I    PL                       L++   G  L S  + Y++++++     T
Sbjct: 104 DIRRKVPLNFIFL-----------------GLFTIAEGCLLGSVVVYYSAEAVLWAVGAT 146

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A    ++SL+   +K D       +   ++ LF  +L+   +RS  + +  +++G +IFS
Sbjct: 147 ALVSLAMSLFSLQSKWDFTAASGCIWAMSWTLFSFALLCAILRSQYLYIFYASLGTLIFS 206

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
                DTQ I      ++  + +  + +  AL LY+D + IF+ LL+ +G
Sbjct: 207 VYLVIDTQLI---LGGKHKYSISPEEYIFAALNLYIDIVTIFLLLLQLIG 253


>gi|94993690|ref|YP_601788.1| membrane protein [Streptococcus pyogenes MGAS10750]
 gi|94547198|gb|ABF37244.1| Integral membrane protein [Streptococcus pyogenes MGAS10750]
          Length = 229

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 66/239 (27%), Positives = 114/239 (47%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D GL  +  ++Y+L+ +G+G++  +S+L+                          ++
Sbjct: 8   TQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLY-----------------PFRENLISI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P+ +        + +F+       +  AA  +FL+YSAL G +LS   + Y   ++
Sbjct: 51  LVNQPMIYYGAAIIELILVFIASGAARKNTPAALPIFLIYSALNGFTLSFIIVAYAQTTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            Q F  +AA F ++S+ G  TKRD+  +   M     G+ + SL+NLF+ S  +   +S 
Sbjct: 111 FQAFLSSAAVFFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISV 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L A D Q IK  Y         +  +V  AL LY+DFI +F+ LLR  G  
Sbjct: 171 ISVLIFSGLIASDNQMIKRVYQATNGQ-VGDGWAVAMALSLYLDFINLFISLLRIFGRN 228


>gi|306834155|ref|ZP_07467275.1| membrane protein [Streptococcus bovis ATCC 700338]
 gi|304423728|gb|EFM26874.1| membrane protein [Streptococcus bovis ATCC 700338]
          Length = 230

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 68/238 (28%), Positives = 114/238 (47%), Gaps = 18/238 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D  L  +  ++Y L+ +G+G++ ++SFL+                   V       +
Sbjct: 9   TQTDSALNRFFAKIYGLVGVGIGLSALVSFLMLY-----------------VFTDNMINI 51

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P  +          +FL       +  AA  +FL YSAL G +LS   + YT  ++
Sbjct: 52  IVYHPFVYYVAIFLELALVFLASNAARKNTPAALPLFLFYSALNGFTLSFVIVAYTQATV 111

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           VQ F  +A  FG +++ G   K+DL  +   ++ G  G+ + SLVN+F+ S  +   +S 
Sbjct: 112 VQAFVSSALVFGVMAVIGTFVKKDLSGMAKALMAGLIGIIIASLVNMFIGSGTMSYIISI 171

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           + ++IFS L AYD Q IK  Y         +  ++  AL LY+DFI +F+ LLR  G+
Sbjct: 172 ISVLIFSGLIAYDNQMIKRVYESTGGN-VGDGWAISMALSLYLDFINLFLSLLRIFGN 228


>gi|195426491|ref|XP_002061365.1| GK20879 [Drosophila willistoni]
 gi|194157450|gb|EDW72351.1| GK20879 [Drosophila willistoni]
          Length = 244

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 45/254 (17%), Positives = 93/254 (36%), Gaps = 21/254 (8%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASI 64
           N            +  DQ +R  ++ +VY ++ + L +T     +     +T +    + 
Sbjct: 10  NGTYPDAEADKAFAFDDQSIRKGFIRKVYMILMVQLSITFAFVSIFTFSTSTQEWCQKNP 69

Query: 65  IINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGL 124
            +    +      ++  +    +    PL                       L++     
Sbjct: 70  WLFWIALCVLIVTMICMACCESVRRKTPLNFIFLF-----------------LFTLAESF 112

Query: 125 SLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN 184
            L      Y +  ++    ITAA    L+L+   TK D    G  ++       +  +V 
Sbjct: 113 LLGIIAGQYKADEVLMAVGITAAVSLGLTLFALQTKFDFTMCGGVLVCCLVVFIIFGIVA 172

Query: 185 LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
           +F+      +  +++G ++FS    YDTQ        ++  + +  + +  AL LY+D I
Sbjct: 173 IFVSGKIFAMVYASLGALLFSVYLVYDTQL---MLGGKHKYSISPEEYIFAALNLYLDII 229

Query: 245 QIFVHLLRFLGSRR 258
            IF++LL  +G  R
Sbjct: 230 NIFMYLLAIIGLAR 243


>gi|114622150|ref|XP_001154224.1| PREDICTED: similar to Glutamate receptor, ionotropic, N-methyl
           D-asparate-associated protein 1 (glutamate binding)
           isoform 1 [Pan troglodytes]
          Length = 304

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 72/143 (50%), Gaps = 4/143 (2%)

Query: 117 LYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFG 176
           + +A +   +      Y +++++    IT A   ++ ++   T+ D       +++    
Sbjct: 166 VLTASLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVV 225

Query: 177 LFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGA 236
           LF+ +++ +F+R+  +++  +++G ++F+   A DTQ +         ++ +  + V  A
Sbjct: 226 LFIFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAA 281

Query: 237 LMLYMDFIQIFVHLLRFLGSRRD 259
           L LY D I IF+++L  +G  ++
Sbjct: 282 LNLYTDIINIFLYILTIIGRAKE 304


>gi|21909796|ref|NP_664064.1| hypothetical protein SpyM3_0260 [Streptococcus pyogenes MGAS315]
 gi|28896511|ref|NP_802861.1| hypothetical protein SPs1599 [Streptococcus pyogenes SSI-1]
 gi|73921091|sp|Q8K8I9|Y260_STRP3 RecName: Full=Uncharacterized membrane protein SpyM3_0260/SPs1599
 gi|21903981|gb|AAM78867.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315]
 gi|28811765|dbj|BAC64694.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1]
          Length = 229

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 65/239 (27%), Positives = 114/239 (47%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D GL  +  ++Y+L+ +G+G++  +S+L+                          ++
Sbjct: 8   TQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLY-----------------PFRENLISI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P+ +        + +F+       +  AA  +FL+Y+AL G +LS   + Y   ++
Sbjct: 51  LVNQPMIYYGAAIIELILVFVASGAARKNTPAALPIFLIYAALNGFTLSFIIVAYAQTTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            Q F  +AA F ++S+ G  TKRD+  +   M     G+ + SL+NLF+ S  +   +S 
Sbjct: 111 FQAFLSSAAVFFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISV 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L A D Q IK  Y         +  +V  AL LY+DFI +F+ LLR  G  
Sbjct: 171 ISVLIFSGLIASDNQMIKRVYQATNGQ-VGDGWAVAMALSLYLDFINLFISLLRIFGRN 228


>gi|323126638|gb|ADX23935.1| hypothetical protein SDE12394_01965 [Streptococcus dysgalactiae
           subsp. equisimilis ATCC 12394]
          Length = 229

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 66/239 (27%), Positives = 114/239 (47%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D GL  +  ++Y+L+ +G+G++  +S+L+                          ++
Sbjct: 8   TQSDAGLNQFFAKIYSLVGMGIGLSAFVSYLMLY-----------------PFRDNLVSI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P+ +        + +F+       +  AA  +FL+YSAL G +LS    +YT  ++
Sbjct: 51  IANQPMVYYGAVIIELILVFVASGAARKNTPAALPLFLIYSALNGFTLSFIIAIYTQTTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            Q F  +A  F ++S+ G  TKRD+  +   M     G+ + SL+NLF+ S  +   +S 
Sbjct: 111 FQAFVSSAVVFFAMSVLGVKTKRDMTGLRKAMFAALIGIIVASLINLFIGSGMMSYVISI 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L A D Q IK  Y         +  +V  AL LY+DFI +F+ LLR  G  
Sbjct: 171 ISVLIFSGLIASDNQMIKRVYQATNGQ-VGDGWAVAMALSLYLDFINLFISLLRLFGRN 228


>gi|327301155|ref|XP_003235270.1| hypothetical protein TERG_04326 [Trichophyton rubrum CBS 118892]
 gi|326462622|gb|EGD88075.1| hypothetical protein TERG_04326 [Trichophyton rubrum CBS 118892]
          Length = 275

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 89/234 (38%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY+++ + L +T  +S +            +   +  G ++     ++ T     
Sbjct: 69  QFIRKVYSILTVQLILTTALSSVSFFNTKYKSWVQSHSWLMIGSLIGAIVFMLLTYWK-- 126

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S     +    ++ L G ++S     Y SK ++Q   IT 
Sbjct: 127 ------------------RKSYPTNLLFLSGFTLLEGYAISVITSFYDSKIVMQALVITM 168

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFS 205
             F  L+L+   TK D      ++    + L +   V   F     +DL   A+G +IFS
Sbjct: 169 GLFIGLTLFACQTKYDFTGWMPYLFGAFWFLVIFGFVAAFFPVGKTMDLIYGAVGALIFS 228

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ +   Y    +        +  A+ LY+D I +F+ +LR L ++ +
Sbjct: 229 GYILVDTQLVMRHYHVEEE--------IAAAISLYLDIINLFLSILRILNNQSN 274


>gi|226287076|gb|EEH42589.1| transmembrane BAX inhibitor motif-containing protein
           [Paracoccidioides brasiliensis Pb18]
          Length = 275

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 86/234 (36%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY ++ + L +T ++S +                +                    
Sbjct: 69  QFVRKVYFILTIQLLLTTVLSSISFFSENYRTWIQTHPWL-------------------- 108

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
           + + A   +           S     M    ++ L   ++S     Y ++ ++Q   +T 
Sbjct: 109 MLVSAISALVFMGLTYWKRKSYPTNLMFLGGFTILEAYAISVTTSFYDARIVIQALVLTL 168

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL-SLVNLFMRSSAIDLTMSAMGLVIFS 205
             F +L+++   TK D      ++    + + +   +     +SS +DL    +  ++FS
Sbjct: 169 GIFVALTIFACQTKYDFTSWMPYLFSALWLVIIFGFMAAFLPKSSKMDLVYGVVIALLFS 228

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ +   Y    +        +  ++ LY+D I +F+ +LR L S+ D
Sbjct: 229 GYILVDTQLVMRHYHVEEE--------IAASISLYLDIINLFLAILRILNSQND 274


>gi|146414353|ref|XP_001483147.1| hypothetical protein PGUG_05102 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146392846|gb|EDK41004.1| hypothetical protein PGUG_05102 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 257

 Score =  103 bits (256), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 97/236 (41%), Gaps = 30/236 (12%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           + ++ +VY+L+ L +  T I+  ++           +++ +    M+   G L+ T    
Sbjct: 50  QMFIRKVYSLLTLQIIATVIVGLIIRSNEKITQWCLSNMWLFFISMVGSIGFLIAT---- 105

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                              + S     ++   ++ L   +L     +  +  ++Q  F+T
Sbjct: 106 ----------------HFKARSYPINLVLLSGFTLLEAYTLGVVCSLVETDVLIQALFLT 149

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM--RSSAIDLTMSAMGLVI 203
              F  L+L+ + TK D      F  MG + L     + +F   +S  +++     G+ +
Sbjct: 150 MIVFIGLTLFAFQTKYDFISWQGFASMGVWLLIGWGFMFMFFPSQSKGMEMIYGIFGVAV 209

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           FS     DTQ+I +      +        +I  + LY+D + +F+++LR L SRRD
Sbjct: 210 FSLYIVIDTQQIMKTAHLDDE--------IIATITLYLDIVNVFLYILRILESRRD 257


>gi|260891091|ref|ZP_05902354.1| putative membrane protein [Leptotrichia hofstadii F0254]
 gi|260859118|gb|EEX73618.1| putative membrane protein [Leptotrichia hofstadii F0254]
          Length = 256

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 74/260 (28%), Positives = 121/260 (46%), Gaps = 23/260 (8%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYN---LMALGLGVTGIMSFLVNILATTVDPDAA 62
           N             T D   R  + +V      M +GL +TG + F+V   A   +  A 
Sbjct: 14  NNDDYNEYNGQMSMTYDDLNRLVISKVRGSMIWMVIGLLITGGIGFMVYNGANNGNSVAV 73

Query: 63  SIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALI 122
            I+                    WIF+   +   +  +  +++ ++   K++FL+YSAL 
Sbjct: 74  MIV-----------------EKYWIFLILEVVAVLAFSALVYTANSSVLKLIFLIYSALS 116

Query: 123 GLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSL 182
           GL+ S   L Y    I   F  T + F  L++YGY TK +L      +  G   + L+S+
Sbjct: 117 GLTFSIIGLRYAPDVIGSAFLGTLSIFVVLAIYGYFTKENLTRFVPLLTAGIIAMILVSV 176

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSD---RYDVAYAERQSVIGALML 239
           VN+F+ +SAIDL +S +G++IF+   A D  +I+          D     +  ++GAL L
Sbjct: 177 VNMFLGNSAIDLFVSVLGVIIFTIYIAVDVNRIRNNIIACAVHEDSDILNKIEIVGALEL 236

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y+DF+ +F+ +LR LG  RD
Sbjct: 237 YLDFVNLFLSILRILGRGRD 256


>gi|313890902|ref|ZP_07824526.1| putative membrane protein [Streptococcus pseudoporcinus SPIN 20026]
 gi|313120800|gb|EFR43915.1| putative membrane protein [Streptococcus pseudoporcinus SPIN 20026]
          Length = 229

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 66/239 (27%), Positives = 112/239 (46%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           S  D GL  +  ++Y L+  G+G++  +S+L+                          A+
Sbjct: 8   SETDSGLSQFFAKIYGLVGAGVGLSAFVSYLMLY-----------------PFRDNLVAI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P  +        + +F+       +   A  +FL YSAL G +LS    VYT  ++
Sbjct: 51  IANHPFVYYGAIILELILVFVASGAAQRNTPMALPLFLFYSALNGFTLSFIIAVYTQTTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +Q F  +AA F ++S+ G  TK+DL      ++    G+ + S+VNLF+ S  ++  +S 
Sbjct: 111 LQAFISSAAVFFTMSMIGLFTKKDLSGFTKALMAALIGIIVASIVNLFIGSGDLNFIISI 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L A D  +IK  Y         +  ++  AL LY+DFI +F+ LLR  G  
Sbjct: 171 VSVLIFSGLIAVDNNRIKAVYQATNGQ-VGDGWAIAMALSLYLDFINLFISLLRIFGRN 228


>gi|227432301|ref|ZP_03914294.1| integral membrane protein, interacts with FtsH [Leuconostoc
           mesenteroides subsp. cremoris ATCC 19254]
 gi|227351907|gb|EEJ42140.1| integral membrane protein, interacts with FtsH [Leuconostoc
           mesenteroides subsp. cremoris ATCC 19254]
          Length = 239

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 66/249 (26%), Positives = 112/249 (44%), Gaps = 17/249 (6%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
                 +     + +D+G+RA+  + Y+ M + + +T +  F+V                
Sbjct: 1   MDNFNMNARRDVTGVDEGMRAFFKQTYSFMGIAVLLTAVTGFIVQN-------------- 46

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                L     L+  + +  + +     + + +  R    +   A  + + ++ + GL+L
Sbjct: 47  ---FFLEQVAKLLVGNVIGLLALLGIQMLIMTMIGRATFKNPARAFGLLMAFAVVEGLTL 103

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                VYT  S++  F   +A FG ++ YG  TKRDL  +GS +     GL + S+ N+F
Sbjct: 104 GVLLAVYTGASVMMAFVSASAVFGGMAAYGVFTKRDLTGLGSILFGLLIGLLIASIANMF 163

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
             S  + L +S   +V+FS  TAYD Q +K  YS           +V GAL LY+DF+ I
Sbjct: 164 FYSGIVSLLLSWASVVVFSLFTAYDNQNLKVMYSQFAGQVDTTGLAVNGALRLYLDFVNI 223

Query: 247 FVHLLRFLG 255
           F  LLR  G
Sbjct: 224 FFALLRIFG 232


>gi|156407212|ref|XP_001641438.1| predicted protein [Nematostella vectensis]
 gi|156228577|gb|EDO49375.1| predicted protein [Nematostella vectensis]
          Length = 319

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 46/247 (18%), Positives = 89/247 (36%), Gaps = 20/247 (8%)

Query: 15  SGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLT 73
            G  S  D+ +R  ++ RVY ++ + L VT     L        +           V+  
Sbjct: 89  GGAVSFSDKSIRMGFIRRVYFILMIQLSVTVATICLFLFYKPVRNFVHGKHGAGNTVVY- 147

Query: 74  GFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVY 133
                         F+   +  F+               +   +++  +   + +    +
Sbjct: 148 -----------VSAFVVFFVLYFVIACCESVRRKYPVNLICLAIFTLALSYLVGTISSYH 196

Query: 134 TSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM---RSS 190
            +  ++    +T     S+ ++   TK D    G  +   A  +F LS+         ++
Sbjct: 197 DTNIVLIMMGVTTLVCLSVMIFSCQTKYDFTTWGGVLFCAALAIFFLSIFTPVWLLLNTT 256

