HHsearch alignment for GI: 254780454 and conserved domain: PRK07761

>PRK07761 DNA polymerase III subunit beta; Validated.
Probab=99.60  E-value=2.1e-13  Score=100.31  Aligned_cols=209  Identities=16%  Similarity=0.248  Sum_probs=113.7

Q ss_pred             EEECCCHHHHHHHCCEEEECCCCCCCCCEEEEEEEECCCCCEEEEEEECCEEEEEEEEECCCCCCCCCHHCCCCCHHHHH
Q ss_conf             45056113554202202300245565210116677617873489998534157666643578753310000010001222
Q gi|254780454|r  129 SFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEI  208 (385)
Q Consensus       129 ~~~i~~~~l~~~i~~t~~a~s~d~~r~~L~Gv~~~~~~~~~~l~~vaTDg~RLa~~~~~~~~~~~~~~~~iiP~k~l~el  208 (385)
T Consensus         2 kf~i~k~~L~~~L~~v~~~v~~k~~~piL~~vliea~~~--~l~l~atd~ei~i~~~i~~--~i~e~G~~~vpak~l~~i   77 (376)
T PRK07761          2 KFRVERDDLADAVAWVARSLPARPPVPVLAGVLLEADDE--GLTLSGFDYEVSARVRVSA--EVDEPGRVLVSGRLLADI   77 (376)
T ss_pred             EEEEEHHHHHHHHHHHHHHCCCCCCHHHHCCEEEEEECC--EEEEEEECCCEEEEEEEEE--EECCCEEEEEEHHHHHHH
T ss_conf             799999999999999986617898728877889999899--9999997782799999976--871571899977999999


Q ss_pred             HHHCCCCCCCCCCCCCCCCEEEECCEEEEEEEECC-CCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCC-CCC---
Q ss_conf             21027764643313345530100250699985126-6553221013555661799848998888988741012-355---
Q gi|254780454|r  209 LRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID-GEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSS-VRI---  283 (385)
Q Consensus       209 ~k~l~~~~~~v~i~~~~~~i~~~~~~~~~~srLi~-g~yPdy~~vip~~~~~~~~v~r~~l~~al~Rv~i~~~-~~~---  283 (385)
T Consensus        78 vk~lp~--~~I~l~~e~~~l~I~~g~~~f~l~~~~~~dfP~~~~~----~~~~~~i~~~~l~~~i~~t~fa~s~~e~r~~  151 (376)
T PRK07761         78 TRALPN--KPVEFSVDGSRVTLTCGSARFTLPTMPVEDYPTLPQL----PEETGTVPAELFAEAVSQVAVAAGRDDTLPM  151 (376)
T ss_pred             HHHCCC--CCEEEEECCCEEEEEECCEEEEEECCCHHHCCCCCCC----CCCCEEECHHHHHHHHHHEEEEECCCCCHHH
T ss_conf             974777--6327997199999998977999634686878666788----7631589899999998437587317478477


Q ss_pred             -CCCEEEEECCEEEEEECCCCCEEEEEEEEEEE--CCCCEEEEECHHHHHHHHHHCCCCCCCCCEEEEEECC
Q ss_conf             -53025651765999980787326899999896--2884399963889988987357533466338999658
Q gi|254780454|r  284 -QAVKLSLSSDKLCMTVDNPDMGKAIESMNVYY--NECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDS  352 (385)
Q Consensus       284 -~~i~l~~~~~~l~i~~~~~e~g~~~e~i~~~~--~G~~~~i~fN~~yl~d~L~~~~~~~~~~e~i~l~~~~  352 (385)
T Consensus       152 L~Gv~~~~~~~~l~~vATDg-hRLa~~~~~~~~~~~~~~~~~iIP~k~l~el~k~l~~~----~~v~l~~~~  218 (376)
T PRK07761        152 LTGIRLEIEGETVVLAATDR-FRLAVRELTWSPGSPDIDAAALVPAKTLAEAAKALTLG----SEVRLALGT  218 (376)
T ss_pred             HCCEEEEEECCEEEEEEECC-CCEEEEEECCCCCCCCCCCCEEECHHHHHHHHHHCCCC----CCEEEEEEC
T ss_conf             37389998499899999753-21013663246667776543571089999999753889----848999966