PSIBLAST alignment of GI: 254780453 and protein with PDB id: 3li0

>gi|298508494|pdb|3LI0|A Chain A, Crystal Structure Of The Mutant R203a Of Orotidine 5'-Monoph Decarboxylase From Methanobacterium Thermoautotrophicum Com With Inhibitor Bmp Length = 228
>gi|298508495|pdb|3LI0|B Chain B, Crystal Structure Of The Mutant R203a Of Orotidine 5'-Monoph Decarboxylase From Methanobacterium Thermoautotrophicum Com With Inhibitor Bmp Length = 228
 Score =  104 bits (258), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 51/240 (21%), Positives = 100/240 (41%), Gaps = 18/240 (7%)

Query: 1   MDAGLIIDVDEKKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDL- 59
           M +  +  +D   RL++ +DL    +A R+   + + +   KIGY L  S G+++  +  
Sbjct: 1   MRSRRVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFR 60

Query: 60  ISDGKSVFLDMKLFDIGSSVTAAIEHIANMGVAMLTVHAYP--QTMRSAVSVVRDTGICL 117
              G  +  D K+ DI  +           G   + VH +P   ++R+ ++V  + G  +
Sbjct: 61  KRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREV 120

Query: 118 LAVTVLTSMDDFDLRESGYEKDISDMVRMRAVQARDIGMGGIVCSPQEVRMVREIVGHNM 177
             +T ++        E   +    ++ RM           G    P+ +  +REI+G + 
Sbjct: 121 FLLTEMSHPGA----EMFIQGAADEIARMGVDLG-VKNYVGPSTRPERLSRLREIIGQDS 175

Query: 178 VIVTPGIRMLGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAISLI 237
            +++PG+   G           P   L++ A  I+V   I  A +P +AA     +I  +
Sbjct: 176 FLISPGVGAQGGD---------PGETLRF-ADAIIVGASIYLADNPAAAAAGIIESIKDL 225