HHsearch alignment of GI: 254780454 and MMDB domain: 3fds_C_

>3fds_C (C:) DNA polymerase sliding clamp C; protein-protein complex, cytoplasm, DNA damage, DNA repair, DNA replication, DNA-binding; HET: DNA 1PE PGE; 2.05A {Sulfolobus solfataricus} PDB: 2io4_A* 2nti_D* 2hii_A 2hik_A 2ix2_A* 2izo_C*
Probab=99.24  E-value=6.5e-09  Score=72.69  Aligned_cols=212  Identities=11%  Similarity=0.193  Sum_probs=149.1

Q ss_pred             CCCCEEEEEEEECCCCCEEEEEEECCEEEEEEEEECCCCC------CCCCHHCCCCCHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             6521011667761787348999853415766664357875------3310000010001222210277646433133455
Q gi|254780454|r  153 IRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQI------AKMPSIIVPRKAVGEILRILSSKDSSVKVSLSES  226 (385)
Q Consensus       153 ~r~~L~Gv~~~~~~~~~~l~~vaTDg~RLa~~~~~~~~~~------~~~~~~iiP~k~l~el~k~l~~~~~~v~i~~~~~  226 (385)
                      .......++|++.+++  |.+.|.|.+|.+.....++...      +.+..+-|+.+.+..+.|.+...+..+....+++
T Consensus        19 l~~i~~~~~l~~~~~g--l~l~a~d~s~~a~~~~~l~~~~F~~Y~~~~~~~~~i~~~~l~~ilk~~~~~d~~~~~~~~~~   96 (249)
T 3fds_C           19 ITNVTDSIILNFTEDG--IFSRHLTEDKVLMAIMRIPKDVLSEYSIDSPTSVKLDVSSVKKILSKASSKKATIELTETDS   96 (249)
T ss_dssp             HTTTCSSEEEEECSSE--EEEEEECTTSSEEEEEEEEGGGSSEEECSSCEEEEECHHHHHHHHTTCCCSCEEEEEEECSS
T ss_pred             HHHHHCEEEEEECCCE--EEEEEECCCCEEEEEEEECHHHCEEECCCCCEEEEEEHHHHHHHHHHCCCCCCEEEEEECCC
T ss_conf             9986581999984573--79999989957999999786757075168983887789999999854477530278861798


Q ss_pred             CEEEEC----CE--EEEEEEECCCCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCCCCCCEEEEECCEEEEEEC
Q ss_conf             301002----50--699985126655322101355566179984899888898874101235553025651765999980
Q gi|254780454|r  227 RIHLNI----ES--LSMSVRLIDGEFPNYQNVIPCSNDKELRVNCTNLRQAVDRVSIMSSVRIQAVKLSLSSDKLCMTVD  300 (385)
Q Consensus       227 ~i~~~~----~~--~~~~srLi~g~yPdy~~vip~~~~~~~~v~r~~l~~al~Rv~i~~~~~~~~i~l~~~~~~l~i~~~  300 (385)
                      ++.+.+    +.  .++..++++...+++.- -+.+++.++.++.+.|.++++.+...++.    +.+...++.+.+++.
T Consensus        97 ~l~i~~~~~~~~~~~~~~l~~~~~~~~~~~~-~~~~~~~~~~i~s~~l~~~~~~~~~~~~~----i~i~~~~~~~~~~~~  171 (249)
T 3fds_C           97 GLKIIIRDEKSGAKSTIYIKAEKGQVEQLTE-PKVNLAVNFTTDESVLNVIAADVTLVGEE----MRISTEEDKIKIEAG  171 (249)
T ss_dssp             EEEEEEEETTTCCEEEEEEECEECCCCCCCC-CCCCCCEEEEECHHHHHHHHHHHHHHCSE----EEEEEETTEEEEEEE
T ss_pred             CEEEEEEECCCCEEEEEEEEECCCCHHCCCC-CCCCCCEEEEECHHHHHHHHHHHHCCCCE----EEEEEECCEEEEEEE
T ss_conf             5279999358980799997402463201567-76565358996389999998655204878----999996999999994


Q ss_pred             CCCCEEEEEEE-E-----EEECCCCEEEEECHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCEEEECCCCCCCCCCCCCC
Q ss_conf             78732689999-9-----89628843999638899889873575334663389996589875899437765444555667
Q gi|254780454|r  301 NPDMGKAIESM-N-----VYYNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSSNSSVFIRGKDKDSKNNKDNKV  374 (385)
Q Consensus       301 ~~e~g~~~e~i-~-----~~~~G~~~~i~fN~~yl~d~L~~~~~~~~~~e~i~l~~~~~~~p~~i~~~~~~~~~~~~~~~  374 (385)
                      +.. ....+.. +     ....|++.++.|+.+||.++++++++-   .+.|.+.+ ++..|+.++..-++.       .
T Consensus       172 ~~~-~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~l~~~~k~~~~~---s~~v~i~~-~~~~Pl~i~~~~~~~-------~  239 (249)
T 3fds_C          172 EEG-KRYVAFLMKDKPLKELSIDTSASSSYSAEMFKDAVKGLRGF---SAPTMVSF-GENLPMKIDVEAVSG-------G  239 (249)
T ss_dssp             ETT-EEEEEEEEETBEESEEEESSCCEEEEEHHHHHHHHHTTTTC---CSCEEEEE-CTTCCEEEEEECTTS-------C
T ss_pred             CCC-CEEEEEECCCCCEEEEECCCCEEEEEEHHHHHHHHHHHHCC---CCEEEEEE-CCCCCEEEEEECCCC-------E
T ss_conf             378-60799962788606886287525699789999999863024---88599997-499888999983898-------3


Q ss_pred             CEEEEEEEE
Q ss_conf             637998321
Q gi|254780454|r  375 NAFYVLMPM  383 (385)
Q Consensus       375 ~~~~liMPv  383 (385)
                      ...|+|+|.
T Consensus       240 ~~~f~lap~  248 (249)
T 3fds_C          240 HMIFWIAPR  248 (249)
T ss_dssp             EEEEEECCB
T ss_pred             EEEEEECCC
T ss_conf             999999357