HHsearch alignment for GI: 254780454 and conserved domain: pfam02768

>pfam02768 DNA_pol3_beta_3 DNA polymerase III beta subunit, C-terminal domain. A dimer of the beta subunit of DNA polymerase beta forms a ring which encircles duplex DNA. Each monomer contains three domains of identical topology and DNA clamp fold.
Probab=100.00  E-value=1.3e-31  Score=210.77  Aligned_cols=121  Identities=30%  Similarity=0.588  Sum_probs=115.8

Q ss_pred             CCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCCCCCCEEEEECCEEEEEECCCCCEEEEEEEEEEECCCCEEEEECHHHH
Q ss_conf             10135556617998489988889887410123555302565176599998078732689999989628843999638899
Q gi|254780454|r  250 QNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVDNPDMGKAIESMNVYYNECPMDICFNYKYL  329 (385)
Q Consensus       250 ~~vip~~~~~~~~v~r~~l~~al~Rv~i~~~~~~~~i~l~~~~~~l~i~~~~~e~g~~~e~i~~~~~G~~~~i~fN~~yl  329 (385)
T Consensus         1 r~vIP~~~~~~i~i~r~~l~~al~Rvsi~s~~~~~~V~l~~~~~~l~iss~~~d~g~a~E~i~~~~~G~~~~I~FN~~YL   80 (121)
T pfam02768         1 RRVLPKEFETKITVDNKELKKALARVALLANEKNRGVRLSFEEGQLKLTANNPEIGRAEEEVDVDYIGEPLEIAFNVSYL   80 (121)
T ss_pred             CCCCCCCCCEEEEEEHHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEECCCCCCEEEEEEEEECCCCCEEEEECHHHH
T ss_conf             96268999889999999999999999987437873399998799369998689765067999400169817999979999


Q ss_pred             HHHHHHCCCCCCCCCEEEEEECCCCCCEEEECCCCCCCCCCCCCCCEEEEEEEEE
Q ss_conf             8898735753346633899965898758994377654445556676379983212
Q gi|254780454|r  330 LEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKDKDSKNNKDNKVNAFYVLMPMR  384 (385)
Q Consensus       330 ~d~L~~~~~~~~~~e~i~l~~~~~~~p~~i~~~~~~~~~~~~~~~~~~~liMPvr  384 (385)
T Consensus        81 ~d~L~~i~~-----~~v~~~~~~~~~p~~i~~~~~---------~~~~~viMP~R  121 (121)
T pfam02768        81 LDALKALKS-----EEIELQFTDSTKPALISPPGD---------DDLKYVVMPMR  121 (121)
T ss_pred             HHHHHCCCC-----CEEEEEECCCCCCEEEECCCC---------CCEEEEEEECC
T ss_conf             999960899-----879999868998889985899---------96289997419