HHsearch alignment for GI: 254780454 and conserved domain: PTZ00113

>PTZ00113 proliferating cell nuclear antigen (cyclin); Provisional.
Probab=98.95  E-value=1.4e-06  Score=58.89  Aligned_cols=207  Identities=20%  Similarity=0.296  Sum_probs=140.3

Q ss_pred             CCHHHHHHHCCEEEECCCCCCCCCEEEEEEEECCCCCEEEEEEECCEEEEEEEEECCCCCCCC------CHHCCCCCHHH
Q ss_conf             611355420220230024556521011667761787348999853415766664357875331------00000100012
Q gi|254780454|r  133 ASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQIAKM------PSIIVPRKAVG  206 (385)
Q Consensus       133 ~~~~l~~~i~~t~~a~s~d~~r~~L~Gv~~~~~~~~~~l~~vaTDg~RLa~~~~~~~~~~~~~------~~~iiP~k~l~  206 (385)
T Consensus         8 ~a~~~k~i~e---------~lk~lv~e~~~~~~~~G--i~iqamD~shVaLv~l~L~~~~F~~Y~~~~~~~iGvn~~~l~   76 (277)
T PTZ00113          8 NAVVLRRIFD---------CIRDLINDGNIDFDATG--MKLQALDGNHVALVHLKLHESGFSLYRCDRPRALGININSVT   76 (277)
T ss_pred             CHHHHHHHHH---------HHHHHHCEEEEEECCCE--EEEEEECCCCEEEEEEEECHHHCEEEECCCCEEEEEEHHHHH
T ss_conf             5689999999---------99986451789995885--799998678489999998964381995599869989889999


Q ss_pred             HHHHHCCCCCCCCCCCCCC--CCEEEECCE------EEEEEEECCCCCCCCCCCCCC-C--CCCEEEEEHHHHHHHHHHH
Q ss_conf             2221027764643313345--530100250------699985126655322101355-5--6617998489988889887
Q gi|254780454|r  207 EILRILSSKDSSVKVSLSE--SRIHLNIES------LSMSVRLIDGEFPNYQNVIPC-S--NDKELRVNCTNLRQAVDRV  275 (385)
Q Consensus       207 el~k~l~~~~~~v~i~~~~--~~i~~~~~~------~~~~srLi~g~yPdy~~vip~-~--~~~~~~v~r~~l~~al~Rv  275 (385)
T Consensus        77 kiLk~~~~-~d~l~l~~~~~~~~l~i~~~~~~~~~~~~f~l~L~did~e~l~--IPe~e~~~~~~i~m~S~~f~~~ikdl  153 (277)
T PTZ00113         77 KAFKSCGN-NDSVLIQSEEDKDNINFVFENNVEDRVTSFSLKLMSIEQDALS--IPENTEGFDAEITLSSKELTNICKQM  153 (277)
T ss_pred             HHHHHCCC-CCEEEEEEECCCCEEEEEEECCCCCEEEEEEEEECCCCCCCCC--CCCCCCCCCEEEEECHHHHHHHHHHH
T ss_conf             99862569-9769999807998799999758863588999986136754567--99987654289998199999999999


Q ss_pred             HHCCCCCCCCCEEEEECCEEEEEECCCCCEEEEEEEE-----------EEE-CCCCEEEEECHHHHHHHHHHCCCCCCCC
Q ss_conf             4101235553025651765999980787326899999-----------896-2884399963889988987357533466
Q gi|254780454|r  276 SIMSSVRIQAVKLSLSSDKLCMTVDNPDMGKAIESMN-----------VYY-NECPMDICFNYKYLLEIIDNISSDEVVD  343 (385)
Q Consensus       276 ~i~~~~~~~~i~l~~~~~~l~i~~~~~e~g~~~e~i~-----------~~~-~G~~~~i~fN~~yl~d~L~~~~~~~~~~  343 (385)
T Consensus       154 ~~~~d~----I~i~~~~~~~~~~~~G-d~g~~~~~~~~~~~~~e~~~~~~i~~~~~~~~~ysl~YL~~f~K~~~l----s  224 (277)
T PTZ00113        154 NEFSDT----VKIDISSNSIKFTTKG-DLGDGEIVLKNRAPTSEDDCGVTIKVKKPIKQSYATKYLLMFSKSGCL----S  224 (277)
T ss_pred             HHCCCE----EEEEEECCEEEEEEEE-CCCEEEEEEECCCCCCCCCCEEEEECCCCEEEEEEHHHHHHHHCCCCC----C
T ss_conf             862988----9999959989999980-375289999527887886530689738836889848998865370567----8


Q ss_pred             CEEEEEECCCCCCEEEECCC
Q ss_conf             33899965898758994377
Q gi|254780454|r  344 DEVVFRLDSSNSSVFIRGKD  363 (385)
Q Consensus       344 e~i~l~~~~~~~p~~i~~~~  363 (385)
T Consensus       225 ~~V~i~~~-~d~Pl~l~y~l  243 (277)
T PTZ00113        225 DVVTLGLS-QNRPIEVKYEV  243 (277)
T ss_pred             CEEEEEEE-CCCCEEEEEEE
T ss_conf             76999970-99678999994