Query: 191 AIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHL 250
           A  + +  +  ++F A  AYDTQ I            +  + + GAL LYMD I+IF+ L
Sbjct: 257 AGKIVLGGVLALVFVAFLAYDTQLIM----GGKKYELSPEEYIFGALTLYMDIIRIFLLL 312

Query: 251 LRFLGSR 257
           L   G +
Sbjct: 313 LALFGKK 319


>gi|321260869|ref|XP_003195154.1| vacuole protein [Cryptococcus gattii WM276]
 gi|317461627|gb|ADV23367.1| Vacuole protein, putative [Cryptococcus gattii WM276]
          Length = 283

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 48/226 (21%), Positives = 99/226 (43%), Gaps = 30/226 (13%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++ +VY+++ + L  T  +S L+++ +                             + WI
Sbjct: 79  FVRKVYSILLVQLLATAGVSILLSLPSAKDFTHT-------------------NPWIMWI 119

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
            +        F+  + H     A  ++  L++      +      Y S+ ++Q  FIT  
Sbjct: 120 PMIGSFVSLFFVYWKRH--HHPANLILLGLFTLFEATMIGLAVSYYESRIVIQALFITLG 177

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF-MRSSAIDLTMSAMGLVIFSA 206
            F  L+L+ + TK D   +   + +G +GL    L+ +F   ++ +DL ++    ++FS 
Sbjct: 178 VFIGLTLFTFQTKYDFSSLAPILFIGIWGLITTYLIQIFLPFNATVDLVIAGFSTLLFSG 237

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
              YDTQ+I +          +  +++ GAL LY+DF+ +F+ +LR
Sbjct: 238 FVLYDTQQIMK--------RLSVDEAIAGALTLYLDFLNLFLSILR 275


>gi|15674509|ref|NP_268683.1| hypothetical protein SPy_0358 [Streptococcus pyogenes M1 GAS]
 gi|71910115|ref|YP_281665.1| integral membrane protein [Streptococcus pyogenes MGAS5005]
 gi|15214345|sp|Q9A1B9|Y358_STRP1 RecName: Full=Uncharacterized membrane protein
           SPy_0358/M5005_Spy0301
 gi|13621611|gb|AAK33404.1| conserved hypothetical protein (putative membrane spanning protein)
           [Streptococcus pyogenes M1 GAS]
 gi|71852897|gb|AAZ50920.1| integral membrane protein [Streptococcus pyogenes MGAS5005]
          Length = 229

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 66/239 (27%), Positives = 114/239 (47%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D GL  +  ++Y+L+ +G+G++  +S+L+                          ++
Sbjct: 8   TQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLY-----------------PFRENLISI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P+ +        + +F+       +  AA  +FL+YSAL G +LS   + Y   ++
Sbjct: 51  LVNQPMIYYGAAIIELILVFVASSAARKNTPAALPIFLIYSALNGFTLSFIIVAYAQTTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            Q F  +AA F ++S+ G  TKRD+  +   M     G+ + SL+NLF+ S  +   +S 
Sbjct: 111 FQAFLSSAAVFFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISV 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L A D Q IK  Y         +  +V  AL LY+DFI +F+ LLR  G  
Sbjct: 171 ISVLIFSGLIASDNQMIKRVYQATNGQ-VGDGWAVAMALSLYLDFINLFISLLRIFGRN 228


>gi|303241028|ref|ZP_07327538.1| protein of unknown function UPF0005 [Acetivibrio cellulolyticus
           CD2]
 gi|302591453|gb|EFL61191.1| protein of unknown function UPF0005 [Acetivibrio cellulolyticus
           CD2]
          Length = 234

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 82/255 (32%), Positives = 126/255 (49%), Gaps = 21/255 (8%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           ++NY       +    +    L + M RV+  M +GL VTG+ +                
Sbjct: 1   MQNYNDYNYDNAIDRKS---ALASQMARVFGWMFIGLMVTGLTALFTATSPA-------- 49

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                         +       +  +   L    F++ R   +    A   F+LYS L G
Sbjct: 50  ----------MLRIIYTGRFTIFGLMILELVFVWFISSRAMKMEYGVAAAAFILYSILNG 99

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           L+LSS F  YT KSI   FF++A  FG +S+YG  TK DL  +GS  IMG  GL ++S+V
Sbjct: 100 LTLSSIFFAYTFKSIALAFFMSAGFFGFMSVYGMITKTDLTSLGSLFIMGLVGLIIVSIV 159

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDF 243
           N+F+ +  +   +S +G+ IF  LTAYD+QKIK+              +++GAL+LY+DF
Sbjct: 160 NIFLHNPTLYWIISFVGVAIFLGLTAYDSQKIKDISIRFTGTEKERNVAIVGALILYLDF 219

Query: 244 IQIFVHLLRFLGSRR 258
           I +F+++LR LG R+
Sbjct: 220 INLFLYILRILGKRK 234


>gi|296212274|ref|XP_002752765.1| PREDICTED: transmembrane BAX inhibitor motif-containing protein
           4-like [Callithrix jacchus]
          Length = 394

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 47/228 (20%), Positives = 93/228 (40%), Gaps = 28/228 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY++++L + +T + S +     +       S  +     L   G +   +    
Sbjct: 95  AFLRKVYSILSLQVLLTTMASTVFLYFESIRTFVHDSPALILLFALGSLGLIFALN---- 150

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                           L+         +   ++ L  L+++     Y    I+Q + +T 
Sbjct: 151 ----------------LNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVHIILQAYILTT 194

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
             F  L++Y    KRD   +G+ +    + L L     LF  S  ++L ++A G ++F  
Sbjct: 195 GVFFGLTMYTLQAKRDFSKLGAGLFAFLWILCLSGFFKLFFYSETVELVLAAAGALLFCG 254

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
              YDT  +            +  + ++ A+ LY+D I +F+HLLRFL
Sbjct: 255 FIIYDTHSLMHK--------LSPEEYILAAISLYLDIINLFLHLLRFL 294


>gi|295666632|ref|XP_002793866.1| transmembrane BAX inhibitor motif-containing protein
           [Paracoccidioides brasiliensis Pb01]
 gi|226277519|gb|EEH33085.1| transmembrane BAX inhibitor motif-containing protein
           [Paracoccidioides brasiliensis Pb01]
          Length = 275

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 84/234 (35%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY ++ + L +T  +S +                +    +++    +  T     
Sbjct: 69  QFVRKVYFILTVQLLLTTALSSISFFSENYRTWIQTHPWLMLISVISSLVFMGLTYWK-- 126

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S     +    ++ L   ++S     Y +  ++Q   +T 
Sbjct: 127 ------------------RKSYPTNLIFLCGFTILEAYAISVTTSFYDAHIVIQALILTL 168

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL-SLVNLFMRSSAIDLTMSAMGLVIFS 205
             F +L+L+   TK D      ++    + + +   +      SS +DL    +  ++FS
Sbjct: 169 GIFVALTLFACQTKYDFTSWMPYLFGALWLVIIFGFMAAFLPMSSKMDLVYGVVIALLFS 228

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ +   Y    +        +  ++ LY+D I +F+ +LR L S+ D
Sbjct: 229 GYILVDTQLVMRHYHVEEE--------IAASISLYLDIINLFLAILRILNSQND 274


>gi|227903421|ref|ZP_04021226.1| integral membrane protein, interacts with FtsH [Lactobacillus
           acidophilus ATCC 4796]
 gi|227868897|gb|EEJ76318.1| integral membrane protein, interacts with FtsH [Lactobacillus
           acidophilus ATCC 4796]
          Length = 266

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 69/255 (27%), Positives = 124/255 (48%), Gaps = 21/255 (8%)

Query: 5   RNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASI 64
            N     +        + + +  ++ ++Y  M L + V+ I +FL   +           
Sbjct: 31  NNMDNFSSPERRQVHDVSE-VNGFLSKMYGYMGLAVLVSAIAAFLTMTVF---------- 79

Query: 65  IINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGL 124
                        +   + L W+ +F P+G+ + ++ +  + +  A  +M ++ + + G 
Sbjct: 80  ---------RSAVMQMPTALMWVILFVPIGLSLGISFKA-TRNPVAGFIMLMILAVIYGF 129

Query: 125 SLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN 184
             +     YT   I   F  +AA FGS++++G  TK++L  +GS+M     GLF+  +VN
Sbjct: 130 EFALLAGYYTQAQIGTAFLSSAAVFGSMAIFGTFTKKNLNNLGSYMRAALIGLFVAMIVN 189

Query: 185 LFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFI 244
           +F+R+S      S +G+VIF+ LTAYD QK++  Y+   D       +V+GAL LY+DFI
Sbjct: 190 MFLRNSVATFIFSIIGVVIFTGLTAYDAQKMRNIYNSYGDQVSTNGLAVLGALQLYLDFI 249

Query: 245 QIFVHLLRFLGSRRD 259
            IF+ LL+  G   D
Sbjct: 250 NIFLFLLQIFGMGND 264


>gi|45430023|ref|NP_991367.1| transmembrane BAX inhibitor motif-containing protein 1 [Bos taurus]
 gi|42564204|gb|AAS20596.1| responsive to centrifugal force and shear [Bos taurus]
 gi|94534883|gb|AAI16019.1| Transmembrane BAX inhibitor motif containing 1 [Bos taurus]
 gi|95767701|gb|ABF57325.1| PP1201 protein [Bos taurus]
 gi|148745508|gb|AAI42531.1| Transmembrane BAX inhibitor motif containing 1 [Bos taurus]
 gi|296490283|gb|DAA32396.1| transmembrane BAX inhibitor motif containing 1 [Bos taurus]
          Length = 308

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 45/255 (17%), Positives = 100/255 (39%), Gaps = 26/255 (10%)

Query: 8   QRVVNSGSGFGSTIDQGLR-AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           +R V+   G G   D+ +R A++ +VY ++++ L VT  +  +   +    D   A++ +
Sbjct: 74  ERAVSDTFGSGDWDDRKVRHAFIRKVYTIISIQLLVTVGIIAVFTFVKPVGDFVRANMAV 133

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                                     +        +          ++ ++++  +    
Sbjct: 134 YYASYAVFL-----------------VTYLTLACCQGPRRRFPWNIILLIIFTLAMAYMT 176

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGL----FLLSL 182
            +   VY +K+++    ITA    S++++ + TK D         +    +     +  +
Sbjct: 177 GTISSVYKTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFCVLGIVMTVTGIITVI 236

Query: 183 VNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMD 242
           V +F     + +  +A+G + F+   AYDTQ +            +    + GAL +Y D
Sbjct: 237 VLVFKYVYWLHMVYAALGAICFTLFLAYDTQMV----LGNRKHTISPEDYITGALQIYTD 292

Query: 243 FIQIFVHLLRFLGSR 257
            + IF  +L+ +GSR
Sbjct: 293 IVYIFTFVLQLVGSR 307


>gi|259502646|ref|ZP_05745548.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
 gi|259169291|gb|EEW53786.1| conserved hypothetical protein [Lactobacillus antri DSM 16041]
          Length = 235

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 62/236 (26%), Positives = 107/236 (45%), Gaps = 17/236 (7%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           GL  ++ ++Y LM   + ++ + ++LV                   V    F A +  + 
Sbjct: 16  GLNRFLTKMYGLMTFAVLISALTAWLVAN-----------------VFANQFAAFLANNR 58

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                I        F      + S   +  + +L + + G++ +     YT   I   F 
Sbjct: 59  WGIWLIILLPIFLTFGISFNATRSPGMSLFLLILTAIIYGITFAFIAGAYTGADISTAFL 118

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
            +A  F +++L G  + RD   IGS+      GL +  LVNLF+ S A+D  +S + ++I
Sbjct: 119 SSAGIFLTMALIGTFSHRDFSRIGSYASAALIGLIIAMLVNLFLHSPAVDYVLSVIAVII 178

Query: 204 FSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           F+ LTA+D Q++K  Y+   D       +V+GAL LY+DFI +F+ LL    S  +
Sbjct: 179 FTILTAWDAQRMKSIYTGYGDQLSVNGLAVLGALQLYLDFINLFISLLDIFSSSDE 234


>gi|62460524|ref|NP_001014914.1| transmembrane BAX inhibitor motif-containing protein 4 [Bos taurus]
 gi|61553119|gb|AAX46353.1| CGI-119 protein [Bos taurus]
 gi|75775541|gb|AAI05248.1| Transmembrane BAX inhibitor motif containing 4 [Bos taurus]
 gi|154425716|gb|AAI51433.1| TMBIM4 protein [Bos taurus]
 gi|296487657|gb|DAA29770.1| transmembrane BAX inhibitor motif containing 4 [Bos taurus]
          Length = 238

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 47/228 (20%), Positives = 96/228 (42%), Gaps = 28/228 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY++++L + +T +         +       S  +   + L   G ++  +    
Sbjct: 33  AFLRKVYSILSLQVLLTTVTLAFFLYFDSIRTFVHESPALILVLALGSLGLILALT---- 88

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                           ++         +   ++ L  L+++     Y    ++Q F +T 
Sbjct: 89  ----------------VNRHKHPLNLYLLFGFTLLESLTVAFVVTFYDVYVVLQAFILTC 132

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
           A F  L++Y   +KRD    G+ +  G + L L  ++ LF  S  ++L ++A G ++F  
Sbjct: 133 AVFLGLTVYTLQSKRDFSKFGAGLFAGLWILCLSGILRLFFYSETVELVLAAGGALLFCG 192

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
              YDT  +            +  + V+ A+ LY+D I +F+HLLR L
Sbjct: 193 FIIYDTHSLMH--------RLSPEEYVLAAINLYLDIINLFLHLLRVL 232


>gi|195026788|ref|XP_001986335.1| GH21302 [Drosophila grimshawi]
 gi|193902335|gb|EDW01202.1| GH21302 [Drosophila grimshawi]
          Length = 289

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 52/237 (21%), Positives = 94/237 (39%), Gaps = 21/237 (8%)

Query: 22  DQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           DQ +R  ++ +VY ++   L VT  +  +      T +    +  +    M+     L  
Sbjct: 73  DQSIRKGFIRKVYLILLAQLVVTFGVICIFMYHEPTNNFVQENPEVMSVAMVINIVVLFS 132

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
            +                        +     +    ++  + L L +      S  +++
Sbjct: 133 MAC-----------------CETARRTFPINFVCLGFFTVTMSLLLGAAAGTLDSVVVLE 175

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              ITAA    LS++   TK D     + ++     L +LS+   F+R S  D+ +S +G
Sbjct: 176 AVAITAALVVGLSIFAIQTKYDFTSCRAVLVSVVICLLVLSISASFVRESFADIALSCLG 235

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
            ++ S L  YDTQ I       +   +     +  AL LYMD ++IFV++LR L  R
Sbjct: 236 ALLASFLLIYDTQLII---GGNHKYQFNPEDYIFAALTLYMDIVRIFVYVLRLLARR 289


>gi|301778675|ref|XP_002924755.1| PREDICTED: transmembrane BAX inhibitor motif-containing protein
           4-like [Ailuropoda melanoleuca]
          Length = 238

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 47/228 (20%), Positives = 95/228 (41%), Gaps = 28/228 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY++++L + +T + +       +       S  +     L   G ++  +    
Sbjct: 33  AFLRKVYSILSLQVLLTTVTASFFLYFESIRTFVHESPALILVFALGSLGLILALT---- 88

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                           ++         +   ++    L+++     Y    I+Q F +T 
Sbjct: 89  ----------------VNRHKHPLNLYLLFGFTLFEALTVAFVVTFYDVYIILQAFILTT 132

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
           A F  L+ Y   +KRD    G+ +    + L L  ++ LF  S  ++L ++A+G ++F  
Sbjct: 133 AVFLGLTGYTLQSKRDFTKFGAGLFAVLWILCLSGILKLFFYSQTVELVLAAVGALLFCG 192

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
              YDT  +            +  + V+ A+ LY+D I +F+HLLRFL
Sbjct: 193 FIIYDTHSLMH--------RLSPEEYVLAAISLYLDVINLFLHLLRFL 232


>gi|302668368|ref|XP_003025756.1| hypothetical protein TRV_00083 [Trichophyton verrucosum HKI 0517]
 gi|291189883|gb|EFE45145.1| hypothetical protein TRV_00083 [Trichophyton verrucosum HKI 0517]
          Length = 260

 Score =  103 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 47/234 (20%), Positives = 91/234 (38%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY+++ + L +T  +S +    A       +   +  G ++     ++ T     
Sbjct: 54  QFIRKVYSILTVQLILTTALSSVSFFNAKYKSWVQSHSWLMIGSLIGAIVFMLLTYW--- 110

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S     +    ++ L G ++S     Y S+ ++Q   IT 
Sbjct: 111 -----------------KRKSYPTNLLFLSGFTLLEGYAISVITSFYDSRIVMQALVITM 153

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFS 205
             F  L+L+   TK D      ++  G + L +   V   F     +DL   A+G +IFS
Sbjct: 154 GLFIGLTLFACQTKYDFTGWMPYLFGGLWFLVIFGFVAAFFPVGKTMDLIYGAVGALIFS 213

