HHsearch alignment of GI: 254780454 and MMDB domain: 1iz5_A_

>1iz5_A (A:) Proliferating cell nuclear antigen; DNA, replication, processivity, sliding clamp, DNA binding protein; 1.80A {Pyrococcus furiosus}
Probab=100.00  E-value=7.8e-41  Score=266.36  Aligned_cols=230  Identities=13%  Similarity=0.132  Sum_probs=198.6

Q ss_pred             HHHHHHCCEEEECCCCCCCCCEEEEEEEECCCCCEEEEEEECCEEEEEEEEECCCCCC------CCCHHCCCCCHHHHHH
Q ss_conf             3554202202300245565210116677617873489998534157666643578753------3100000100012222
Q gi|254780454|r  136 VLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQIA------KMPSIIVPRKAVGEIL  209 (385)
Q Consensus       136 ~l~~~i~~t~~a~s~d~~r~~L~Gv~~~~~~~~~~l~~vaTDg~RLa~~~~~~~~~~~------~~~~~iiP~k~l~el~  209 (385)
                      .+.++++++.||++.++.|++++|++|++.++  .|.++||||||||+...+++....      ...+++||.|.+.++.
T Consensus         3 f~~~~~~~~~~a~s~~~~~~il~gv~~~~~~~--~l~l~atD~~rla~~~~~~~~~~~~~~~~~~~~~~~i~~k~l~~i~   80 (249)
T 1iz5_A            3 FEIVFEGAKEFAQLIDTASKLIDEAAFKVTED--GISMRAMDPSRVVLIDLNLPSSIFSKYEVVEPETIGVNLDHLKKIL   80 (249)
T ss_dssp             EEEEEECHHHHHHHHHHHTSSCSEEEEEECSS--EEEEEEECTTSSEEEEEEEEGGGSSEEEESSCEEEEEEHHHHHHHH
T ss_pred             EEEEECCHHHHHHHHHHHHHHHCEEEEEEECC--EEEEEEECCCCEEEEEEEECHHHCCEECCCCCEEEEEEHHHHHHHH
T ss_conf             89993568999999999998758499999789--6899999898789999998988794654588889999969989998


Q ss_pred             HHCCCCCCCCCCCCCCCCEEE---ECCEEEEEEEECCCCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             102776464331334553010---02506999851266553221013555661799848998888988741012355530
Q gi|254780454|r  210 RILSSKDSSVKVSLSESRIHL---NIESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAV  286 (385)
Q Consensus       210 k~l~~~~~~v~i~~~~~~i~~---~~~~~~~~srLi~g~yPdy~~vip~~~~~~~~v~r~~l~~al~Rv~i~~~~~~~~i  286 (385)
                      |.+.+ ++.+++.++++++.+   ..++..+++++++|.||+|++++|.+++.++.+++.+|.++|+|+..++++    +
T Consensus        81 k~~~~-~~~~~i~~~~~~~~~~~~~~~~~~~~~~li~~~~p~~~~i~~~~~~~~i~i~~~~l~~~l~~~~~~~~~----v  155 (249)
T 1iz5_A           81 KRGKA-KDTLILKKGEENFLEITIQGTATRTFRVPLIDVEEMEVDLPELPFTAKVVVLGEVLKAAVKAASLVSDS----I  155 (249)
T ss_dssp             TTCCT-TCEEEEEECSSSEEEEEEESSSEEEEEEECBCCCC-----CCCCCCEEEEEEHHHHHHHHHHHTTTCSE----E
T ss_pred             HCCCC-CCEEEEEECCCCEEEEEEECCCEEEEEEEECCCCCCCCCCCCCCCCEEEEECHHHHHHHHHHHHCCCCE----E
T ss_conf             43689-966999955886279999535127999860334533467888776549972499999999875015988----9


Q ss_pred             EEEEECCEEEEEECCCCCEEEE------EEEEEEECCCCEEEEECHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCEEEE
Q ss_conf             2565176599998078732689------9999896288439996388998898735753346633899965898758994
Q gi|254780454|r  287 KLSLSSDKLCMTVDNPDMGKAI------ESMNVYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIR  360 (385)
Q Consensus       287 ~l~~~~~~l~i~~~~~e~g~~~------e~i~~~~~G~~~~i~fN~~yl~d~L~~~~~~~~~~e~i~l~~~~~~~p~~i~  360 (385)
                      .++++++.+++++.+...+...      |.+++.+.|++++++||++||+++|++++++    +.|+++++++.+|+++.
T Consensus       156 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~g~~~~i~fn~~yL~~~l~~~~~~----~~V~i~~~~~~~p~l~~  231 (249)
T 1iz5_A          156 KFIARENEFIMKAEGETQEVEIKLTLEDEGLLDIEVQEETKSAYGVSYLSDMVKGLGKA----DEVTIKFGNEMPMQMEY  231 (249)
T ss_dssp             EEEEETTEEEEEEECSSCEEEEEEETTTTSSSEEEESSCEEEEEEHHHHHHHHTTSCTT----CEEEEEECTTCCEEEEE
T ss_pred             EEEECCCEEEEEEECCCCEEEEEEECCCCCCEEEECCCCCCEEEHHHHHHHHHHHCCCC----CEEEEEECCCCCEEEEE
T ss_conf             99993883899996366558999821676404565077500366388999998753689----85999974997799999


Q ss_pred             CCCCCCCCCCCCCCCEEEEEEEEE
Q ss_conf             377654445556676379983212
Q gi|254780454|r  361 GKDKDSKNNKDNKVNAFYVLMPMR  384 (385)
Q Consensus       361 ~~~~~~~~~~~~~~~~~~liMPvr  384 (385)
                      +.+++.        .+.|+|||+.
T Consensus       232 ~~~~~~--------~~~~~imP~~  247 (249)
T 1iz5_A          232 YIRDEG--------RLTFLLAPRV  247 (249)
T ss_dssp             EETTTE--------EEEEEECCC-
T ss_pred             EECCCC--------EEEEEECCCC
T ss_conf             968981--------9999983677