HHsearch alignment for GI: 254780454 and conserved domain: pfam00712

>pfam00712 DNA_pol3_beta DNA polymerase III beta subunit, N-terminal domain. A dimer of the beta subunit of DNA polymerase beta forms a ring which encircles duplex DNA. Each monomer contains three domains of identical topology and DNA clamp fold.
Probab=98.94  E-value=1.8e-09  Score=76.41  Aligned_cols=117  Identities=18%  Similarity=0.339  Sum_probs=97.7

Q ss_pred             EEECCCHHHHHHHCCEEEECCCCCCCCCEEEEEEEECCCCCEEEEEEECCEEEEEEEEECCCCCCCCCHHCCCCCHHHHH
Q ss_conf             45056113554202202300245565210116677617873489998534157666643578753310000010001222
Q gi|254780454|r  129 SFELASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEI  208 (385)
Q Consensus       129 ~~~i~~~~l~~~i~~t~~a~s~d~~r~~L~Gv~~~~~~~~~~l~~vaTDg~RLa~~~~~~~~~~~~~~~~iiP~k~l~el  208 (385)
T Consensus         2 kf~i~k~~L~~aL~~v~~~v~~k~~~PiL~~vli~~~~~--~l~l~aTDlei~i~~~i~~~~~-~e~G~~~vpak~l~di   78 (120)
T pfam00712         2 KFTIERDQLLKALQKVARVLSNRPTIPILSGILLEVKDD--QLSLTGTDLEISIESTISAEIE-SEPGSVLIPARKFLDI   78 (120)
T ss_pred             EEEEEHHHHHHHHHHHHHHHCCCCCHHHHCCEEEEEECC--EEEEEECCCCEEEEEEEEEEEE-CCCEEEEEEHHHHHHH
T ss_conf             899989999999999986607798717875889999899--9999982675799999801681-4340899804998899


Q ss_pred             HHHCCCCCCCCCCCCCCCCEEEECCEEEEEEEECC-CCCCCC
Q ss_conf             21027764643313345530100250699985126-655322
Q gi|254780454|r  209 LRILSSKDSSVKVSLSESRIHLNIESLSMSVRLID-GEFPNY  249 (385)
Q Consensus       209 ~k~l~~~~~~v~i~~~~~~i~~~~~~~~~~srLi~-g~yPdy  249 (385)
T Consensus        79 vr~lp~~-~~i~~~~~~~~l~I~~~~~~f~l~~~~~~eFP~~  119 (120)
T pfam00712        79 VRALPDD-KDVKLSVNEDRLLIISGNSRFSLPTLPAEDYPNL  119 (120)
T ss_pred             HHHCCCC-CCEEEEECCCEEEEEECCEEEEECCCCHHHCCCC
T ss_conf             9839999-8389998399999997972999717897986899