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ +   Y    +        +  A+ LY+D I +F+ +LR L ++ +
Sbjct: 214 GYILVDTQLVMRHYHVEEE--------IAAAISLYLDIINLFLSILRILNNQSN 259


>gi|195446252|ref|XP_002070697.1| GK19213 [Drosophila willistoni]
 gi|194166782|gb|EDW81683.1| GK19213 [Drosophila willistoni]
          Length = 271

 Score =  103 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/250 (16%), Positives = 84/250 (33%), Gaps = 20/250 (8%)

Query: 8   QRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIIN 67
               N         +   R ++ +VY ++   L  T  +  L             +  I 
Sbjct: 41  NNSSNQPKNLSFDDESIRRGFIRKVYLILLGQLVATFGVVSLFVFNDDVKLYVQQNFWIF 100

Query: 68  RGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLS 127
              ++                    + +   +             +   +Y+      + 
Sbjct: 101 WFALIIML-----------------ITMLALICCENLRRETPTNFIFLSVYTMAQSFIMG 143

Query: 128 SFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM 187
                Y    I+    ITA    +L+L+   TK D    G  ++     L +  +V +F 
Sbjct: 144 VSACRYGPNEILLAVGITAILCLALTLFALQTKYDFTASGGILLCCLVILTIFGIVAIFA 203

Query: 188 RSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIF 247
            +    L  ++   ++FSA   YDTQ +      ++  + +  + +  AL LY+D + IF
Sbjct: 204 NTKLSTLIYASFSALLFSAYLIYDTQLMM---GGKHKYSISPEEYIFAALNLYLDVVNIF 260

Query: 248 VHLLRFLGSR 257
           + +L  LGS 
Sbjct: 261 MDILTILGSS 270


>gi|266619242|ref|ZP_06112177.1| putative membrane protein [Clostridium hathewayi DSM 13479]
 gi|288869237|gb|EFD01536.1| putative membrane protein [Clostridium hathewayi DSM 13479]
          Length = 236

 Score =  103 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 119/254 (46%), Gaps = 20/254 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +Y           ST  + L  Y  + +  M  GL +T +++       T +        
Sbjct: 2   DYNSTDQPYVYSDSTSAEPLGKYTAKTFGWMFAGLLITFLVAAFGYTTGTII-------- 53

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                       +        +   A + V +FL+ R+H +S   A+ +F  Y+ L G+ 
Sbjct: 54  -----------YVFAVPYAYLLLGVAEIAVVLFLSARIHKMSVGTARALFFTYAVLNGVV 102

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
            S++FL+Y    ++  F  T+  FG +++ GY T  D   I +F++ G   L +  L+++
Sbjct: 103 FSAYFLMYDMVDLILVFGATSIFFGVMAVIGYVTNADFSRIRNFLMGGLIFLVVFWLLSM 162

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDR-YDVAYAERQSVIGALMLYMDFI 244
           F+     ++ +  +G+ IF   TAYDTQKI+  +     D   A + S+  AL LY+DF+
Sbjct: 163 FINLGQFEMIVCYIGIFIFLGFTAYDTQKIRAYHQYYAQDPEMAAKASIFSALQLYLDFV 222

Query: 245 QIFVHLLRFLGSRR 258
            +F++++R +G R+
Sbjct: 223 NLFLYIIRIVGRRK 236


>gi|330836755|ref|YP_004411396.1| hypothetical protein Spico_0789 [Spirochaeta coccoides DSM 17374]
 gi|329748658|gb|AEC02014.1| protein of unknown function UPF0005 [Spirochaeta coccoides DSM
           17374]
          Length = 236

 Score =  103 bits (255), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 74/236 (31%), Positives = 126/236 (53%), Gaps = 21/236 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R+ +  VY  M  GLGVT ++++LV      +    ++  +  G+++             
Sbjct: 17  RSLIRNVYVWMTAGLGVTAVVAYLVAATPAIMSIILSNQFLFFGIVI------------- 63

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                A L +  +L+ RL ++    A   F+ Y+ L G+ +S+ F V+T  SI   FF T
Sbjct: 64  -----AELALVFYLSSRLKTMDVGKAVASFIGYAILNGVLMSTLFYVFTGGSIAIAFFTT 118

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
             +FG +S++   TKRDL   G +  M  +GL + SL+N+F+ S  +   +S +G+++F 
Sbjct: 119 TVAFGGMSVFAMLTKRDLRGFGYYFSMALWGLIIASLINMFLGSQTMYYIISFVGIIVFL 178

Query: 206 ALTAYDTQKIK---EAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            LTA+DTQ+++   E Y          + S+I AL LY++FI IF+++LRF+G  R
Sbjct: 179 GLTAWDTQRLRDVNEQYGTTMTEEEYTKISIISALSLYLNFINIFLYILRFMGVMR 234


>gi|282851162|ref|ZP_06260529.1| putative membrane protein [Lactobacillus gasseri 224-1]
 gi|282557694|gb|EFB63289.1| putative membrane protein [Lactobacillus gasseri 224-1]
          Length = 237

 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 63/251 (25%), Positives = 112/251 (44%), Gaps = 17/251 (6%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
               +        + G+  ++ R+Y LMAL + V+ + S+L   +      +        
Sbjct: 3   NFDQNPERRHLVDESGVNIFLSRLYGLMALAVLVSALSSYLTMTVFARQMVN-------- 54

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
                    LM   P    F+         +     + S   + ++ +L + + G++ + 
Sbjct: 55  ---------LMNYHPWAMWFLLLLPIALTLIINFNATRSPGMSFVLLMLTAIVYGVTFAF 105

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
               YT + I   F  +A+ F  +++ G  TKRDL  IGS+      GL +  L+NLF++
Sbjct: 106 IAGAYTGEDIASAFIASASVFIVMAILGTVTKRDLSRIGSYASAALIGLIVAMLINLFLK 165

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFV 248
           +  ID   S + ++IF+ LTA+D Q+IK  Y            +V+GAL LY+DF+ +F+
Sbjct: 166 NPTIDYIFSFIAVIIFTILTAWDAQRIKNIYLQFGGELSTNGLAVLGALQLYLDFVNLFL 225

Query: 249 HLLRFLGSRRD 259
             L   GS  +
Sbjct: 226 QFLDIFGSNDN 236


>gi|222056382|ref|YP_002538744.1| protein of unknown function UPF0005 [Geobacter sp. FRC-32]
 gi|221565671|gb|ACM21643.1| protein of unknown function UPF0005 [Geobacter sp. FRC-32]
          Length = 231

 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 89/243 (36%), Positives = 139/243 (57%), Gaps = 21/243 (8%)

Query: 16  GFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGF 75
                +       + +VY  M  GL VT I++ +                          
Sbjct: 10  RTADQVAIAQNTLIRQVYAWMGGGLLVTAILAMVTISSPV------------------ML 51

Query: 76  GALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTS 135
            A+     + +  I   LG+   ++  ++ LSA AA  +F+LY+AL G+++S+ F VYT+
Sbjct: 52  NAIFGNRLVFYALILGELGLVFAISGAINRLSATAASSLFILYAALNGVTMSAIFAVYTA 111

Query: 136 KSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLT 195
           +SI  TF ITAA+FG++S+YGY TKRDL  +GSF+ MG  G+ + S+VN+F +SSA    
Sbjct: 112 ESIGSTFVITAATFGAMSIYGYVTKRDLTGMGSFLFMGLIGIVIASIVNIFTKSSAASWI 171

Query: 196 MSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           +SA+G+++F+ LTAYDT KIK   +   +     + +++GAL LY+DFI +F+ LLR LG
Sbjct: 172 ISALGVIVFTGLTAYDTWKIKAMAASGAE---GRKPAILGALTLYLDFINLFLMLLRLLG 228

Query: 256 SRR 258
           +RR
Sbjct: 229 NRR 231


>gi|319946454|ref|ZP_08020691.1| membrane protein [Streptococcus australis ATCC 700641]
 gi|319747422|gb|EFV99678.1| membrane protein [Streptococcus australis ATCC 700641]
          Length = 228

 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 64/235 (27%), Positives = 115/235 (48%), Gaps = 18/235 (7%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GL ++  ++Y+L+ +G+G++ ++S L+  L                     F  ++  +
Sbjct: 11  SGLNSFYSKIYSLVGVGVGISAVVSALMMTL-----------------FQETFIYILTQA 53

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
           P  +    A   + + +  R    +   A  +FL YSAL G +LS     Y   ++ + F
Sbjct: 54  PWVYYIAIAVELILVLVASRQSVKNNPMALPLFLTYSALNGFTLSFIIARYAQATVYKAF 113

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            ++A  F  +S  G  TK+DL  +G   +    G+ + S+ N+F++SS +D  +S + ++
Sbjct: 114 VVSALMFFIMSAIGRVTKKDLSGMGRAFMGALIGIIIASIANIFLQSSGMDYVLSILCVI 173

Query: 203 IFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           IF+ LTA+D QKI+  Y             V  AL LY+DFI +F+++LR  G  
Sbjct: 174 IFAGLTAWDNQKIRYVYEQSNGQP-TNGWVVALALELYLDFINLFINILRIFGRN 227


>gi|300811374|ref|ZP_07091870.1| putative membrane protein [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
 gi|300497609|gb|EFK32635.1| putative membrane protein [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
          Length = 237

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 65/234 (27%), Positives = 112/234 (47%), Gaps = 18/234 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D  L  ++ ++Y++M L + V+ + ++L                    V       L+  
Sbjct: 16  DSALNGFLTKMYSIMGLAVLVSALTAYLTLT-----------------VFSGSLLPLLTN 58

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
               W+ +  PL + + ++ +  +     A  M +  + + GL  S     YT   I   
Sbjct: 59  RVFIWVLLLLPLILSVGISFKA-TRKPTTAFFMLMAIAVVYGLEFSLLAFAYTGAQIGGA 117

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F   +A F  ++ YG  TK++L  IG++     +GL + SLVN+F++S+      S +G+
Sbjct: 118 FISASAVFIGMAAYGSVTKKNLDTIGAYASAAIWGLIVASLVNMFLKSTPASFIFSIIGV 177

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           +IF+ LTA+D QK+K  Y+   D       +V GALMLY+DFI +F+  LR  G
Sbjct: 178 IIFTILTAWDAQKMKSIYASYGDQLPELGLAVNGALMLYLDFINLFLQFLRIFG 231


>gi|296111924|ref|YP_003622306.1| integral membrane protein [Leuconostoc kimchii IMSNU 11154]
 gi|295833456|gb|ADG41337.1| integral membrane protein [Leuconostoc kimchii IMSNU 11154]
          Length = 239

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 66/249 (26%), Positives = 113/249 (45%), Gaps = 17/249 (6%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
                 +     + +D+G+RA+  + Y  M + + VT I  F+V                
Sbjct: 1   MDNFNINTRRDVTGVDEGMRAFFKQTYTFMGIAVLVTAITGFIVQK-------------- 46

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                L    AL+  + +  + +     + I +  R    +   A  + + ++ + GL+ 
Sbjct: 47  ---FFLEQAIALLAGNFIGALALIGIQMLIITMIGRSTFKNPARAFGLLMAFAVVEGLTF 103

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                +YT  S+V  F   +A FG ++LYG  TKRDL  + S +     G+ + S+VN+ 
Sbjct: 104 GLLLAIYTGASVVMAFVSASAVFGGMALYGVFTKRDLTGMRSILFGALIGIIVASVVNMI 163

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
             S  + L +S + +V+F+  TAYD Q +K  YS     A     +V GAL LY+DF+ +
Sbjct: 164 FYSGIVSLLLSIVSVVVFALYTAYDNQNLKIMYSQFAGQADTTGLAVNGALRLYLDFVNL 223

Query: 247 FVHLLRFLG 255
           F  L+R  G
Sbjct: 224 FFALIRIFG 232


>gi|159126558|gb|EDP51674.1| Bax Inhibitor family protein [Aspergillus fumigatus A1163]
          Length = 281

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/234 (18%), Positives = 91/234 (38%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY ++ + L +T IMS +     +      ++  +    +    G ++ T     
Sbjct: 64  QFIRKVYAILTIQLLLTTIMSSISFFSESYRLWIQSNFWLMMVSVFGALGFMLVTYWK-- 121

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S  A  +    ++ L   S+S     Y ++ ++Q   +  
Sbjct: 122 ------------------RKSYPANLLFLSAFTLLEAYSISVVTSFYDARIVIQALILAL 163

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFS 205
             F +L+L+   TK D      ++    + L L   ++  F  +S  +L    +  +IFS
Sbjct: 164 GIFVALTLFACQTKYDFTNWMPYLFGALWFLILFGFMSAFFPYNSTAELIYGGLAALIFS 223

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           A    DTQ +   Y    +        +  A+ LY+D + +F+ +LR L ++ +
Sbjct: 224 AYILVDTQLVMRHYHVEEE--------IAAAISLYLDILNLFLAILRILNNQNN 269


>gi|261202212|ref|XP_002628320.1| bax Inhibitor family protein [Ajellomyces dermatitidis SLH14081]
 gi|239590417|gb|EEQ72998.1| bax Inhibitor family protein [Ajellomyces dermatitidis SLH14081]
          Length = 275

 Score =  102 bits (254), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 44/234 (18%), Positives = 88/234 (37%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY ++ + L  T I+S +     +      +   +                    
Sbjct: 69  QFIRKVYFILTVQLLCTTILSSVSFFSDSYRTWIQSHSWL-------------------- 108

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
           + +     +           S     +    ++ L   ++S     Y ++ ++Q   +T 
Sbjct: 109 MLVSVVSALVFMGLTYWKRKSYPTNLIFLSGFTLLEAYAISVVTSFYDARIVIQALILTL 168

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM-RSSAIDLTMSAMGLVIFS 205
             F +L+L+   TK D      ++  G + L L   +  FM  S  ++L    +  +IFS
Sbjct: 169 GIFVALTLFACQTKYDFTSWIPYLFGGLWFLILFGFMAAFMGPSKKVELVYGGLAALIFS 228

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           A    DTQ I   Y    +        +  A+ LY+D I +F+ +LR L S+ +
Sbjct: 229 AYILVDTQLIMRHYHVEEE--------IAAAISLYLDIINLFLAILRILNSQSN 274


>gi|295698756|ref|YP_003603411.1| stationary phase anti-death Family [Candidatus Riesia pediculicola
           USDA]
 gi|291156995|gb|ADD79440.1| stationary phase anti-death Family [Candidatus Riesia pediculicola
           USDA]
          Length = 241

 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 69/241 (28%), Positives = 123/241 (51%), Gaps = 23/241 (9%)

Query: 24  GLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSP 83
           G++ Y+  VY  M++ L +T  +SF        +     +  I   +       +   + 
Sbjct: 18  GVQFYIANVYGWMSVSLLLTAFVSFYTIRNDNIIFFILNNKWIFFLIFFAEIILVNILTS 77

Query: 84  LRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFF 143
                               H + + +A  + +LYS + G+++S    VYT  SIV+TFF
Sbjct: 78  SAL-----------------HKIDSNSATTLLMLYSLMTGITISLPLFVYTGISIVRTFF 120

Query: 144 ITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVI 203
           IT+  FG+L++YGY TK+ L  + SF+     G+ L+S +N++++++ +   ++  G++ 
Sbjct: 121 ITSIMFGALAIYGYKTKKSLNFLSSFLFTSIIGIVLISFLNIWLKNTGLSFFINFAGVLT 180

Query: 204 FSALTAYDTQKIKEAYSD------RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           FS L AYD QK+KE  S+        D    ++ SV+GAL LY+DF+ +F+  L+  G R
Sbjct: 181 FSGLVAYDNQKLKEMGSNLIFQNLLDDKDNMKKHSVVGALTLYLDFVNLFLFFLQINGER 240

Query: 258 R 258
           +
Sbjct: 241 K 241


>gi|328948178|ref|YP_004365515.1| hypothetical protein Tresu_1310 [Treponema succinifaciens DSM 2489]
 gi|328448502|gb|AEB14218.1| protein of unknown function UPF0005 [Treponema succinifaciens DSM
           2489]
          Length = 236

 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 76/236 (32%), Positives = 120/236 (50%), Gaps = 22/236 (9%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++ R Y  M + L V+ ++SF        +    A+  +                    I
Sbjct: 18  FLTRTYLWMGIALLVSAVVSFFAAESGLIISILKATGGMGLI-----------------I 60

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
              A +G+ + L   +  +S   AK++F+LYSAL GL++S+ F  YT+ SI   F   AA
Sbjct: 61  LCIAEIGLVVGLTSSIRKISVANAKLLFILYSALNGLTISTIFFTYTASSIAICFVSAAA 120

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR-----SSAIDLTMSAMGLV 202
            F  +SLYG  TK DL   G +++M   G+ + SL+N  +      S+  D  +S   +V
Sbjct: 121 MFFGMSLYGLKTKSDLTTAGRYLMMALLGIIIASLLNGILFLFGAGSTMFDWLISVASVV 180

Query: 203 IFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F+ LTAYD+QKI    S   +    ++ ++ GAL LY+DFI IF+ LLR  G+R+
Sbjct: 181 VFTGLTAYDSQKIMRISSSADNSDSFKKIAIYGALELYLDFINIFLSLLRLFGNRK 236


