HHsearch alignment of GI: 254780454 and MMDB domain: 2avt_A_140-204_253-378

>2avt_A (A:140-204,A:253-378) DNA polymerase III beta subunit; beta clamp, sliding clamp, replication, transferase; HET: DNA; 2.00A {Streptococcus pyogenes} PDB: 2awa_A*
Probab=100.00  E-value=4.2e-45  Score=292.51  Aligned_cols=188  Identities=24%  Similarity=0.423  Sum_probs=168.1

Q ss_pred             HHHHHHHCCEEEECCCCCCCCCEEEEEEEECCCCCEEEEEEECCEEEEEEEEECCCCCCCCCHHCCCCCHHHHHHHHCCC
Q ss_conf             13554202202300245565210116677617873489998534157666643578753310000010001222210277
Q gi|254780454|r  135 SVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQIAKMPSIIVPRKAVGEILRILSS  214 (385)
Q Consensus       135 ~~l~~~i~~t~~a~s~d~~r~~L~Gv~~~~~~~~~~l~~vaTDg~RLa~~~~~~~~~~~~~~~~iiP~k~l~el~k~l~~  214 (385)
                      +.|+++|++|.||+|+|+.||+|+||+|++.++. .|++|||||||||+.+..+..+.+ +++++||             
T Consensus         1 ~~l~~~i~~v~~a~~~~~~r~~L~Gv~~~~~~~~-~l~~vATDg~Rla~~~~~~~~~~~-~~~~~ip-------------   65 (191)
T 2avt_A            1 KLLKSIIAETAFAASLQESRPILTGVHIVLSNHK-DFKAVATDSHRMSQRLITLDNTSA-DFMVVLP-------------   65 (191)
T ss_dssp             HHHHHHHHHHGGGSCCCTTSGGGGEEEEEEETTT-EEEEEEECSSEEEEEEEECSSCCC-CEEEEEE-------------
T ss_pred             HHHHHHHCCCEEEEECCCCHHHHCCEEEEEECCC-CEEEEECCCCCCEEEEEECCCCCC-CCCCCCH-------------
T ss_conf             7888752111266503643022254379994276-147997278620168751233432-1001330-------------


Q ss_pred             CCCCCCCCCCCCCEEEECCEEEEEEEECCCCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCC-CCCCEEEEECC
Q ss_conf             64643313345530100250699985126655322101355566179984899888898874101235-55302565176
Q gi|254780454|r  215 KDSSVKVSLSESRIHLNIESLSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVR-IQAVKLSLSSD  293 (385)
Q Consensus       215 ~~~~v~i~~~~~~i~~~~~~~~~~srLi~g~yPdy~~vip~~~~~~~~v~r~~l~~al~Rv~i~~~~~-~~~i~l~~~~~  293 (385)
                                                         +++||.+++++++++|.+|+++|+|++++++++ ...|.|+|+++
T Consensus        66 -----------------------------------~rlIp~~~~~~i~i~~~el~~ai~Rv~ils~~~~~~~v~l~~~~~  110 (191)
T 2avt_A           66 -----------------------------------DRLLMTEFETEVVFNTQSLRHAMERAFLISNATQNGTVKLEITQN  110 (191)
T ss_dssp             -----------------------------------GGGSCCCCSEEEEEEHHHHHHHHHHHHHHHTTSTTCCEEEEEETT
T ss_pred             -----------------------------------EEECCCCCCCEEEECCHHHHHHHHHHHHHCCCCCCCEEEEEECCC
T ss_conf             -----------------------------------773366776302212146789986531211133122699997164


Q ss_pred             EEEEEECCCCCEEEEEEEEE-EECCCCEEEEECHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCEEEECCCCCCCCCCCC
Q ss_conf             59999807873268999998-96288439996388998898735753346633899965898758994377654445556
Q gi|254780454|r  294 KLCMTVDNPDMGKAIESMNV-YYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKDKDSKNNKDN  372 (385)
Q Consensus       294 ~l~i~~~~~e~g~~~e~i~~-~~~G~~~~i~fN~~yl~d~L~~~~~~~~~~e~i~l~~~~~~~p~~i~~~~~~~~~~~~~  372 (385)
                      ++++++.++|.|++.|++++ .++|++++|+||++||+|+|+++++     ++|+|+|.++.+|++|++.+++       
T Consensus       111 ~l~i~s~~~e~g~~~e~i~~~~~~Ge~~~I~fN~~YLldaL~~i~~-----~~i~l~~~~~~~P~~I~~~~~~-------  178 (191)
T 2avt_A          111 HISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKAIKS-----ETVKIHFLSPVRPFTLTPGDEE-------  178 (191)
T ss_dssp             EEEEEEEETTTEEEEEECCCSEEEECCEEEEECHHHHHHHHHTCCS-----SEEEEEECCTTSCEEEEETTCC-------
T ss_pred             EEEEEECCCCCCCCEEEEEECCCCCCCEEEEECHHHHHHHHHCCCC-----CEEEEEECCCCCCEEEECCCCC-------
T ss_conf             0588754876564138873121369967999889999999854899-----8799997689997799717988-------


Q ss_pred             CCCEEEEEEEEEC
Q ss_conf             6763799832129
Q gi|254780454|r  373 KVNAFYVLMPMRI  385 (385)
Q Consensus       373 ~~~~~~liMPvri  385 (385)
                       .+|+|||||||+
T Consensus       179 -~~~~~lIMPvrl  190 (191)
T 2avt_A          179 -ESFIQLITPVRT  190 (191)
T ss_dssp             -SEEEEEECCCCC
T ss_pred             -CCEEEEEEEEEC
T ss_conf             -757999901405