HHsearch alignment for GI: 254780453 and conserved domain: PRK13132

>PRK13132 consensus.
Probab=97.11  E-value=0.028  Score=35.18  Aligned_cols=180  Identities=16%  Similarity=0.237  Sum_probs=96.8

Q ss_pred             EEEECCCHHHHHHHHHHH-CCCCCEEEECHHHHHC--CCHHHHHHHH---HHCH---HHHH---HHHHCCHH-------H
Q ss_conf             996079989999999973-8852289986899842--5589999998---5154---6678---77640424-------6
Q gi|254780453|r   17 VGLDLPTVKEAERIVSIL-SDTVSFYKIGYHLSFS--GGLELARDLI---SDGK---SVFL---DMKLFDIG-------S   77 (238)
Q Consensus        17 vALD~~~~~e~l~l~~~l-~~~i~~iKig~~l~~~--~G~~~i~~l~---k~~~---~If~---D~K~~DIp-------n   77 (238)
T Consensus        17 itaG~P~~e~s~~~~~~l~~~GaDiiEiGiPfSDP~aDGPvIq~A~~~AL~~G~~~~~~~~~~~~ir-~~~pivlM~Y~N   95 (246)
T PRK13132         17 IVAGYPNLETTKEFLQRLDESPLDILELGIPYSDPLADGKLIADASFIALQQGVNTDTVFELLARVK-TKKALVFLVYYN   95 (246)
T ss_pred             EECCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHC-CCCCEEEEEECH
T ss_conf             8285899899999999999749998997898888765589999999999877998999999999753-699979996010


Q ss_pred             HHH-----HHHHHHCCCCCEEEEEECCC-HHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             789-----87765215675089972460-467777653023553104666414777688765201210488765445421
Q gi|254780453|r   78 SVT-----AAIEHIANMGVAMLTVHAYP-QTMRSAVSVVRDTGICLLAVTVLTSMDDFDLRESGYEKDISDMVRMRAVQA  151 (238)
Q Consensus        78 Tv~-----~~v~~~~~~g~d~iTvH~~~-~~l~~~~~~~~~~~~~il~Vt~LTS~~~~~l~~~g~~~~~~~~v~~~a~~a  151 (238)
T Consensus        96 ~i~~~G~e~F~~~~~~~GvdGlIipDLP~ee~~~~~~~~~~~~i~~I~lvaPTs--~~R~~~i~~~------s~gfiY~v  167 (246)
T PRK13132         96 LIFAYGLEKFVKKAKELGISGLIVPDLPFEESEELIKECEKYNIALIPLISVTS--PKRAKKILKH------AKGFIYAL  167 (246)
T ss_pred             HHHHCCHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCC--HHHHHHHHHC------CCCCEEEE
T ss_conf             887729999999998769985775799978989999999985997014425797--8999999954------89827997


Q ss_pred             HHCCCCCCCCC-----CHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCEECCHHH--HHHCCCCEEEECCHHCC
Q ss_conf             10244311134-----1034455442024403551011357865798400369899--99659989999853308
Q gi|254780453|r  152 RDIGMGGIVCS-----PQEVRMVREIVGHNMVIVTPGIRMLGSATDGQKRFATPET--ALKYGASHIVVSRPIVR  219 (238)
Q Consensus       152 ~~~g~~GvV~s-----~~ei~~ir~~~~~~~~~itPGI~~~~~~~~dq~r~~tp~~--Ai~~GaD~iVVGR~I~~  219 (238)
T Consensus       168 s~~GvTG~~~~~~~~~~~~i~~ik~~t-~~Pv~--vGFGI~-----------~~e~v~~~~~~aDGvIVGSa~v~  228 (246)
T PRK13132        168 GSIGVTGTKSVEEARLKDKVKEIKSFT-DLPVA--VGFGIK-----------NNQDVKRMRKYADGVIVGTSIVK  228 (246)
T ss_pred             ECCCCCCCCCCCHHHHHHHHHHHHHCC-CCCEE--EECCCC-----------CHHHHHHHHHCCCEEEECHHHHH
T ss_conf             535677776663688999999999628-99869--977989-----------99999999822999997099999