HHsearch results for GI: 254780454 and protein with PDBid: 1plq_A

>1plq_A Proliferating cell nuclear antigen (PCNA); DNA-binding, nuclear protein, DNA replication, processivity factor; 2.30A {Saccharomyces cerevisiae} SCOP: d.131.1.2 d.131.1.2 PDB: 1plr_A 2od8_A* 1sxj_F* 3f1w_A 3gpn_A 3gpm_A 3l0w_A 3l0x_A 3l10_A 3l0x_B
Probab=98.52  E-value=1.6e-05  Score=51.24  Aligned_cols=210  Identities=15%  Similarity=0.163  Sum_probs=129.9

Q ss_pred             CEEEE-EHHHHHHHHHHHHHHHCCCCCCCHHCEEEEEEECCEEEEEEECCE--EEEEEEEEE------EECCCCEEEEEH
Q ss_conf             95898-599999999987502037888610133899998997999996782--899999977------752680799949
Q gi|254780454|r    1 MKITV-ERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPE--IEITGAIPA------SVDVCGSITVSA   71 (385)
Q Consensus         1 Mk~~i-~~~~L~~~l~~v~~~i~~k~~~pil~~ilie~~~~~l~l~atd~~--~~i~~~i~~------~i~~~G~~~v~a   71 (385)
                      |+++. +-+.|...++.+++++         ..+.+++..+++.+.|.|..  .-+...+++      +++++-.+.|+-
T Consensus         2 fe~~~~~a~~fk~i~~~l~~l~---------~e~~~~~~~~Gi~i~~~D~s~v~lv~~~l~~~~F~~Y~~~~~~~~gi~~   72 (258)
T 1plq_A            2 LEAKFEEASLFKRIIDGFKDCV---------QLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDL   72 (258)
T ss_dssp             EEEEESSHHHHHHHHHHHTTTC---------SEEEEEEETTEEEEEEECTTSSEEEEEEEEGGGSSEECCSSCEEEEEEH
T ss_pred             CEEEECCHHHHHHHHHHHHHHH---------CEEEEEEECCEEEEEEECCCCEEEEEEEECHHHCEEECCCCCEEEEEEH
T ss_conf             0899667699999999998876---------5399999389789999989978999999888989265268668999998


Q ss_pred             HHHHHHHHCCCCCCCEEEEEECCCCEEEEE--EECC----CEEEEECCCCC-CCCCCCCCCCCEEEECCCHHHHHHHCCE
Q ss_conf             987788740777773047773367508999--8678----20243036621-1432123324304505611355420220
Q gi|254780454|r   72 HLLYDIVRKLQDGAQISFFKENELGTEVNI--SHGD----SNFYLQSFPES-EFPSTKEEEYVYSFELASSVLKNLVERT  144 (385)
Q Consensus        72 ~~l~~iik~L~~~~~i~~~~~~~~~~~i~i--~~~~----~~~~l~~~~~~-~fP~~~~~~~~~~~~i~~~~l~~~i~~t  144 (385)
                      +.|..++|.+..+..+.+..+++. ..+.+  .+.+    .+|.++.++.+ +-+.+|..+....+.+++..|+++++..
T Consensus        73 ~~l~kilk~~~~~d~l~l~~~~~~-~~l~~~~~~~~~~~~~~~~l~l~d~~~~~~~ip~~~~~~~i~~~s~~f~~~~k~l  151 (258)
T 1plq_A           73 TSLSKILRCGNNTDTLTLIADNTP-DSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDL  151 (258)
T ss_dssp             HHHHHHTTCSTTTSEEEEEECSSC-SEEEEEEECSSSSCEEEEEEECBCCCCCCCCCCCSCCSEEEEEEHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCCEEEEEEECCC-CEEEEEEECCCCCCEEEEEEECCCCCCCCCCCCCCCCCEEEEEEHHHHHHHHHHH
T ss_conf             998999861478867999995588-7169999558876379999733678721246887676468997599999999987


Q ss_pred             EEECCCCCCCCCEEEEEEEECCCCCEEEEEEECCEEEEEEEEECCC-----------CCCCCCHHCCCCCHHHHHHHHCC
Q ss_conf             2300245565210116677617873489998534157666643578-----------75331000001000122221027
Q gi|254780454|r  145 HFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVA-----------QIAKMPSIIVPRKAVGEILRILS  213 (385)
Q Consensus       145 ~~a~s~d~~r~~L~Gv~~~~~~~~~~l~~vaTDg~RLa~~~~~~~~-----------~~~~~~~~iiP~k~l~el~k~l~  213 (385)
                      .- .+ |       -|.+...++...+.+-+ |.-+. ...+....           ..........+.+.|..+.|...
T Consensus       152 ~~-~~-d-------~i~i~~~~~~~~f~~~g-d~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~fsl~yl~~~~k~~~  220 (258)
T 1plq_A          152 SQ-LS-D-------SINIMITKETIKFVADG-DIGSG-SVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSS  220 (258)
T ss_dssp             HT-TC-S-------EEEEEEETTEEEEEEEC-SSCEE-EEEECCBCCTTCGGGCBEEEESSCEEEEEEHHHHHHHGGGGG
T ss_pred             HH-HC-C-------EEEEEECCCCEEEEEEE-CCCEE-EEEEECCCCCCCCCCEEEEECCCCEEEEEEHHHHHHHHHHCC
T ss_conf             71-38-8-------79999858830899980-36438-999803566677542046522771348995899999872525


Q ss_pred             CCCCCCCCCCCCCC-EEEEC
Q ss_conf             76464331334553-01002
Q gi|254780454|r  214 SKDSSVKVSLSESR-IHLNI  232 (385)
Q Consensus       214 ~~~~~v~i~~~~~~-i~~~~  232 (385)
                      - .+.|+++++.+. +.|.+
T Consensus       221 l-s~~v~i~~~~~~Pl~~~~  239 (258)
T 1plq_A          221 L-SDRVGIRLSSEAPALFQF  239 (258)
T ss_dssp             T-CSEEEEEECSSSCEEEEE
T ss_pred             C-CCEEEEEEECCCCEEEEE
T ss_conf             7-988999982896689999