>gi|213618997|ref|ZP_03372823.1| hypothetical protein SentesTyp_22030 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
          Length = 173

 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 71/173 (41%), Positives = 100/173 (57%), Gaps = 2/173 (1%)

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
            I A L +   L+  +H LSA  A  +F+LYSAL G  +  +F         Q       
Sbjct: 1   LIIAQLALVFVLSGLVHKLSAGMATTLFMLYSALTGFDVIQYFYRLHLFLHRQHVCGDGG 60

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
            FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++ +G+V+F  L
Sbjct: 61  MFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVTYIGVVVFVGL 120

Query: 208 TAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           TAYDTQK+K         D A   + S++GAL LY+DFI +F+ LLR  G+RR
Sbjct: 121 TAYDTQKLKNIGEQIDTRDSANLRKYSILGALTLYLDFINLFLMLLRIFGNRR 173


>gi|304382498|ref|ZP_07364993.1| protein of hypothetical function UPF0005 [Prevotella marshii DSM
           16973]
 gi|304336329|gb|EFM02570.1| protein of hypothetical function UPF0005 [Prevotella marshii DSM
           16973]
          Length = 237

 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 89/254 (35%), Positives = 136/254 (53%), Gaps = 19/254 (7%)

Query: 6   NYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           N Q +          +     A M +VY  M+L L +TGI ++ V      +        
Sbjct: 2   NEQELTRFMREKDGALSLAFPALMRKVYVWMSLALIITGITAYGVASSPGLIT------- 54

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
                      A      L W  + A   +   L+  L+ LS   A ++F++YS L G+ 
Sbjct: 55  -----------AFYTNQMLMWGVVIAEFALVFALSAALNRLSLSVATLLFVVYSVLNGVM 103

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
            SS FLVYT  S+   FFITA +F +++ YGY TK DL  +G ++ M   GL + ++VN+
Sbjct: 104 FSSIFLVYTMSSVANVFFITAGTFAAMAAYGYFTKSDLTTLGKYLFMALIGLVIATVVNI 163

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDV-AYAERQSVIGALMLYMDFI 244
           F+ SS + L +S  G++IF  LTAYD+QKIK+  + + D    A++ ++ GAL LY+DFI
Sbjct: 164 FVGSSMLSLVISYAGVLIFVGLTAYDSQKIKQMLAQQVDADETAQKVALFGALTLYLDFI 223

Query: 245 QIFVHLLRFLGSRR 258
            +F++LLR LG+RR
Sbjct: 224 NLFLYLLRLLGNRR 237


>gi|57239618|ref|YP_180754.1| hypothetical protein Erum8920 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161697|emb|CAH58627.1| putative integral membrane protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 234

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 84/252 (33%), Positives = 147/252 (58%), Gaps = 21/252 (8%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
              +S          GLR Y+++VYN MA+ LG+TG+++F V+  +  V+          
Sbjct: 2   DNYSSVRFQSDYYSVGLRNYLMKVYNYMAMALGLTGLVAFFVSSSSYAVN---------- 51

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
                    ++Y +PL W+ +F+P+ +   ++ +L + S     ++F  ++AL+G S+SS
Sbjct: 52  ---------IIYNTPLHWVIMFSPIVLVFLMSYKLSTFSFQTVLVVFFSFAALMGASISS 102

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            FL+YT+ SI + FFI+++ FG+++ YG  TK+DL    SF+IMG  G+ + SLVNLF+ 
Sbjct: 103 IFLIYTAASITKVFFISSSMFGAMAWYGNVTKKDLSQFQSFLIMGIIGVIIASLVNLFLH 162

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQI 246
           +  +D  +S + +++F+ +TA D Q+IK+ Y   +  +     + +V+GA  LY ++I I
Sbjct: 163 NGPLDFAISFIAVILFTGMTACDAQRIKDMYYRFNDGNSVSLNKMAVLGATTLYFNYINI 222

Query: 247 FVHLLRFLGSRR 258
           F+ LL   G RR
Sbjct: 223 FLSLLNLQGERR 234


>gi|302501781|ref|XP_003012882.1| hypothetical protein ARB_00764 [Arthroderma benhamiae CBS 112371]
 gi|291176443|gb|EFE32242.1| hypothetical protein ARB_00764 [Arthroderma benhamiae CBS 112371]
          Length = 260

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 46/234 (19%), Positives = 90/234 (38%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY+++ + L +T  +S +    A       +   +  G ++     ++ T     
Sbjct: 54  QFIRKVYSILTVQLILTTALSSVSFFNAKYKSWVQSHSWLMIGSLIGAIVFMLLTYW--- 110

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S     +    ++ L G ++S     Y S+ ++Q   IT 
Sbjct: 111 -----------------KRKSYPTNLLFLSGFTLLEGYAISVITSFYDSRIVMQALVITM 153

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFS 205
             F  L+L+   TK D      ++    + L +   V   F     +DL   A+G +IFS
Sbjct: 154 GLFIGLTLFACQTKYDFTGWMPYLFGALWFLVIFGFVAAFFPVGKTMDLIYGAVGALIFS 213

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ +   Y    +        +  A+ LY+D I +F+ +LR L ++ +
Sbjct: 214 GYILVDTQLVMRHYHVEEE--------IAAAISLYLDIINLFLSILRILNNQSN 259


>gi|325978968|ref|YP_004288684.1| putative integral membrane protein [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|325178896|emb|CBZ48940.1| putative integral membrane protein [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
          Length = 230

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 70/238 (29%), Positives = 114/238 (47%), Gaps = 18/238 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D  L  +  ++Y L+ +G+G++ ++SFL+                   V       +
Sbjct: 9   TQTDSALNRFFAKIYGLVGVGIGLSALVSFLMLY-----------------VFTDNMVNI 51

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P  +        V +FL       +  AA  +FL YSAL G +LS   + YT  ++
Sbjct: 52  IVYHPFVYYGAIFLELVLVFLASNAARKNTPAALPLFLFYSALNGFTLSFVIVAYTQTTV 111

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           VQ F  +A  FG +++ G   KRDL  +   ++    G+ + SLVN+F+ S  +   +S 
Sbjct: 112 VQAFVSSALVFGVMAIIGTFVKRDLSGMAKALMAALIGIIIASLVNMFIGSGTMSYIISI 171

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           + ++IFS L AYD Q IK  Y         +  ++  AL LY+DFI +F+ LLR  GS
Sbjct: 172 ISVLIFSGLIAYDNQMIKRVYESTGGN-VGDGWAISMALSLYLDFINLFLSLLRIFGS 228


>gi|239612128|gb|EEQ89115.1| bax Inhibitor family protein [Ajellomyces dermatitidis ER-3]
 gi|327352706|gb|EGE81563.1| bax Inhibitor family protein [Ajellomyces dermatitidis ATCC 18188]
          Length = 275

 Score =  102 bits (253), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 44/234 (18%), Positives = 88/234 (37%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY ++ + L  T I+S +     +      +   +                    
Sbjct: 69  QFIRKVYFILTVQLLFTTILSSVSFFSDSYRTWIQSHSWL-------------------- 108

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
           + +     +           S     +    ++ L   ++S     Y ++ ++Q   +T 
Sbjct: 109 MLVSVVSALVFMGLTYWKRKSYPTNLIFLSGFTLLEAYAISVVTSFYDARIVIQALILTL 168

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM-RSSAIDLTMSAMGLVIFS 205
             F +L+L+   TK D      ++  G + L L   +  FM  S  ++L    +  +IFS
Sbjct: 169 GIFVALTLFACQTKYDFTSWIPYLFGGLWFLILFGFMAAFMGPSKKVELVYGGLAALIFS 228

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           A    DTQ I   Y    +        +  A+ LY+D I +F+ +LR L S+ +
Sbjct: 229 AYILVDTQLIMRHYHVEEE--------IAAAISLYLDIINLFLAILRILNSQSN 274


>gi|312868724|ref|ZP_07728916.1| putative membrane protein [Lactobacillus oris PB013-T2-3]
 gi|311095710|gb|EFQ53962.1| putative membrane protein [Lactobacillus oris PB013-T2-3]
          Length = 237

 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 58/251 (23%), Positives = 116/251 (46%), Gaps = 17/251 (6%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
                N           GL +++ ++Y  M L + V+ + ++L   +  T          
Sbjct: 1   MDNFPNDSGRRVVADQAGLNSFLTKMYGNMTLAVLVSALSAYLTMNVFATQV-------- 52

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                    G       + W+ +  P+ + + ++    + +     +M +L + + G+  
Sbjct: 53  --------LGYFQQHQGMVWLILLLPIALSMGISFSA-TRNPVGGFIMLMLVAIIYGVEF 103

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           +     +T+ +I   F  +AA F +++LYG  TKRDL   G+  +     L + S++N+F
Sbjct: 104 ALIAGAFTAANITAAFISSAAVFATMALYGTVTKRDLSKFGAHAMAALVALIIASIINIF 163

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           ++S AI    S + ++IF  LTA+D QK+K+ Y +  +       +++GAL LY+DF+ +
Sbjct: 164 LKSPAITYIFSYIAVIIFVVLTAWDAQKMKQIYLNYSNENSVMGLAIVGALQLYLDFVNL 223

Query: 247 FVHLLRFLGSR 257
           F+  L+  G  
Sbjct: 224 FISFLQIFGMS 234


>gi|311255880|ref|XP_003126407.1| PREDICTED: transmembrane BAX inhibitor motif-containing protein
           4-like [Sus scrofa]
          Length = 238

 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 47/228 (20%), Positives = 96/228 (42%), Gaps = 28/228 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY++++L + +T + S       +       S  +     L   G ++  +    
Sbjct: 33  AFLRKVYSILSLQVLLTTMTSTFFLYFDSVRAFVHESPALILVFALGSLGLILALT---- 88

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                           L+         +   ++ L  L+++     Y    ++Q F +T 
Sbjct: 89  ----------------LNRHKHPLNLYLLFGFTLLEALTVAFVVTFYDVYIVLQAFILTT 132

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
           A F  L++Y   +KRD    G+ +    + L L  ++ +F  S  ++L ++A+G ++F  
Sbjct: 133 AVFLGLTVYTLQSKRDFSKFGAGLFAVLWILCLSGILKVFFYSETMELVLAAVGALLFCG 192

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
              YDT  +            +  + V+ A+ LY+D I +F+HLLR L
Sbjct: 193 FIIYDTHSLMH--------RLSPEEYVLAAISLYLDIINLFLHLLRVL 232


>gi|22537744|ref|NP_688595.1| hypothetical protein SAG1604 [Streptococcus agalactiae 2603V/R]
 gi|25011693|ref|NP_736088.1| hypothetical protein gbs1653 [Streptococcus agalactiae NEM316]
 gi|76787395|ref|YP_330222.1| hypothetical protein SAK_1619 [Streptococcus agalactiae A909]
 gi|22534634|gb|AAN00468.1|AE014264_23 membrane protein, putative [Streptococcus agalactiae 2603V/R]
 gi|24413233|emb|CAD47312.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76562452|gb|ABA45036.1| membrane protein, putative [Streptococcus agalactiae A909]
 gi|319745521|gb|EFV97823.1| membrane protein [Streptococcus agalactiae ATCC 13813]
          Length = 229

 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 69/239 (28%), Positives = 117/239 (48%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D GL  +  ++Y L+ +G+G++  +S ++                   +      A+
Sbjct: 8   TQSDSGLNQFFAKIYGLVGIGVGLSAAVSAIMLY-----------------MFPQNMIAI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           M   P  +        V +F+       +  AA  +FL+YSAL G +LS     YT  ++
Sbjct: 51  MQKMPGLYFGAIILELVLVFVASGAARRNTPAALPLFLIYSALNGFTLSFIIARYTQTTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +Q F  +AA F +++L G  TK+DL  +   ++    G+ + SLVNLF+ S  +   +S 
Sbjct: 111 LQAFITSAAVFFAMALIGAKTKKDLSGMRKALMAALIGILIASLVNLFIGSGGMSYIISI 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L AYD Q IK  Y +      A+  +V  AL LY+DFI +F+++LR     
Sbjct: 171 VCVIIFSGLIAYDNQMIKYVY-NSQGGQVADGWAVSMALSLYLDFINLFLNILRLFARN 228


>gi|88607665|ref|YP_505848.1| hypothetical protein APH_1345 [Anaplasma phagocytophilum HZ]
 gi|88598728|gb|ABD44198.1| putative membrane protein [Anaplasma phagocytophilum HZ]
          Length = 233

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 96/238 (40%), Positives = 145/238 (60%), Gaps = 21/238 (8%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
            GLR+Y++RVYN MAL LG+TG ++F+ ++                     G  A +Y +
Sbjct: 15  AGLRSYLVRVYNYMALALGITGAVAFIASLSG-------------------GLMAAIYGT 55

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
           PL W+   AP+     ++ R+H +S     M+FL +SA++GLSLS  F+VYTS SI + F
Sbjct: 56  PLHWVVSLAPVITVFVMSARVHQMSYQTMMMVFLGFSAMMGLSLSYVFMVYTSHSIARVF 115

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
           FI++A FG+++ YG TTKRDL    +F+ MG  GL + S+VNLFMRS  +   +S + ++
Sbjct: 116 FISSAMFGTMAWYGNTTKRDLSKFSTFLTMGVVGLIIASVVNLFMRSGPLYFAISVVAVL 175

Query: 203 IFSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           +F+ALTA + Q+IK+ Y   +  D     + S++GA  LY  +I IFVH+L  +G RR
Sbjct: 176 VFTALTAVNAQEIKDMYYRFNDGDSNTVGKMSILGATSLYFSYINIFVHMLHLMGDRR 233


>gi|288906001|ref|YP_003431223.1| integral membrane protein [Streptococcus gallolyticus UCN34]
 gi|306832020|ref|ZP_07465175.1| membrane protein [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|288732727|emb|CBI14301.1| putative conserved integral membrane protein [Streptococcus
           gallolyticus UCN34]
 gi|304425946|gb|EFM29063.1| membrane protein [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
          Length = 230

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 69/238 (28%), Positives = 113/238 (47%), Gaps = 18/238 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D  L  +  ++Y L+ +G+G++ ++SFL+                   V       +
Sbjct: 9   TQTDSALNRFFAKIYGLVGVGIGLSALVSFLMLY-----------------VFTDNMVNI 51

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P  +          +FL       +  AA  +FL YSAL G +LS   + YT  ++
Sbjct: 52  IVYHPFVYYGAIFLELALVFLASNAARKNTPAALPLFLFYSALNGFTLSFVIVAYTQTTV 111

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           VQ F  +A  FG +++ G   KRDL  +   ++    G+ + SLVN+F+ S  +   +S 
Sbjct: 112 VQAFVSSALVFGVMAIIGTFVKRDLSGMAKALMAALIGIIIASLVNMFIGSGTMSYIISI 171

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           + ++IFS L AYD Q IK  Y         +  ++  AL LY+DFI +F+ LLR  GS
Sbjct: 172 ISVLIFSGLIAYDNQMIKRVYESTGGN-VGDGWAISMALSLYLDFINLFLSLLRIFGS 228


>gi|227513547|ref|ZP_03943596.1| integral membrane protein, interacts with FtsH [Lactobacillus
           buchneri ATCC 11577]
 gi|227524690|ref|ZP_03954739.1| integral membrane protein, interacts with FtsH [Lactobacillus
           hilgardii ATCC 8290]
 gi|227083420|gb|EEI18732.1| integral membrane protein, interacts with FtsH [Lactobacillus
           buchneri ATCC 11577]
 gi|227088174|gb|EEI23486.1| integral membrane protein, interacts with FtsH [Lactobacillus
           hilgardii ATCC 8290]
          Length = 235

 Score =  101 bits (252), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 68/255 (26%), Positives = 114/255 (44%), Gaps = 26/255 (10%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + N+    N      +    GL A++ ++Y  M+L + V+   +FL              
Sbjct: 1   MDNFSNERNERRVVNNA--AGLNAFLTKMYGWMSLAVLVSAATAFLT------------- 45

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                   +T     +      WI I A   +   ++ +        A    + Y+ L G
Sbjct: 46  --------VTTVSRDVLNGGGMWIAIIAWFILPFVVSFQALKR-PSLAFAALMGYAVLSG 96

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
              S+    YT  SI   F   +A F +++++G  T+++L  IG   I     L +  ++
Sbjct: 97  FVFSTLAYRYTGASIAAAFVSASAIFITMTVFGLVTRKNLDKIGRQAIAALIALVIAMII 156

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALMLYM 241
           N+F+RSS I    S + +VIF+ALTAYDTQK+K+ Y  +           +V GAL LY+
Sbjct: 157 NIFLRSSLITFVFSIIAVVIFTALTAYDTQKMKQMYNQAGSTGQVSVSGLAVFGALQLYL 216

Query: 242 DFIQIFVHLLRFLGS 256
           DF+ +F+ LL+  G 
Sbjct: 217 DFVNLFLQLLQIFGM 231


>gi|311110721|ref|ZP_07712118.1| integral membrane protein [Lactobacillus gasseri MV-22]
 gi|311065875|gb|EFQ46215.1| integral membrane protein [Lactobacillus gasseri MV-22]
          Length = 244

