HHsearch alignment for GI: 254780454 and conserved domain: PRK05643

>PRK05643 DNA polymerase III subunit beta; Validated.
Probab=99.65  E-value=4.6e-14  Score=104.32  Aligned_cols=199  Identities=17%  Similarity=0.258  Sum_probs=78.3

Q ss_pred             EECCCHHHHHHHCCEEEECCCCCCCCCEEEEEEEECCCCCEEEEEEECCEEEEEEEEECCCCCCCCCHHCCCCCHHHHHH
Q ss_conf             50561135542022023002455652101166776178734899985341576666435787533100000100012222
Q gi|254780454|r  130 FELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEIL  209 (385)
Q Consensus       130 ~~i~~~~l~~~i~~t~~a~s~d~~r~~L~Gv~~~~~~~~~~l~~vaTDg~RLa~~~~~~~~~~~~~~~~iiP~k~l~el~  209 (385)
T Consensus         3 ~~i~k~~L~~~l~~v~~~i~~k~~~piL~~ill~~~~~--~l~l~atd~e~~i~~~i~~~-~i~~~G~~~v~ak~l~~iv   79 (365)
T PRK05643          3 FTIERNALLKALQLVQRAVERRNTIPILSNILIEADEG--GLSLTGTDLEIGIETKIPAA-EVEEEGAITVPAKKFLDIV   79 (365)
T ss_pred             EEEEHHHHHHHHHHHHHHCCCCCCHHHHCCEEEEEECC--EEEEEEECCCEEEEEEEECC-EECCCEEEEEEHHHHHHHH
T ss_conf             99989999999999875528898628876879999899--99999988855999999741-4445549999779989899


Q ss_pred             HHCCCCCCCCCCCCCCCCEEEECCEEEEEEEECC-CCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCC-CCCC---
Q ss_conf             1027764643313345530100250699985126-6553221013555661799848998888988741012-3555---
Q gi|254780454|r  210 RILSSKDSSVKVSLSESRIHLNIESLSMSVRLID-GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSS-VRIQ---  284 (385)
Q Consensus       210 k~l~~~~~~v~i~~~~~~i~~~~~~~~~~srLi~-g~yPdy~~vip~~~~~~~~v~r~~l~~al~Rv~i~~~-~~~~---  284 (385)
T Consensus        80 k~lp~--~~i~l~~~~~~l~I~~~~~~f~l~~~~~~dfP~~~~~---~~~~~~~i~~~~l~~~i~~v~~a~s~de~r~~L  154 (365)
T PRK05643         80 RKLPD--SEITLELEGNRLTIKSGRSRFNLQTLPAEDFPELPEI---EEEVSFSLPQKTLKRLIKKTQFAISTQETRYYL  154 (365)
T ss_pred             HHCCC--CCEEEEECCCEEEEEECCEEEEEECCCHHHCCCCCCC---CCCCEEEECHHHHHHHHHHHHEECCCCCCCCEE
T ss_conf             63899--8459997499899997877999976897998898667---887179997999999997454000455672013


Q ss_pred             -CCEEEEECCEEEEEECCCCCEEEEEEEEEEECCCCEEEEECHHHHHHHHHHCC
Q ss_conf             -30256517659999807873268999998962884399963889988987357
Q gi|254780454|r  285 -AVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYLLEIIDNIS  337 (385)
Q Consensus       285 -~i~l~~~~~~l~i~~~~~e~g~~~e~i~~~~~G~~~~i~fN~~yl~d~L~~~~  337 (385)
T Consensus       155 ~Gv~~~~~~~~l~~vATDg-~RLa~~~~~~~~~~~~~~~iiP~K~l~el~kll~  207 (365)
T PRK05643        155 NGVLLEIKGNELRAVATDG-HRLAVRSLELEGTEEMFSVIIPRKTLLELQKLLD  207 (365)
T ss_pred             EEEEEEEECCEEEEEEECC-CEEEEEECCCCCCCCCCEEEEEHHHHHHHHHHHC
T ss_conf             2599999699999999643-3124676135677765048988799999998717