HHsearch results for GI: 254780454 and protein with PDBid: 1u7b_A

>1u7b_A PCNA, cyclin, proliferating cell nuclear antigen; sliding clamp, DNA processing, FEN1, PIP- BOX, replication; 1.88A {Homo sapiens} SCOP: d.131.1.2 d.131.1.2 PDB: 1u76_A 1axc_A 1ul1_A 1vyj_A 1vym_A 1w60_A 2zvk_A* 2zvl_A* 2zvm_A*
Probab=98.26  E-value=0.00012  Score=45.80  Aligned_cols=201  Identities=10%  Similarity=0.123  Sum_probs=123.9

Q ss_pred             EEHHHHHHHHHHHHHHHCCCCCCCHHCEEEEEEECCEEEEEEECCE--EEEEEEEEE------EECCCCEEEEEHHHHHH
Q ss_conf             8599999999987502037888610133899998997999996782--899999977------75268079994998778
Q gi|254780454|r    5 VERSDILELLGHACRIIERKNTIPVSCHVLLQANDGLLEIKASGPE--IEITGAIPA------SVDVCGSITVSAHLLYD   76 (385)
Q Consensus         5 i~~~~L~~~l~~v~~~i~~k~~~pil~~ilie~~~~~l~l~atd~~--~~i~~~i~~------~i~~~G~~~v~a~~l~~   76 (385)
                      .+-+.|...++.+++++         ..+.+++..+++.+.+.|..  .-+...++.      +++++-.+.|+.+.|..
T Consensus         7 ~~a~~fk~i~~~l~~l~---------~e~~~~~~~~Gi~i~~mD~s~v~li~~~l~~~~F~~y~~~~~~~igi~~~~l~k   77 (261)
T 1u7b_A            7 VQGSILKKVLEALKDLI---------NEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSK   77 (261)
T ss_dssp             SCTHHHHHHHHHHHTTC---------SEEEEEEETTEEEEEEECTTSSEEEEEEEEGGGSSEEEESSCEEEEEEHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHH---------CEEEEEEECCEEEEEEECCCCEEEEEEEECHHHCEEECCCCCEEEEEEHHHHHH
T ss_conf             56799999999999875---------639999908968999998887899999989788905055776899999999999


Q ss_pred             HHHCCCCCCCEEEEEECCCCEEEE--EEECC----CEEEEECCCCCC-CCCCCCCCCCEEEECCCHHHHHHHCCEEEECC
Q ss_conf             874077777304777336750899--98678----202430366211-43212332430450561135542022023002
Q gi|254780454|r   77 IVRKLQDGAQISFFKENELGTEVN--ISHGD----SNFYLQSFPESE-FPSTKEEEYVYSFELASSVLKNLVERTHFAMA  149 (385)
Q Consensus        77 iik~L~~~~~i~~~~~~~~~~~i~--i~~~~----~~~~l~~~~~~~-fP~~~~~~~~~~~~i~~~~l~~~i~~t~~a~s  149 (385)
                      ++|.+..+..+.+..+++. ..+.  +.++.    .+|+++.++.+. -+.+|..+....+.+++..|+++++...-- +
T Consensus        78 ilk~~~~~d~l~l~~~~~~-~~l~i~~~~~~~~~~~~f~l~l~d~~~~~~~ip~~~~~~~i~~~s~~f~~~~~~l~~~-~  155 (261)
T 1u7b_A           78 ILKCAGNEDIITLRAEDNA-DTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHI-G  155 (261)
T ss_dssp             HHTTSCTTCEEEEEECTTC-SEEEEEEECTTSSCEEEEEEECCCCCCCCCBCCCCCCSEEEEEEHHHHHHHHHHHHTT-C
T ss_pred             HHHHCCCCCEEEEEECCCC-CCEEEEEEECCCCCEEEEEEEECCCCCCCCCCCCCCCCEEEEECHHHHHHHHHHHHHC-C
T ss_conf             9963558954999983688-7169999806876226898740346600125787775589995089999999999742-8


Q ss_pred             CCCCCCCEEEEEEEECCCCCEEEEEEECCEEEEEEEEECCC-----------CCCCCCHHCCCCCHHHHHHHHCCCCCCC
Q ss_conf             45565210116677617873489998534157666643578-----------7533100000100012222102776464
Q gi|254780454|r  150 TEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVA-----------QIAKMPSIIVPRKAVGEILRILSSKDSS  218 (385)
Q Consensus       150 ~d~~r~~L~Gv~~~~~~~~~~l~~vaTDg~RLa~~~~~~~~-----------~~~~~~~~iiP~k~l~el~k~l~~~~~~  218 (385)
                       |.       +.+...++...+.+-+ |+-+. ...+.-..           ...+......+.+.|..+.|...- .+.
T Consensus       156 -d~-------v~i~~~~~~~~~~~~g-d~~~~-~i~~~~~~~~~~~~~~~~~~~~~~~~~~fsl~yl~~~~k~~~l-s~~  224 (261)
T 1u7b_A          156 -DA-------VVISCAKDGVKFSASG-ELGNG-NIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPL-SST  224 (261)
T ss_dssp             -SE-------EEEEEETTEEEEEEEE-TTEEE-EEEECCCC----CCSCCEEEESSCEEEEEEHHHHHHHGGGGGG-CSE
T ss_pred             -CE-------EEEEECCCCEEEEEEE-CCCEE-EEEEECCCCCCCCCCEEEEECCCCEEEEEEHHHHHHHHHHCCC-CCE
T ss_conf             -80-------8999818827999972-26547-9999247787774312676338740389958999987633368-987


Q ss_pred             CCCCCCCCC
Q ss_conf             331334553
Q gi|254780454|r  219 VKVSLSESR  227 (385)
Q Consensus       219 v~i~~~~~~  227 (385)
                      |+++++.++
T Consensus       225 V~i~~~~~~  233 (261)
T 1u7b_A          225 VTLSMSADV  233 (261)
T ss_dssp             EEEEECTTS
T ss_pred             EEEEECCCC
T ss_conf             999981998