 Score =  101 bits (252), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 62/251 (24%), Positives = 111/251 (44%), Gaps = 17/251 (6%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
               +        + G+  ++ R+Y LMAL + V+ + S+L   +      +        
Sbjct: 10  NFDQNPERRHLVDESGVNIFLSRLYGLMALAVLVSALSSYLTMTVFARQMVN-------- 61

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
                    LM        F+         +     + S   + ++ +L + + G++ + 
Sbjct: 62  ---------LMNYHTWAMWFLLLLPIALTLIINFNATRSPGMSFVLLMLTAIVYGVTFAF 112

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
               YT + I   F  +A+ F  +++ G  TKRDL  IGS+      GL +  L+NLF++
Sbjct: 113 IAGAYTGEDIASAFIASASVFIVMAILGTVTKRDLSRIGSYASAALIGLIVAMLINLFLK 172

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFV 248
           +  ID   S + ++IF+ LTA+D Q+IK  Y            +V+GAL LY+DF+ +F+
Sbjct: 173 NPTIDYIFSFIAVIIFTILTAWDAQRIKNIYLQFGGELSTNGLAVLGALQLYLDFVNLFL 232

Query: 249 HLLRFLGSRRD 259
             L   GS  +
Sbjct: 233 QFLDIFGSNDN 243


>gi|259503622|ref|ZP_05746524.1| integral membrane protein [Lactobacillus antri DSM 16041]
 gi|259168396|gb|EEW52891.1| integral membrane protein [Lactobacillus antri DSM 16041]
          Length = 237

 Score =  101 bits (252), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 57/251 (22%), Positives = 114/251 (45%), Gaps = 17/251 (6%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
                N           GL +++ ++Y  M L + V+ + ++L   +             
Sbjct: 1   MDNFPNDSGRRVVADQAGLNSFLTKMYGNMTLAVLVSALSAYLTLNVFAQQV-------- 52

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                            + W+ +  P+ + + ++    + +     +M +L + + G+  
Sbjct: 53  --------LVYFQQHPGMVWLILLLPIALTMGISFSA-TRNPVGGFIMLMLVAVIYGVEF 103

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           +     +TS +I   F  +AA F +++LYG  TKRDL   G+  +     L + S++N+F
Sbjct: 104 ALIAGAFTSANITAAFISSAAVFATMALYGSVTKRDLSKFGAHAMAALVALIIASIINIF 163

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
           ++S AI    S + ++IF  LTA+D QK+K+ Y +  +       +++GAL LY+DF+ +
Sbjct: 164 LKSPAITYIFSYIAVIIFVVLTAWDAQKMKQIYLNYSNENSVMGLAIVGALQLYLDFVNL 223

Query: 247 FVHLLRFLGSR 257
           F+  L+  G  
Sbjct: 224 FISFLQIFGMS 234


>gi|167646934|ref|YP_001684597.1| hypothetical protein Caul_2972 [Caulobacter sp. K31]
 gi|167349364|gb|ABZ72099.1| protein of unknown function UPF0005 [Caulobacter sp. K31]
          Length = 237

 Score =  101 bits (252), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 67/231 (29%), Positives = 106/231 (45%), Gaps = 18/231 (7%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           +MI+V+  MA    ++   ++  + L                            +   W 
Sbjct: 25  FMIQVWLWMAGAALISAASAWACSNLPALSQA---------------LFTPRGLTAAGWG 69

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
              APL + +  +  +  LS   A  +F+ Y+ L+GLSL      YT   +  TF   AA
Sbjct: 70  VTLAPLLLVMVPSGAVTRLSPALAAGVFIAYAVLVGLSLGGVVAAYTGHGLALTFVAVAA 129

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
            F  L+L G  T+ DL  +G F +M    L +  + NL   SS +DL +SA+G+++F+ L
Sbjct: 130 GFAGLALLGAITRADLSGLGVFGLMSVMALIVAMIANLLFDSSTLDLAISAIGVLVFAGL 189

Query: 208 TAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
           TA+D Q+I     D +    A    ++ AL LY+D + IF+  LR  G RR
Sbjct: 190 TAFDIQRINRLQVDDWSDDRAP---ILAALTLYLDLLNIFLFALRLGGRRR 237


>gi|58579608|ref|YP_197820.1| hypothetical protein ERWE_CDS_09440 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58617662|ref|YP_196861.1| hypothetical protein ERGA_CDS_09350 [Ehrlichia ruminantium str.
           Gardel]
 gi|58417274|emb|CAI28387.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel]
 gi|58418234|emb|CAI27438.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 234

 Score =  101 bits (252), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 83/252 (32%), Positives = 147/252 (58%), Gaps = 21/252 (8%)

Query: 9   RVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINR 68
              +S          GLR Y+++VYN MA+ LG+TG+++F V+  +  ++          
Sbjct: 2   DNYSSVRFQSDYYSVGLRNYLMKVYNYMAMALGLTGLVAFFVSSSSYAIN---------- 51

Query: 69  GVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSS 128
                    ++Y +PL W+ +F+P+ +   ++ +L + S     ++F  ++AL+G S+SS
Sbjct: 52  ---------IIYNTPLHWVIMFSPIVLVFLMSYKLSTFSFQTVLVVFFSFAALMGASISS 102

Query: 129 FFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMR 188
            FL+YT+ SI + FFI+++ FG+++ YG  TK+DL    SF+IMG  G+ + SLVNLF+ 
Sbjct: 103 IFLIYTAASITKVFFISSSMFGAMAWYGNVTKKDLSQFQSFLIMGIIGVIIASLVNLFLH 162

Query: 189 SSAIDLTMSAMGLVIFSALTAYDTQKIKEAYS--DRYDVAYAERQSVIGALMLYMDFIQI 246
           +  +D  +S + +++F+ +TA D Q+IK+ Y   +  +     + +V+GA  LY ++I I
Sbjct: 163 NGPLDFAISFIAVILFTGMTACDAQRIKDMYYRFNDGNSVSLNKMAVLGATTLYFNYINI 222

Query: 247 FVHLLRFLGSRR 258
           F+ LL   G RR
Sbjct: 223 FLSLLNLQGERR 234


>gi|119578508|gb|EAW58104.1| Fas apoptotic inhibitory molecule 2, isoform CRA_b [Homo sapiens]
 gi|193786897|dbj|BAG52220.1| unnamed protein product [Homo sapiens]
          Length = 270

 Score =  101 bits (252), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 84/238 (35%), Gaps = 25/238 (10%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++ + L VT  +  L        D   A+           F          
Sbjct: 54  RVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFAT-------- 105

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      ++  +++  +          Y + S++    IT
Sbjct: 106 ---------YLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGIT 156

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLF----LLSLVNLFMRSSAIDLTMSAMGL 201
           A    S++++ + TK D       + +    LF    +L+++  F     +    +A+G 
Sbjct: 157 ALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGA 216

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
            +F+   A DTQ +          + +  + + GAL +Y+D I IF   L+  G+ R+
Sbjct: 217 GVFTLFLALDTQLLM----GNRRHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE 270


>gi|146324131|ref|XP_753708.2| Bax Inhibitor family protein [Aspergillus fumigatus Af293]
 gi|129558053|gb|EAL91670.2| Bax Inhibitor family protein [Aspergillus fumigatus Af293]
          Length = 270

 Score =  101 bits (251), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 43/234 (18%), Positives = 91/234 (38%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY ++ + L +T IMS +     +      ++  +    +    G ++ T     
Sbjct: 64  QFIRKVYAILTIQLLLTTIMSSISFFSESYRLWIQSNFWLMMVSVFGALGFMLVTYW--- 120

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S  A  +    ++ L   S+S     Y ++ ++Q   +  
Sbjct: 121 -----------------KRKSYPANLLFLSAFTLLEAYSISVVTSFYDARIVIQALILAL 163

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVN-LFMRSSAIDLTMSAMGLVIFS 205
             F +L+L+   TK D      ++    + L L   ++  F  +S  +L    +  +IFS
Sbjct: 164 GIFVALTLFACQTKYDFTNWMPYLFGALWFLILFGFMSAFFPYNSTAELIYGGLAALIFS 223

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           A    DTQ +   Y    +        +  A+ LY+D + +F+ +LR L ++ +
Sbjct: 224 AYILVDTQLVMRHYHVEEE--------IAAAISLYLDILNLFLAILRILNNQNN 269


>gi|114622148|ref|XP_001154278.1| PREDICTED: similar to Glutamate receptor, ionotropic, N-methyl
           D-asparate-associated protein 1 (glutamate binding)
           isoform 2 [Pan troglodytes]
          Length = 328

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 72/143 (50%), Gaps = 4/143 (2%)

Query: 117 LYSALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFG 176
           + +A +   +      Y +++++    IT A   ++ ++   T+ D       +++    
Sbjct: 190 VLTASLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVV 249

Query: 177 LFLLSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGA 236
           LF+ +++ +F+R+  +++  +++G ++F+   A DTQ +         ++ +  + V  A
Sbjct: 250 LFIFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLL----LGNKQLSLSPEEYVFAA 305

Query: 237 LMLYMDFIQIFVHLLRFLGSRRD 259
           L LY D I IF+++L  +G  ++
Sbjct: 306 LNLYTDIINIFLYILTIIGRAKE 328


>gi|58584747|ref|YP_198320.1| integral membrane protein, interacts with FtsH [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58419063|gb|AAW71078.1| Integral membrane protein, interacts with FtsH [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 240

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 92/247 (37%), Positives = 147/247 (59%), Gaps = 25/247 (10%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MS ++N Q + + G  + +    GLR+Y+ +VYN MAL LG+TG+++FL           
Sbjct: 1   MSYMKNEQDIRSQGVYYSA----GLRSYLTKVYNYMALALGITGLIAFLT---------- 46

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                    V    F  +     L  + I +P+ +  +++ RL  LSA +   +F L+S 
Sbjct: 47  ---------VFFDLFQVIYSNPVLSIVVILSPIVLVFYMSHRLQYLSAQSTVTVFFLFSV 97

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+GLSLS  F+VYT+++I + FFIT+  FGS++LYG +TK+DL  +GSF+IMG +GL + 
Sbjct: 98  LMGLSLSYIFIVYTTENIARAFFITSIMFGSMALYGNSTKKDLTSMGSFLIMGIWGLIIA 157

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVA--YAERQSVIGALM 238
           S+VNLF+ SS +   +S + +++F+ +TAYD Q+IK+ Y    D +     + ++ GA  
Sbjct: 158 SIVNLFLGSSPLYFAISFISVIVFTLMTAYDAQRIKDVYYRYNDGSEAVTTKLAIFGATN 217

Query: 239 LYMDFIQ 245
           LY DFI 
Sbjct: 218 LYFDFIN 224


>gi|24380095|ref|NP_722050.1| putative integral membrane protein [Streptococcus mutans UA159]
 gi|290579926|ref|YP_003484318.1| putative integral membrane protein [Streptococcus mutans NN2025]
 gi|24378091|gb|AAN59356.1|AE015001_1 putative integral membrane protein [Streptococcus mutans UA159]
 gi|254996825|dbj|BAH87426.1| putative integral membrane protein [Streptococcus mutans NN2025]
          Length = 229

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 68/239 (28%), Positives = 119/239 (49%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D  L ++  ++Y L+ +G+G++ ++S+L+                   V      A+
Sbjct: 8   TQSDSRLSSFFAKIYGLVGMGIGLSAVVSYLMLY-----------------VFRNNMIAI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           M  +P  +          + +       ++  A  +FL+YSAL G +LS    +YT  ++
Sbjct: 51  MVNAPWVYYVAIFAELALVLIASNAARKNSPTALPLFLVYSALNGFTLSFIIALYTQTTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +Q F  +AA F  ++L G T K+DL  +G  ++    G+ + SL+N+F+ S  +   +S 
Sbjct: 111 LQAFVSSAAVFFVMALIGVTIKKDLSGMGKALLAALIGIIIASLINMFIGSGTMSYVISI 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L AYD Q IK  Y D      ++  +V  AL LY+DFI +F+ LLR  G  
Sbjct: 171 ISVLIFSGLIAYDNQLIKRVY-DYNSGNVSDGWAVSMALNLYLDFINLFLSLLRIFGRN 228


>gi|310816680|ref|YP_003964644.1| hypothetical protein EIO_2248 [Ketogulonicigenium vulgare Y25]
 gi|308755415|gb|ADO43344.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 209

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 85/206 (41%), Positives = 135/206 (65%), Gaps = 1/206 (0%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           +  +  + +S       IDQGL+A+M +VY  M++G+ +T + ++ V+ LA T DP+AA+
Sbjct: 1   MAQFDTIRSSAGVRAGAIDQGLKAHMNKVYGTMSIGMVITALAAWAVSGLAVTTDPNAAA 60

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
             +     LT FG  +Y SPL+W+ +  P+G+       ++ +SA  A++ F +Y+A +G
Sbjct: 61  AQMGSR-YLTDFGYALYASPLKWVIMLLPIGMVFAFGALINRVSAAGAQLFFYVYAAAMG 119

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
           LSLSS FL+YT  SIVQ F ITA +F +LSLYGYTTKRD+   G+F+IMG  GL +  +V
Sbjct: 120 LSLSSIFLIYTGTSIVQVFLITAIAFAALSLYGYTTKRDISGWGTFLIMGLVGLLVAMIV 179

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTA 209
           N+F+ S  + + +S +G+++F+ LTA
Sbjct: 180 NIFIGSGPLAMAISVLGVLLFAGLTA 205


>gi|91083101|ref|XP_969476.1| PREDICTED: similar to MGC88883 protein [Tribolium castaneum]
 gi|270006991|gb|EFA03439.1| hypothetical protein TcasGA2_TC013429 [Tribolium castaneum]
          Length = 250

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/227 (16%), Positives = 89/227 (39%), Gaps = 28/227 (12%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++ +VY L+++ L +T +++ +             +  +     +     L+        
Sbjct: 46  FIRKVYGLLSMQLLLTIVVASIFMFTPQIKTFVHENDWMLLVSFIPSIFLLIAL------ 99

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
                          +      A  ++   ++ +   ++      Y+   ++Q   +T  
Sbjct: 100 --------------IIKRRDTPANLILLAAFTVVEAYTVGVILTYYSQAVVLQALLLTLV 145

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
             GSL+ Y + TKRD   + S +  G   L +   + +F  SS  ++ +S  G  +F   
Sbjct: 146 IVGSLTFYTFQTKRDFSAMYSGLFAGLGILIVGGFLQIFFHSSTFEIVISLGGAFLFCLF 205

Query: 208 TAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
             +DTQ + +          +  + ++  + LY+D I +F+++LR L
Sbjct: 206 IIFDTQMMMQT--------LSAEEYILATINLYLDIINLFLYILRIL 244


>gi|118093769|ref|XP_422067.2| PREDICTED: hypothetical protein [Gallus gallus]
          Length = 311

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/235 (15%), Positives = 88/235 (37%), Gaps = 27/235 (11%)

Query: 27  AYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           +++ +VY ++++ L VT GI++    +            +      +     L+      
Sbjct: 98  SFIRKVYAIISVQLLVTVGIIAMFTFVSPVRSFVQRNIAVYYSSYAVFLVTYLVLV---- 153

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                           +          ++  +++  +     +   +Y +K+++    IT
Sbjct: 154 --------------CCQGPRRRFPWNLILLSIFTLAMSFMTGTIASMYQTKAVLIAMLIT 199

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRS----SAIDLTMSAMGL 201
           A     ++++ + TK D         +    + +  +V + + S      + +  +A+G 
Sbjct: 200 AIVAIIVTIFCFQTKVDFTSCTGLFCVLGIVVMVTGIVTVIVLSFKYVPWLHMLYAAIGA 259

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
           + F+   AYDTQ +            +  + + GAL +Y D + IF  LL+ +G 
Sbjct: 260 IAFTLFLAYDTQLV----LGNRKNTLSPEEYIYGALTIYTDIVYIFTFLLQIVGR 310


>gi|329117502|ref|ZP_08246219.1| putative membrane protein [Streptococcus parauberis NCFD 2020]
 gi|326907907|gb|EGE54821.1| putative membrane protein [Streptococcus parauberis NCFD 2020]
          Length = 229

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 64/239 (26%), Positives = 114/239 (47%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +  D GL  +  ++Y+L+ +G+G++  +S+L+                           +
Sbjct: 8   TETDSGLNQFFAKIYSLVGMGIGLSAFVSYLMLY-----------------PFKDNLLNI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +   P  +        + +F        +  AA  +FL+YSAL G +LS   + YT+ ++
Sbjct: 51  VANHPFVYYGAIIFELLLVFFASGAARKNTPAALPLFLIYSALNGFTLSFIIMAYTTSTV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
           +Q F  +A  F  +++ G   KRDL  +   +     G+ L S+VN+F+ S A+   +S 
Sbjct: 111 MQAFVSSAGVFFVMAMIGARIKRDLSGMRKALFAALIGIILASVVNIFLGSGAMSYIISI 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L A D Q IK+ Y    +    +  ++  AL LY+DFI +F+ LLR  G  
Sbjct: 171 ISVLIFSGLIAADNQMIKQVY-QSTNGQVNDGWAIAMALSLYLDFINLFISLLRIFGRN 228


>gi|307182329|gb|EFN69611.1| Transmembrane BAX inhibitor motif-containing protein 4 [Camponotus
           floridanus]
          Length = 250

