RPSBLAST alignment for GI: 254780453 and conserved domain: PRK13813

>gnl|CDD|184343 PRK13813, PRK13813, orotidine 5'-phosphate decarboxylase; Provisional. Length = 215
 Score =  114 bits (288), Expect = 2e-26
 Identities = 57/231 (24%), Positives = 99/231 (42%), Gaps = 23/231 (9%)

Query: 12  KKRLVVGLDLPTVKEAERIVSILSDTVSFYKIGYHLSFSGGLELARDLISDGKSVFLDMK 71
             R+++ LD+   + A +I   L D V   K+G+ L  + GL +  +L      V  D+K
Sbjct: 3   DSRIILALDVTDRERALKIAEELDDYVDAIKVGWPLVLASGLGIIEELKRYAP-VIADLK 61

Query: 72  LFDIGSSVTAAIEHIANMGVAMLTVHAYP--QTMRSAVSVVRDTGICLLAVTVLTSMDDF 129
           + DI ++     E +   G   + VH +    ++++ V    ++G  +  V  ++     
Sbjct: 62  VADIPNTNRLICEAVFEAGAWGIIVHGFTGRDSLKAVVEAAAESGGKVFVVVEMS----- 116

Query: 130 DLRESGYEKDISDMVRMRAVQARDIGMGGIVCS---PQEVRMVREIVGHNMVIVTPGIRM 186
                G  + I       A  A++ G  G+V     P+ VR +R  +G  + I++PGI  
Sbjct: 117 ---HPGALEFIQPHADKLAKLAQEAGAFGVVAPATRPERVRYIRSRLGDELKIISPGIGA 173

Query: 187 LGSATDGQKRFATPETALKYGASHIVVSRPIVRAADPVSAAQEFQRAISLI 237
            G              A+K GA +++V R I  AADP  AA+     I   
Sbjct: 174 QG---------GKAADAIKAGADYVIVGRSIYNAADPREAAKAINEEIRGA 215