HHsearch alignment for GI: 254780453 and conserved domain: PRK02615

>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional.
Probab=91.82  E-value=0.16  Score=30.27  Aligned_cols=64  Identities=22%  Similarity=0.349  Sum_probs=43.8

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHH--HHHHHHHHCCCCEEEEECCCCCCCCCCCCCEECCHHHHHHCCCCEEEECCHHC
Q ss_conf             76544542110244311134103--44554420244035510113578657984003698999965998999985330
Q gi|254780453|r  143 MVRMRAVQARDIGMGGIVCSPQE--VRMVREIVGHNMVIVTPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIV  218 (238)
Q Consensus       143 ~v~~~a~~a~~~g~~GvV~s~~e--i~~ir~~~~~~~~~itPGI~~~~~~~~dq~r~~tp~~Ai~~GaD~iVVGR~I~  218 (238)
T Consensus       203 IINDrvDlAlav~ADGVHLGQ~Dlpi~~aR~llG~~~iI---G~S~h--~~------ee~~~A~~~gaDYig~G-pvf  268 (345)
T PRK02615        203 IVNDRVDIALAVDADGVHLGQEDLPLAVARQLLGPEKII---GRSTT--NP------EELAKAIAEGADYIGVG-PVF  268 (345)
T ss_pred             EEECCHHHHHHCCCCEEEECCCCCCHHHHHHHCCCCCEE---EECCC--CH------HHHHHHHHCCCCEEEEC-CEE
T ss_conf             981969999974998775588878999999873999189---96179--99------99999986399979988-774