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 96/228 (42%), Gaps = 29/228 (12%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++ +VY L+++ L +T +++ +  + +T       +            G L+        
Sbjct: 46  FLRKVYGLLSIQLLMTVVVASVFVMSSTVKLYVQDNPWTIGLAFFLTMGILIGL------ 99

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
                          +      A  ++   ++     ++     +Y +  +++  FIT  
Sbjct: 100 --------------LIKRKDHPANLILLSAFTLAQAYTVGVVVSMYDTTIVLEALFITLT 145

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFM-RSSAIDLTMSAMGLVIFSA 206
               L+ Y + TKRD   +G  + +G + L +  L+  F+  ++A++L +S  G ++F  
Sbjct: 146 VLLGLTAYTFQTKRDFSFLGFGLFIGLWCLLIGGLIQTFVLENTALELGISIGGALLFCL 205

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
              +DTQ I          + +  + ++  + +Y+D I +F+H+LR L
Sbjct: 206 FIVFDTQAIM--------QSLSPEEYILATINIYLDIINLFLHILRAL 245


>gi|289742597|gb|ADD20046.1| N-methyl-D-aspartate receptor glutamate-binding subunit [Glossina
           morsitans morsitans]
          Length = 276

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 88/233 (37%), Gaps = 20/233 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           RA++ +VY ++   L  T  M   V     T++    +  +    M+T    ++  +   
Sbjct: 64  RAFIRKVYLILMGQLCFTFGMVAFVLFHEPTLEFIHRNSFLVTIAMVTLLVMVLAMAC-- 121

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                +     +   +++      +++    + S++++    IT
Sbjct: 122 ---------------CDTARRTYPTNFICLSIFTFAESFVVAAIAGHFNSQTVLMAVGIT 166

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A     L+++   +K D    G  ++     + +   + +F     +    + +G  +  
Sbjct: 167 AFLCLVLTIFAMQSKYDFTACGGILLTALVCVVIFGFITIFWNHQILRTMYACLGAFVAC 226

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            L  YDTQ +       +  + +  + +  AL LYMD  +IF+ +L  +G ++
Sbjct: 227 ILFIYDTQLMM---GGDHKYSISPEEYIFAALNLYMDVGRIFLFVLTLIGGKK 276


>gi|313123220|ref|YP_004033479.1| hypothetical protein LDBND_0452 [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|312279783|gb|ADQ60502.1| Conserved hypothetical membrane protein [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
          Length = 237

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 62/234 (26%), Positives = 108/234 (46%), Gaps = 18/234 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D  L  ++ ++Y++M L + V+ + ++L   +                   +G    + T
Sbjct: 16  DSALNGFLTKMYSIMGLAVLVSALTAYLTLTV------------------FSGSLLPLLT 57

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + +    +     +         +     A  M +  + + GL  S     YT   I   
Sbjct: 58  NRVFLWVLLLLPLILSVGISFKATRKPTTAFFMLMAIAVIYGLEFSLLSFAYTGAQIGGA 117

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F   +A F  ++ YG  TK++L  IG++     +GL + SLVN+F++S+      S +G+
Sbjct: 118 FISASAVFIGMAAYGSVTKKNLDTIGAYASAAIWGLIVASLVNMFLKSTPASFIFSIIGV 177

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           +IF+ LTA+D QK+K  Y+   D       +V GALMLY+DFI +F+  LR  G
Sbjct: 178 IIFTILTAWDAQKMKSIYASYGDQLPELGLAVNGALMLYLDFINLFLQFLRIFG 231


>gi|195064721|ref|XP_001996621.1| GH19695 [Drosophila grimshawi]
 gi|193892753|gb|EDV91619.1| GH19695 [Drosophila grimshawi]
          Length = 263

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 47/229 (20%), Positives = 88/229 (38%), Gaps = 22/229 (9%)

Query: 27  AYMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           +++ +VY ++   L VT GI++  V  +   +       +    V++     L       
Sbjct: 51  SFIRKVYLILMAQLLVTFGIVALFVFSVEAKIFAVLHPGLFWVAVLIMLLTMLAMV---- 106

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                                      +   L++      +      +    I+    IT
Sbjct: 107 --------------CCENVRRETPINFICLGLFTVAESFLMGISASRFAPIEILLAIGIT 152

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           AA   +L+L+   TK D+  +G  +I     L +  +V++FM    I L  S++  V+FS
Sbjct: 153 AAICLALTLFALQTKFDVTMMGGILIACLVALLVFGIVSIFMPGRTIRLIYSSLAAVLFS 212

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
               YDTQ +       +  + +  + +  AL LY+D I IF+ +L  L
Sbjct: 213 VYLIYDTQLMM---GGGHKYSISPEEYIFAALNLYLDIINIFMEILGIL 258


>gi|118398731|ref|XP_001031693.1| hypothetical protein TTHERM_00760770 [Tetrahymena thermophila]
 gi|89286025|gb|EAR84030.1| hypothetical protein TTHERM_00760770 [Tetrahymena thermophila
           SB210]
          Length = 338

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 50/249 (20%), Positives = 97/249 (38%), Gaps = 22/249 (8%)

Query: 7   YQRVVNSGSGFGSTIDQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASII 65
           +Q+   +    G T D+ LR+ ++ +VY +++  + VT I+           +    +  
Sbjct: 102 FQQDSQNNQSSGLTSDKFLRSGFVTKVYTILSAQMAVTVILCAYSMSSQKFKNFQLNNPG 161

Query: 66  INRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLS 125
           +    ++                    + + + +  R  +       ++  +++      
Sbjct: 162 LMIAALVVNI-----------------ICLLVLICSRDQARKVPNNYILLGVFTLCESYL 204

Query: 126 LSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNL 185
           +S    +   K +      T A F SL+LY  TTK D   +G  + +   GLF+     +
Sbjct: 205 VSFICSMSNPKIVFLAALFTMAIFLSLTLYACTTKSDFTTMGGTLYVIGMGLFIFGFFLI 264

Query: 186 FMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           F  ++ + L  +    V+F     YDTQ I           Y+    +I +L LYMD I 
Sbjct: 265 FTNNNVMHLIYATACAVLFGFYILYDTQLII----GNKSYKYSIDDYIIASLELYMDIIG 320

Query: 246 IFVHLLRFL 254
           +F+ LL  L
Sbjct: 321 LFLQLLEIL 329


>gi|34540578|ref|NP_905057.1| hypothetical protein PG0795 [Porphyromonas gingivalis W83]
 gi|34396891|gb|AAQ65956.1| membrane protein, putative [Porphyromonas gingivalis W83]
          Length = 236

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 84/232 (36%), Positives = 128/232 (55%), Gaps = 22/232 (9%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M  V+  M   LG+T + + LV   +                       ++    L W  
Sbjct: 23  MRHVFTWMFGALGITALTAMLVAKSSLIYT-------------------MIMNPGLLWGL 63

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A L +   L+ R+  +S + + ++F +YS L G++LSS F+VYT  SI  TFFITA  
Sbjct: 64  IIAELALVFILSARIGKMSFFTSSLLFTIYSILNGVTLSSIFIVYTMTSIAATFFITAGM 123

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG+++L+GY TK+DL   GS   M   GL L ++VNLF+RS A+    S +G++IF+ LT
Sbjct: 124 FGAMALWGYFTKKDLSKWGSIFFMLLIGLILATVVNLFLRSGAMGFIFSIVGVIIFTGLT 183

Query: 209 AYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           A+D  KIK+  +        +   + +++GAL LY+DFI +F++LLRF G R
Sbjct: 184 AFDVNKIKQMLAQTQGFEEGDVVRKVALMGALTLYLDFINLFLYLLRFFGRR 235


>gi|294790988|ref|ZP_06756146.1| putative membrane protein [Scardovia inopinata F0304]
 gi|294458885|gb|EFG27238.1| putative membrane protein [Scardovia inopinata F0304]
          Length = 298

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 65/254 (25%), Positives = 120/254 (47%), Gaps = 19/254 (7%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
           YQ  +++ + + +   Q  R  +IR Y  M LG+ VT +++FL            A+  I
Sbjct: 63  YQNTIDTTASY-TQDAQAQRVSVIRAYFEMFLGILVTAVVAFLTAYNGWYYYYAKATGTI 121

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                              W    A + +   L+ R+  +S   A+++F LY+A +G +L
Sbjct: 122 GL-----------------WGLFIAQIAIVFVLSTRVTKMSTPVARLVFYLYAATMGFTL 164

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
           S+ F +Y   +I     +++  F  L++ G TTKR+L   G  ++     L ++ ++ L 
Sbjct: 165 STIFAIYNIGTIGIALGLSSLFFLVLTMIGLTTKRNLLKAGPILMAALITLLVVEVILLI 224

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDV-AYAERQSVIGALMLYMDFIQ 245
           + +S   + +S + +V+F+  T YD Q  +   +         +R S++ AL LY+DFI 
Sbjct: 225 INASGSTMLISGISVVLFAGFTMYDAQSSRALLAQYQGQPEMIKRVSILCALNLYLDFIN 284

Query: 246 IFVHLLRFLGSRRD 259
            F++LL  LG   +
Sbjct: 285 FFINLLSLLGGSDN 298


>gi|227510538|ref|ZP_03940587.1| integral membrane protein, interacts with FtsH [Lactobacillus
           brevis subsp. gravesensis ATCC 27305]
 gi|227190190|gb|EEI70257.1| integral membrane protein, interacts with FtsH [Lactobacillus
           brevis subsp. gravesensis ATCC 27305]
          Length = 235

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 68/255 (26%), Positives = 115/255 (45%), Gaps = 26/255 (10%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
           + N+    N      +    GL A++ ++Y  M+L + V+   +FL              
Sbjct: 1   MDNFSNERNERRVVNNA--AGLNAFLTKMYGWMSLAVLVSAATAFLT------------- 45

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                   +T     + T    WI I A   +   ++ +        A    + Y+ L G
Sbjct: 46  --------VTAISPAVLTGGGMWIAIIAWFILPFVVSFQALKR-PSLAFAALMGYAVLSG 96

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
              S+    YT  SI   F   +A F +++++G  T+++L  IG   I     L +  ++
Sbjct: 97  FVFSTLAYRYTGASIAAAFVSASAIFITMTVFGLVTRKNLDKIGRQAIAALIALVIAMII 156

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAY--SDRYDVAYAERQSVIGALMLYM 241
           N+F+RS+ I    S + +VIF+ALTAYDTQK+K+ Y  +           +V GAL LY+
Sbjct: 157 NIFLRSTLITFVFSIIAVVIFTALTAYDTQKMKQMYNQAGSTGQVSVSGLAVFGALQLYL 216

Query: 242 DFIQIFVHLLRFLGS 256
           DF+ +F+ LL+  G 
Sbjct: 217 DFVNLFLQLLQIFGM 231


>gi|195402675|ref|XP_002059930.1| GJ15114 [Drosophila virilis]
 gi|194140796|gb|EDW57267.1| GJ15114 [Drosophila virilis]
          Length = 302

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/234 (20%), Positives = 94/234 (40%), Gaps = 23/234 (9%)

Query: 22  DQGLRA-YMIRVYNLMALGLGVT-GIMSFLVNILATTVDPDAASIIINRGVMLTGFGALM 79
           DQ +R  ++ +VY ++   L  T G++S  V    T        +++   +++       
Sbjct: 87  DQTIRKGFIRKVYFILLTQLLFTLGVISIFVYHEPTKQFVREKPMVVGVAMIVN------ 140

Query: 80  YTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIV 139
                        + +           +     +   L++A + L L +      +  ++
Sbjct: 141 ------------IVVLISMACCETARRNFPINFICLGLFTATMSLLLGAVASTLDANVVL 188

Query: 140 QTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAM 199
               ITA    +LS++   TK D    G  +I     L +L+    F+R +  +  +S +
Sbjct: 189 LAVGITALLVVALSIFAIQTKYDFTAWGGVLISVVICLLILAFAGAFLRGTFGETAVSCL 248

Query: 200 GLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRF 253
           G ++ S L  YDTQ I       +   +     +  AL LY+D ++IF+++LR 
Sbjct: 249 GALLASFLLIYDTQLII---GGTHKYQFNPEDYIFAALTLYLDVVRIFLYVLRL 299


>gi|227544013|ref|ZP_03974062.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri CF48-3A]
 gi|300909528|ref|ZP_07126989.1| integral membrane protein [Lactobacillus reuteri SD2112]
 gi|227186005|gb|EEI66076.1| integral membrane protein, interacts with FtsH [Lactobacillus
           reuteri CF48-3A]
 gi|300893393|gb|EFK86752.1| integral membrane protein [Lactobacillus reuteri SD2112]
          Length = 235

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 57/235 (24%), Positives = 108/235 (45%), Gaps = 17/235 (7%)

Query: 25  LRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPL 84
           L  ++ ++Y LM L + ++ + ++LV                   V    F A M  +  
Sbjct: 17  LNKFLTKMYGLMTLVVLLSALTAWLVMT-----------------VFAQQFTAFMVNNRW 59

Query: 85  RWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFI 144
               +     +  F      + S      + +L + + G++ +     Y    I   F  
Sbjct: 60  GMWLVILLPIILTFGINFNATRSPGLCLFLLILTAIVYGITFTFIAGAYAGTDIATAFVS 119

Query: 145 TAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIF 204
           +A  F ++++ G  + RD   +GS+      G+ +  LVN F++S  I+  +S + ++IF
Sbjct: 120 SAGVFLTMAIIGTFSHRDFTRLGSYASAALIGMIIAMLVNFFVQSPIINYLLSIVAVIIF 179

Query: 205 SALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
           +ALTA+D Q++K  Y++      +   +V+GAL LY+DFI +F+  L  LGS  +
Sbjct: 180 TALTAWDAQRMKNIYTECNGQVSSNGLAVLGALQLYLDFINLFISFLDILGSSNE 234


>gi|322517492|ref|ZP_08070365.1| membrane protein [Streptococcus vestibularis ATCC 49124]
 gi|322123974|gb|EFX95533.1| membrane protein [Streptococcus vestibularis ATCC 49124]
          Length = 229

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 72/239 (30%), Positives = 118/239 (49%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +T D GL  +  ++Y L+ +G+G++ ++S+L+                    +   F  +
Sbjct: 8   TTSDAGLNRFFGKIYGLVGIGVGISAVISYLMLF-----------------PLSHLFVNI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +      +          +FL       +  AA  +FL+YSAL G +LS   + YT  ++
Sbjct: 51  LMNYSWVYTAAIFVELALVFLASGAARKNTPAALPLFLVYSALNGFTLSFIIVQYTQANV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            Q F  TA  F  ++L G + KRDL  I  F++    G+ + SLVN+F  SS +   +S 
Sbjct: 111 FQAFISTAIVFFVMALIGVSIKRDLSGIVKFLMAALIGIIVASLVNIFFASSTMSFVISI 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L AYD Q IK+ Y         +  +V  AL LY+DFI +F+++LR   SR
Sbjct: 171 VSVLIFSGLIAYDNQLIKKIYYSTNGQ-VTDGWAVSMALSLYLDFINLFLNILRIFASR 228


>gi|188994682|ref|YP_001928934.1| hypothetical protein PGN_0818 [Porphyromonas gingivalis ATCC 33277]
 gi|188594362|dbj|BAG33337.1| conserved hypothetical protein [Porphyromonas gingivalis ATCC
           33277]
          Length = 236

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 85/232 (36%), Positives = 129/232 (55%), Gaps = 22/232 (9%)

Query: 29  MIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWIF 88
           M  V+  M   LG+T + + LV   +                       ++  S L W  
Sbjct: 23  MRHVFTWMFGALGITALTAMLVAKSSLIYT-------------------MIMNSGLLWGL 63

Query: 89  IFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAAS 148
           I A L +   L+ R+  +S + + ++F +YS L G++LSS F+VYT  SI  TFFITA  
Sbjct: 64  IIAELALVFILSARIGKMSFFTSSLLFTIYSILNGVTLSSIFIVYTMTSIAATFFITAGM 123

Query: 149 FGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSALT 208
           FG+++L+GY TK+DL   GS   M   GL L ++VNLF+RS A+    S +G++IF+ LT
Sbjct: 124 FGAMALWGYFTKKDLSKWGSIFFMLLIGLILATVVNLFLRSGAMGFIFSIVGVIIFTGLT 183

Query: 209 AYDTQKIKEAYSDRYDVAYAE---RQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           A+D  KIK+  +        +   + +++GAL LY+DFI +F++LLRF G R
Sbjct: 184 AFDVNKIKQMLAQTQGFEEGDVVRKVALMGALTLYLDFINLFLYLLRFFGRR 235


>gi|156374080|ref|XP_001629637.1| predicted protein [Nematostella vectensis]
 gi|156216641|gb|EDO37574.1| predicted protein [Nematostella vectensis]
          Length = 247

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 43/260 (16%), Positives = 99/260 (38%), Gaps = 21/260 (8%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDP 59
           M D   Y           +  D  +RA ++ +VY+++   L VT                
Sbjct: 8   MGDAEKYGADDPFADNSMAFSDISIRAGFIRKVYSILLCQLAVTISFICFFLYCEPVRLY 67

Query: 60  DAASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYS 119
             +   I  G +   F  ++  +    +                         +   L++
Sbjct: 68  AVSHPGIFYGALAVTFVTMIAMACCEGVR-----------------RKFPTNLLFLTLFT 110

Query: 120 ALIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFL 179
              G  L +   VY +  ++    ITA    +++++ + TK D   +G F+ +    L  
Sbjct: 111 LCEGYLLGAVSSVYKADEVLMAVGITAVVVLAITIFAFQTKYDFTMMGGFLFVALIVLIC 170

Query: 180 LSLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALML 239
              + +F  +  + +  +++G ++F+    YDTQ +          + +  + +  AL L
Sbjct: 171 FGFLAIFFHNRVVQIVYASLGALLFALYLVYDTQIMM---GGGKMYSISPEEYIFAALNL 227

Query: 240 YMDFIQIFVHLLRFLGSRRD 259
           Y+D + +F+++L+ + + R+
Sbjct: 228 YLDIVNMFLYILQLISAARN 247


>gi|116513624|ref|YP_812530.1| integral membrane protein, interacts with FtsH [Lactobacillus
           delbrueckii subsp. bulgaricus ATCC BAA-365]
 gi|116092939|gb|ABJ58092.1| Integral membrane protein, interacts with FtsH [Lactobacillus
           delbrueckii subsp. bulgaricus ATCC BAA-365]
          Length = 237

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 62/234 (26%), Positives = 109/234 (46%), Gaps = 18/234 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D  L  ++ ++Y++M L + V+ + ++L   +                   +G    + T
Sbjct: 16  DSALNGFLTKMYSIMGLAVLVSALTAYLTLTV------------------FSGSLLPLLT 57

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + +    +     +         + +   A  M +  + + GL  S     YT   I   
Sbjct: 58  NRVFLWVLLLLPLILSVGISFKATRNPTTAFFMLMAIAVVYGLEFSLLAFAYTGAQIGGA 117

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F   +A F  ++ YG  TK++L  IG++     +GL + SLVN+F++S+      S +G+
Sbjct: 118 FISASAVFIGMAAYGSVTKKNLDTIGAYASAAIWGLIVASLVNMFLKSTPASFIFSIIGV 177

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           +IF+ LTA+D QK+K  Y+   D       +V GALMLY+DFI +F+  LR  G
Sbjct: 178 IIFTILTAWDAQKMKSIYASYGDQLPELGLAVNGALMLYLDFINLFLQFLRIFG 231


>gi|104773632|ref|YP_618612.1| hypothetical protein Ldb0509 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|103422713|emb|CAI97340.1| Conserved hypothetical membrane protein [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC 11842]
          Length = 237

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 62/234 (26%), Positives = 108/234 (46%), Gaps = 18/234 (7%)

Query: 22  DQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYT 81
           D  L  ++ ++Y++M L + V+ + ++L   +                   +G    + T
Sbjct: 16  DSALNGFLTKMYSIMGLAVLVSSLTAYLTLTV------------------FSGSLLPLLT 57

Query: 82  SPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQT 141
           + +    +     +         +     A  M +  + + GL  S     YT   I   
Sbjct: 58  NRVFLWVLLLLPLILSVGISFKATRKPTTAFFMLMAIAVVYGLEFSLLAFAYTGAQIGGA 117

Query: 142 FFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGL 201
           F   +A F  ++ YG  TK++L  IG++     +GL + SLVN+F++S+      S +G+
Sbjct: 118 FISASAVFIGMAAYGSVTKKNLDTIGAYASAAIWGLIVASLVNMFLKSTPASFIFSIIGV 177

Query: 202 VIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
           +IF+ LTA+D QK+K  Y+   D       +V GALMLY+DFI +F+  LR  G
Sbjct: 178 IIFTILTAWDAQKMKSIYASYGDQLPELGLAVNGALMLYLDFINLFLQFLRIFG 231


>gi|312864013|ref|ZP_07724249.1| putative membrane protein [Streptococcus vestibularis F0396]
 gi|311100426|gb|EFQ58633.1| putative membrane protein [Streptococcus vestibularis F0396]
          Length = 229

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 73/239 (30%), Positives = 117/239 (48%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +T D GL  +  +VY L+ +G+G++ ++S+L+                    +   F  +
Sbjct: 8   TTSDAGLNRFFGKVYGLVGIGVGLSAVISYLMLF-----------------PLSHLFVNI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +      ++         +FL       +  AA  +FL+YSAL G +LS     YT   +
Sbjct: 51  LMNYSWIYMAAIFIELALVFLASGAARRNTPAALPLFLVYSALNGFTLSFIIAQYTQAIV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            Q F  TA  F  ++L G + KRDL  I  F++    G+ + SLVN+F  SS +   +S 
Sbjct: 111 FQAFLSTAIVFFVMALIGVSIKRDLSGIVKFLMAALIGIIVASLVNIFFASSTMSFVISI 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L AYD Q IK+ Y         +  +V  AL LY+DFI +F+++LR   SR
Sbjct: 171 VSVLIFSGLIAYDNQLIKKIYYSTNGQ-VTDGWAVSMALSLYLDFINLFLNILRIFASR 228


>gi|300173071|ref|YP_003772237.1| integral membrane protein [Leuconostoc gasicomitatum LMG 18811]
 gi|299887450|emb|CBL91418.1| Integral membrane protein [Leuconostoc gasicomitatum LMG 18811]
          Length = 239

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 68/249 (27%), Positives = 115/249 (46%), Gaps = 17/249 (6%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
                 +     + +D G+RA+  + Y+ MA+ + VT I  F+V                
Sbjct: 1   MDNFNINTRRDVTGMDAGMRAFFKQTYSFMAIAVMVTAITGFVVQK-------------- 46

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                L    AL+  + +  + +F    + + +  R    +   A  + + ++ + GL+L
Sbjct: 47  ---FFLAQVVALIAGNIVGTLALFGIQILIMTMIGRATFKNPARAFGLLMAFAVVEGLTL 103

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                +YT  S+   F   AA FG ++ YG  TKRDL  +GS +     GL + S+VN+ 
Sbjct: 104 GLLLAIYTGASVTMAFVSAAAVFGGMAAYGIFTKRDLTGMGSILFGLLIGLVVASVVNIL 163

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
             +  + L +S + +++FS  TAYD Q +K  YS     A     +V GAL LY+DF+ +
Sbjct: 164 FYNGIVSLLISGVSVIVFSLYTAYDNQNLKLMYSQFAGQADTTGLAVNGALRLYLDFVNL 223

Query: 247 FVHLLRFLG 255
           F  L+R  G
Sbjct: 224 FFALIRIFG 232


>gi|315226652|ref|ZP_07868440.1| conserved hypothetical protein [Parascardovia denticolens DSM
           10105]
 gi|315120784|gb|EFT83916.1| conserved hypothetical protein [Parascardovia denticolens DSM
           10105]
          Length = 312

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 118/257 (45%), Gaps = 19/257 (7%)

Query: 4   IRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAAS 63
              +   +N+ + + +  ++     + R Y  M LG+ VT +++ L  I    +    A+
Sbjct: 74  FAQFSSPMNTTAAY-AQDERARHTSVTRAYFEMFLGILVTAVIAVLSAINGWFISFYQAT 132

Query: 64  IIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIG 123
                             +   W  + A L + + L+  +  ++   A+++F LY+A +G
Sbjct: 133 G-----------------TIGYWGIVIAQLVLVVVLSTNISKMNTTVARLIFYLYAASMG 175

Query: 124 LSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV 183
            +LS  F VY   +I   F +++  F  L++ G TT+R+L   G  +      L ++ ++
Sbjct: 176 FTLSVVFGVYGLTTIGLAFGLSSLFFLVLTMIGLTTRRNLLAWGPILFAALLTLVVVEIL 235

Query: 184 NLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDV-AYAERQSVIGALMLYMD 242
            +   +    + +S + +V+F+  TAYD QK +             ++ S++ AL LY+D
Sbjct: 236 LMIFNAGGATMLISGISIVLFAGFTAYDAQKTRVILGQYQGQPEMIKKVSILCALDLYLD 295

Query: 243 FIQIFVHLLRFLGSRRD 259
           FI  FV LL+ LG   D
Sbjct: 296 FINFFVSLLQLLGGSSD 312


>gi|195501696|ref|XP_002097903.1| GE10054 [Drosophila yakuba]
 gi|194184004|gb|EDW97615.1| GE10054 [Drosophila yakuba]
          Length = 264

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 83/232 (35%), Gaps = 20/232 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++   L    I S +V +  T  +     +  +  +               
Sbjct: 52  RGFIRKVYLILLAQL----ITSLVVIVTLTVDEQVRLIVADSTWIFW------------- 94

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
              +     +              A  +    ++      L      Y    I  +  IT
Sbjct: 95  MAILIVVCSLVALGCNEDLRRQTPANFIFLSAFTVAESFLLGVVACRYAPMEIFMSVLIT 154

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A+    L+L+   T+ D   +G  ++     L L  +V +F+    +    ++M  ++FS
Sbjct: 155 ASVCLGLTLFALQTRYDFTMMGGILVSCLIILLLFGIVTIFVGGHMVTTIYASMSALLFS 214

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
               YDTQ        ++  + +  + +  AL +YMD I IF  +L+ +G  
Sbjct: 215 VYLVYDTQL---MLGGKHRYSISPEEYIFAALNIYMDVINIFHDILQLIGGS 263


>gi|321452764|gb|EFX64082.1| hypothetical protein DAPPUDRAFT_66500 [Daphnia pulex]
          Length = 237

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/242 (18%), Positives = 93/242 (38%), Gaps = 21/242 (8%)

Query: 14  GSGFGSTIDQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVML 72
           G    +  DQ +R  ++ +VY+++ + L +T  +  L     +          +     L
Sbjct: 11  GDAAFAFSDQSIRMVFVRKVYSILMVQLAITVAIISLFVYEPSVQLYSFEHPEMWLIAFL 70

Query: 73  TGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLV 132
              G ++                 +               ++  L++   G  L +F   
Sbjct: 71  MAIGLII-----------------VLARCHEFRRRWPLNMILLGLFTLCEGFLLGTFSAS 113

Query: 133 YTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAI 192
           Y S+ ++    I +A   +L ++   TK D    G  + + A  L +  +V + +     
Sbjct: 114 YESEEVLIAVGICSAVCFALIIFAMQTKWDFTAYGGILFVCAIVLIIFGIVAICIPGDVT 173

Query: 193 DLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLR 252
            L  +++G ++FS    YDTQ        ++  + +  + +  AL LY+D I IF ++L 
Sbjct: 174 QLLYASLGALLFSIYLVYDTQL---MLGGKHKHSISPEEYIFAALTLYLDIINIFQYVLS 230

Query: 253 FL 254
            L
Sbjct: 231 LL 232


>gi|118580557|ref|YP_901807.1| hypothetical protein Ppro_2141 [Pelobacter propionicus DSM 2379]
 gi|118503267|gb|ABK99749.1| protein of unknown function UPF0005 [Pelobacter propionicus DSM
           2379]
          Length = 232

 Score =  100 bits (248), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 79/223 (35%), Positives = 122/223 (54%), Gaps = 21/223 (9%)

Query: 23  QGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTS 82
                 + +VY  M LGL +T +++ +       +   A + +I  G+M+          
Sbjct: 17  ASQNTLVRQVYAWMGLGLTLTALVALVTISSPGLLGAVAGNRLIFFGLMI---------- 66

Query: 83  PLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTF 142
                     L +   L+  ++ LS  AA ++FL YSAL GL+LS  FLVYT+ SI  TF
Sbjct: 67  --------GELAMVAVLSAAINRLSGSAATLLFLGYSALNGLTLSVIFLVYTADSIGSTF 118

Query: 143 FITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLV 202
            I+A  FG++S+YG+ T RDL   GSF+ MG  G+ + S+VN+F+ S A+    S +G++
Sbjct: 119 LISAGMFGAMSVYGHLTSRDLTSWGSFLFMGLIGIVIASIVNIFLASDAVSWITSGIGVL 178

Query: 203 IFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQ 245
           IF+ LTAYD+ KIK   +         + +++GAL LY+DFI 
Sbjct: 179 IFTGLTAYDSWKIKALAAQG---QTGRKPAILGALTLYLDFIN 218


>gi|21312892|ref|NP_083417.1| hypothetical protein LOC75010 isoform b [Mus musculus]
 gi|12854083|dbj|BAB29920.1| unnamed protein product [Mus musculus]
 gi|109732231|gb|AAI15682.1| RIKEN cDNA 4930511M11 gene [Mus musculus]
 gi|148682667|gb|EDL14614.1| RIKEN cDNA 4930511M11, isoform CRA_c [Mus musculus]
          Length = 302

 Score =   99 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 43/231 (18%), Positives = 88/231 (38%), Gaps = 20/231 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
             ++++V+ ++++ L +T ++  +            A                       
Sbjct: 92  NDFIMKVFVVLSIQLFITAVIIGIFVFCEPVRKWVIAKPWFLYA---------------- 135

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +     + +F+    R       A  ++   ++ L GL L S  + Y ++ I+     T
Sbjct: 136 -LLPAVMILIFVLACCRDIRRQVPANYILLAFFTILEGLLLGSLSVFYRAEEILWAAGAT 194

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
                 L+L+   TK D   +   M +    L +  ++ L +RS  + L  SA+G ++FS
Sbjct: 195 TMVTLVLTLFALQTKWDFTLLNGVMFVFTSVLLIYGIIALVIRSYWLHLVYSALGTLLFS 254

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGS 256
                D Q        RY       + +  AL +Y+D I +F+ +L  +G 
Sbjct: 255 IYLVMDVQM---MVGGRYHYEINPEEYIFAALNIYVDIISLFIFILDLIGR 302


>gi|195392250|ref|XP_002054772.1| GJ22617 [Drosophila virilis]
 gi|194152858|gb|EDW68292.1| GJ22617 [Drosophila virilis]
          Length = 262

 Score =   99 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 49/234 (20%), Positives = 88/234 (37%), Gaps = 20/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++   L VT     L        +  A +  +                   
Sbjct: 49  RGFIRKVYLILMGQLVVTFGAVALFVFSEDAKNFAALNPWLFW----------------- 91

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
                  + +   +             +   L++      L      + +K ++    IT
Sbjct: 92  LAVGVMVVTMIFMICCENVRRETPTNFIFLGLFTVAESFLLGVSASRFAAKEVLLAIGIT 151

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           AA   +L+L+   TK D   +G  +I    G  +  +V +FM    I L  S++G V+FS
Sbjct: 152 AAICLALTLFALQTKYDFTMMGGILIACLMGFLIFGIVAIFMHGKIITLIYSSLGAVLFS 211

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
               YDTQ +       +  A +  + +  +L LY+D I IF+ +L  LG  +D
Sbjct: 212 IYLIYDTQLMM---GGSHKYAISPEEYIFASLNLYLDVINIFMDVLNILGITQD 262


>gi|190571220|ref|YP_001975578.1| hypothetical protein WPa_0820 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018620|ref|ZP_03334428.1| putative membrane protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357492|emb|CAQ54928.1| Putative membrane protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995571|gb|EEB56211.1| putative membrane protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 240

 Score =   99 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 147/246 (59%), Gaps = 25/246 (10%)

Query: 1   MSDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPD 60
           MS ++N Q + + G  + +    GLR+Y+ +VYN MAL LGVTG+++FL           
Sbjct: 1   MSYMKNEQDIRSQGVYYSA----GLRSYLTKVYNYMALALGVTGLVAFLTVFSGL----- 51

Query: 61  AASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSA 120
                         F  +     L  + + +P+ +  +++ RL  LSA +   +F L+S 
Sbjct: 52  --------------FQVIYSNPVLSLVVMLSPVALVFYMSFRLQHLSAQSTLTVFFLFSV 97

Query: 121 LIGLSLSSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLL 180
           L+G+SLS  F++YT+++I + FFIT+  FGS++LYG TTK+DL  +GSF+IMG +GL + 
Sbjct: 98  LMGISLSHIFIIYTAENIARAFFITSIMFGSMALYGNTTKKDLTSMGSFLIMGIWGLIIA 157

Query: 181 SLVNLFMRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVA--YAERQSVIGALM 238
           S+VNLF+ SS +   +S + +++F+ +TAYD Q+IK+ Y    D +     + +++GA  
Sbjct: 158 SIVNLFLGSSPLYFAISFVSVIVFTLMTAYDAQRIKDVYYRYNDGSEVATTKLAILGATN 217

Query: 239 LYMDFI 244
           LY DFI
Sbjct: 218 LYFDFI 223


>gi|321453532|gb|EFX64759.1| hypothetical protein DAPPUDRAFT_265831 [Daphnia pulex]
          Length = 296

 Score =   99 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/182 (19%), Positives = 72/182 (39%), Gaps = 3/182 (1%)

Query: 76  GALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTS 135
            +    S            + + L V +  +S +  +     YS            V  S
Sbjct: 82  FSFSEKSIRMAFVRKVYAILMVQLAVTVGLISLFVYEPNVKSYSRQHPEMCWIALAVTIS 141

Query: 136 KSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLT 195
           + ++    I  A   +L+++   TK D    G  + +    LF+  +V + +    I L 
Sbjct: 142 EDVLIAAGICTAVCLALTIFAMQTKWDFTACGGILFVCVIVLFIFGIVAICIPGKVIRLV 201

Query: 196 MSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
            +++G ++FS    +DTQ         +  + +  + +  AL LY+D I IF+++L  +G
Sbjct: 202 YASLGALLFSVYLVFDTQM---MLGGNHKYSISPEEYIFAALNLYLDIINIFLYILALVG 258

Query: 256 SR 257
             
Sbjct: 259 GS 260


>gi|170017480|ref|YP_001728399.1| integral membrane protein, interacts with FtsH [Leuconostoc citreum
           KM20]
 gi|169804337|gb|ACA82955.1| Integral membrane protein, interacts with FtsH [Leuconostoc citreum
           KM20]
          Length = 239

 Score =   99 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 68/249 (27%), Positives = 115/249 (46%), Gaps = 17/249 (6%)

Query: 7   YQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIII 66
                 +     + +D G+RA+  + Y+ M L + VT +  F+V                
Sbjct: 1   MDNFNFNTRRDVTGMDAGMRAFFKQTYSFMGLAVLVTAVTGFIVQK-------------- 46

Query: 67  NRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSL 126
                L    AL+  + +  + +     + I +  R    +   A  + + ++ + GL++
Sbjct: 47  ---FFLAQVYALIAGNLIGTLALLGIQLLIITMIGRATFKNPARAFGLLMAFAVVEGLTV 103

Query: 127 SSFFLVYTSKSIVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLF 186
                +YT  SI+  F   AA FG ++LYG  TKRDL  +G  +     GLF+  L+N+F
Sbjct: 104 GLLLAIYTGASIMMAFVSAAAVFGGMALYGVFTKRDLSGMGGALFGMLIGLFVAMLINMF 163

Query: 187 MRSSAIDLTMSAMGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQI 246
             +  + L +S + +++FS  TAYD Q +K  YS     A     ++ GAL LY+DFI +
Sbjct: 164 FPNGIVSLLISFVSVIVFSLYTAYDNQSLKVMYSQFAGQADTTGLAINGALRLYLDFINL 223

Query: 247 FVHLLRFLG 255
           F  L+R  G
Sbjct: 224 FFALVRIFG 232


>gi|197127172|gb|ACH43670.1| putative transmembrane BAX inhibitor motif containing 4 variant 1
           [Taeniopygia guttata]
          Length = 237

 Score =   99 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 90/228 (39%), Gaps = 28/228 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY+++++ + +T + S +                +           ++  +    
Sbjct: 32  AFLRKVYSILSVQVLLTTVTSAIFLYSTGVQAFVHERPALLLISGFGSLAVIVALT---- 87

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                           L+         +   ++ L  L+++     Y    ++Q F +T 
Sbjct: 88  ----------------LYRHQHPVNLYLLFGFTLLEALTVAITVSFYDVAIVLQAFILTT 131

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
           + F  L+ Y   +KRD    G+ +    + L   S + LF  S  I+L  +A G ++F  
Sbjct: 132 SVFLGLTAYTLQSKRDFSKFGAGLFACLWILIFSSFLRLFFYSETIELVFAAAGALLFCG 191

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
              YDT  +            +  + ++ A+ LY+D I +F+HLLRFL
Sbjct: 192 FIIYDTHLLMHK--------LSPEEYILAAINLYLDIINLFLHLLRFL 231


>gi|224093989|ref|XP_002188958.1| PREDICTED: similar to putative transmembrane BAX inhibitor motif
           containing 4 [Taeniopygia guttata]
          Length = 237

 Score =   99 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 90/228 (39%), Gaps = 28/228 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
           A++ +VY+++++ + +T + S +                +           ++  +    
Sbjct: 32  AFLRKVYSILSVQVLLTTVTSAIFLYSTGVQAFVHERPALLLISGFGSLAVIVALT---- 87

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                           L+         +   ++ L  L+++     Y    ++Q F +T 
Sbjct: 88  ----------------LYRHQHPVNLYLLFGFTLLEALTVAITVSFYDVAIVLQAFILTT 131

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSA 206
           + F  L+ Y   +KRD    G+ +    + L   S + LF  S  I+L  +A G ++F  
Sbjct: 132 SVFLGLTAYTLQSKRDFSKFGAGLFACLWILIFSSFLRLFFYSETIELVFAAAGALLFCG 191

Query: 207 LTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
              YDT  +            +  + ++ A+ LY+D I +F+HLLRFL
Sbjct: 192 FIIYDTHLLMHK--------LSPEEYILAAINLYLDIINLFLHLLRFL 231


>gi|325119401|emb|CBZ54954.1| Os03g0795800 protein, related [Neospora caninum Liverpool]
          Length = 265

 Score =   99 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 50/234 (21%), Positives = 99/234 (42%), Gaps = 21/234 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           + ++ +VY ++AL L  T  ++ L       VDP  A  + +   ++   G ++  + + 
Sbjct: 51  QGFIRKVYTIIALQLITTAAVTALFL----FVDPVRAWFLTHGQPVIIAAGVVLLVTSIP 106

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +                 S       ++  +++    + +++    Y+ K+++     T
Sbjct: 107 LVCCEGA------------SRRFPFNYLLLCVFTLAESVLVAAVTAHYSEKTVLIAVAGT 154

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A     LSL+    K D       + + A  L +  L  +F+      +  S++ L++FS
Sbjct: 155 AVITVGLSLFACQVKYDFTSWVGVLFIFALNLMIFGLFCIFLP-KWAQVLYSSLALLLFS 213

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ I      R  +  +E   ++ ALM+Y+D I IF+HLLR + S  D
Sbjct: 214 IYLVVDTQLIV----GRGKLRLSEDDYIVAALMIYVDIITIFLHLLRLVASATD 263


>gi|309786560|ref|ZP_07681183.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|308925623|gb|EFP71107.1| conserved hypothetical protein [Shigella dysenteriae 1617]
          Length = 183

 Score = 99.5 bits (246), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 81/183 (44%), Positives = 115/183 (62%), Gaps = 2/183 (1%)

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           +          I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ S
Sbjct: 1   MFTNRVFLIGLIIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAAS 60

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           I  TF +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++
Sbjct: 61  IASTFVVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVT 120

Query: 198 AMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
            +G+++F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G
Sbjct: 121 YIGVIVFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFG 180

Query: 256 SRR 258
           +RR
Sbjct: 181 NRR 183


>gi|255955859|ref|XP_002568682.1| Pc21g16820 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211590393|emb|CAP96579.1| Pc21g16820 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 273

 Score = 99.5 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 42/234 (17%), Positives = 89/234 (38%), Gaps = 29/234 (12%)

Query: 27  AYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRW 86
            ++ +VY+++   L +T I+S +     +      ++  +    +    G ++ T     
Sbjct: 66  QFVRKVYSILTAQLLLTTILSSISFFNDSYRTWIQSNFWLMIISVFGALGFMLAT----- 120

Query: 87  IFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITA 146
                               S  A  +    ++ L   S+S     Y ++ +VQ   +T 
Sbjct: 121 ---------------FWKRKSYPANLLFLSGFTILEAYSISVATSFYDARVVVQALALTL 165

Query: 147 ASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLV-NLFMRSSAIDLTMSAMGLVIFS 205
             F +L+L+   TK D      ++    + + L   V      +S I++    +G +IFS
Sbjct: 166 GIFVALTLFACQTKYDFTDWMPYLFGALWFMILFGFVAMFIPFNSTIEIIYGVLGALIFS 225

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRRD 259
                DTQ +   Y    +        +  ++ LY+D + +F+ +LR L    +
Sbjct: 226 GYILVDTQLVMRHYHVEEE--------IAASISLYLDVLNLFMSILRILNGANN 271


>gi|195026779|ref|XP_001986333.1| GH21301 [Drosophila grimshawi]
 gi|193902333|gb|EDW01200.1| GH21301 [Drosophila grimshawi]
          Length = 291

 Score = 99.5 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 50/238 (21%), Positives = 92/238 (38%), Gaps = 21/238 (8%)

Query: 22  DQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           DQ LR  ++ +VY ++   L VT  + ++      T +    +  +    ++        
Sbjct: 69  DQSLRKGFIRKVYLILLAQLVVTFGVIYIFMYHEPTNNFVQENPRVVNVAIVINI----- 123

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
                       + +F          +     +   L++  + L L     +  S  +++
Sbjct: 124 ------------VVLFSMAYCETARRTFPINFVCLGLFTVTMSLLLGVVAGILDSVVMLE 171

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              ITAA    LS++   TK       + ++     L +LS+   F+R S  D+ +S +G
Sbjct: 172 AVAITAALVVGLSIFAIQTKYGFNCCRAVLVSVVICLLVLSISASFVRESFNDIALSCLG 231

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSRR 258
            ++   L  YDTQ I       +         +  AL LYM  ++IFV +LR L   R
Sbjct: 232 AILACFLLIYDTQLII---GGNHKYQINPEDYIFAALTLYMGIVRIFVCILRPLARGR 286


>gi|194900699|ref|XP_001979893.1| GG21447 [Drosophila erecta]
 gi|190651596|gb|EDV48851.1| GG21447 [Drosophila erecta]
          Length = 264

 Score = 99.5 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 87/232 (37%), Gaps = 20/232 (8%)

Query: 26  RAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLR 85
           R ++ +VY ++   L  + ++   + +        A S  +    +L    +L+  S   
Sbjct: 52  RGFIRKVYLILLAQLITSLVVIVALTVDRQVRLMVADSTWMFLVAILIVVFSLVALSCNE 111

Query: 86  WIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFIT 145
            +                      A  +    ++      L      Y    I  +  IT
Sbjct: 112 DLR-----------------RQTPANLLFLAAFTIAESFLLGVVACRYAPMEIFMSVLIT 154

Query: 146 AASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFS 205
           A+    LSL+   T+ D   +G  ++     L L   V+L +    +    +++  ++FS
Sbjct: 155 ASVCLGLSLFALQTRYDFTVLGGILVSCLIILLLFGTVSLLVGGHMVTTIYASLSALLFS 214

Query: 206 ALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
               +DTQ +      ++  + +  + +  AL +YMD + IF+ +L+ LG  
Sbjct: 215 IYLVHDTQLMM---GGKHRYSISPEEYIFAALNIYMDVMNIFLEILQLLGGS 263


>gi|116627182|ref|YP_819801.1| integral membrane protein, interacts with FtsH [Streptococcus
           thermophilus LMD-9]
 gi|116100459|gb|ABJ65605.1| Integral membrane protein, interacts with FtsH [Streptococcus
           thermophilus LMD-9]
          Length = 229

 Score = 99.5 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 69/239 (28%), Positives = 117/239 (48%), Gaps = 18/239 (7%)

Query: 19  STIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGAL 78
           +T D GL  +  ++Y L+ +G+G++ ++S+L+                    +   F  +
Sbjct: 8   TTSDAGLNRFFGKIYGLVGIGVGLSAVISYLMLF-----------------PLSHLFVNI 50

Query: 79  MYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSI 138
           +      ++         +FL       +  AA  +FL+YSAL G +LS   + YT   +
Sbjct: 51  LMNYSWIYMAAIFVELALVFLASGAARRNTPAALPLFLVYSALNGFTLSFIIVQYTQAIV 110

Query: 139 VQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSA 198
            Q F  TA  F  ++L G + KRDL  +  F++    G+ + SLVN+F  SS +   +S 
Sbjct: 111 FQAFLSTAIVFFVMALIGVSIKRDLSGMVKFLMAALIGIIVASLVNIFFASSTMSFVISI 170

Query: 199 MGLVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLGSR 257
           + ++IFS L AYD Q IK+ Y         +  ++  AL LY+DFI +F+++LR    R
Sbjct: 171 VSVLIFSGLIAYDNQLIKKVYYSTNGQ-VTDGWAISMALSLYLDFINLFLNILRIFARR 228


>gi|82776141|ref|YP_402488.1| hypothetical protein SDY_0817 [Shigella dysenteriae Sd197]
 gi|81240289|gb|ABB60999.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
          Length = 184

 Score = 99.5 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 81/183 (44%), Positives = 115/183 (62%), Gaps = 2/183 (1%)

Query: 78  LMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKS 137
           +          I A L + I L+  +  LSA    M+F+LYSAL GL+LSS F+VYT+ S
Sbjct: 1   MFTNRVFLIGLIIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIFIVYTAAS 60

Query: 138 IVQTFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMS 197
           I  TF +TA  FG++SLYGYTTKRDL   G+ + M   G+ L SLVN +++S A+   ++
Sbjct: 61  IASTFVVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKSEALMWAVT 120

Query: 198 AMGLVIFSALTAYDTQKIKEAYSD--RYDVAYAERQSVIGALMLYMDFIQIFVHLLRFLG 255
            +G+++F  LTAYDTQK+K         D +   + S++GAL LY+DFI +F+ LLR  G
Sbjct: 121 YIGVIVFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLMLLRIFG 180

Query: 256 SRR 258
           +RR
Sbjct: 181 NRR 183


>gi|198459730|ref|XP_002138731.1| GA24238 [Drosophila pseudoobscura pseudoobscura]
 gi|198136789|gb|EDY69289.1| GA24238 [Drosophila pseudoobscura pseudoobscura]
          Length = 303

 Score = 99.5 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 93/234 (39%), Gaps = 21/234 (8%)

Query: 22  DQGLRA-YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMY 80
           DQ +R  ++ +VY+++ + L  T     L      T      + ++     +     L+ 
Sbjct: 86  DQTIRKGFIRKVYSILLVQLLFTCGTIGLFLYHEPTKMFVQKNPVVLIVAAVLNIIVLIM 145

Query: 81  TSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQ 140
              +  +                   +     +   +++  + L L     V  +  ++ 
Sbjct: 146 IVCIEGVR-----------------RAHPTNLVCLGIFTVTMSLMLGCVSSVMNANLVLI 188

Query: 141 TFFITAASFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMG 200
              +TA     LS+Y   TK D   +G  ++     + +  L N+ M S   ++ MS++ 
Sbjct: 189 AVGVTAFLVIGLSVYAIQTKVDYTAMGGVLVTFVMCIIIFGLSNMLMPSLTENIVMSSLM 248

Query: 201 LVIFSALTAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
            +I      YDTQ+I       ++  ++  + V  AL LY+D ++I V++LR L
Sbjct: 249 AIIACFFLIYDTQQIV---GGNHEYQFSPEEYVFAALTLYVDVVRILVYILRIL 299


>gi|147899637|ref|NP_001089282.1| transmembrane BAX inhibitor motif containing 4 [Xenopus laevis]
 gi|58701947|gb|AAH90219.1| MGC85171 protein [Xenopus laevis]
          Length = 235

 Score = 99.2 bits (245), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 42/227 (18%), Positives = 95/227 (41%), Gaps = 28/227 (12%)

Query: 28  YMIRVYNLMALGLGVTGIMSFLVNILATTVDPDAASIIINRGVMLTGFGALMYTSPLRWI 87
           ++ +VY+++ + + +T + + L     +       S  +    ++   G ++  +     
Sbjct: 31  FLKKVYSILTVQVLLTTLTAALFLYSKSIQTFVHESPALLLISVIGSLGTVIALT----- 85

Query: 88  FIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSALIGLSLSSFFLVYTSKSIVQTFFITAA 147
                          ++         + L ++    ++++     Y    ++Q F +T A
Sbjct: 86  ---------------IYRQQYPVNLYLLLAFTVFESVTVAIAVTFYDVAVVLQAFILTTA 130

Query: 148 SFGSLSLYGYTTKRDLGPIGSFMIMGAFGLFLLSLVNLFMRSSAIDLTMSAMGLVIFSAL 207
            F  L+ + + +KRD    G+ +    + L   SL+ LF  S  ++L M+A G ++F   
Sbjct: 131 VFLGLTAFTFQSKRDFSKFGAGLFTCLWILIFASLLRLFFYSETVELVMAAAGALLFCGF 190

Query: 208 TAYDTQKIKEAYSDRYDVAYAERQSVIGALMLYMDFIQIFVHLLRFL 254
             YDT  +            +  + ++ ++ LY+D I +F+HLLR L
Sbjct: 191 IIYDTHILMHK--------LSPEEYILASVNLYLDIINLFLHLLRIL 229


>gi|332372766|gb|AEE61525.1| unknown [Dendroctonus ponderosae]
          Length = 288

 Score = 99.2 bits (245), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 39/253 (15%), Positives = 95/253 (37%), Gaps = 31/253 (12%)

Query: 2   SDIRNYQRVVNSGSGFGSTIDQGLRAYMIRVYNLMALGLGVTGIMSFLVNILATTVDPDA 61
           +DI N     N+ +    +I     A++ +VY L+ + + +T  ++ +            
Sbjct: 61  NDIENDFAYRNNVAQATKSIRL---AFLRKVYGLLTMQILLTVTIAAIFMFTPPIKVFVQ 117

Query: 62  ASIIINRGVMLTGFGALMYTSPLRWIFIFAPLGVFIFLNVRLHSLSAYAAKMMFLLYSAL 121
            +  +           L+                       +    +    ++   ++ +
Sbjct: 118 TNDWMMMISFFASIIL