HHsearch results for GI: 254780454 and protein with PDBid: 3fds_C

>3fds_C DNA polymerase sliding clamp C; protein-protein complex, cytoplasm, DNA damage, DNA repair, DNA replication, DNA-binding; HET: DNA 1PE PGE; 2.05A {Sulfolobus solfataricus} PDB: 2io4_A* 2nti_D* 2hii_A 2hik_A 2ix2_A* 2izo_C*
Probab=99.00  E-value=5.2e-07  Score=60.20  Aligned_cols=221  Identities=10%  Similarity=0.154  Sum_probs=139.6

Q ss_pred             CCHHHHHHHCCEEEECCCCCCCCCEEEEEEEECCCCCEEEEEEECCEEEEEEEEECCCCCC------CCCHHCCCCCHHH
Q ss_conf             6113554202202300245565210116677617873489998534157666643578753------3100000100012
Q gi|254780454|r  133 ASSVLKNLVERTHFAMATEEIRYYLNGIFFHINEEDLKLCAVATDGHRLAVAEVDIVAQIA------KMPSIIVPRKAVG  206 (385)
Q Consensus       133 ~~~~l~~~i~~t~~a~s~d~~r~~L~Gv~~~~~~~~~~l~~vaTDg~RLa~~~~~~~~~~~------~~~~~iiP~k~l~  206 (385)
                      ++..|+++++..         +....-++|++..++  |.+.+.|..|.+.....+....-      .+..+-|+.+.+.
T Consensus         8 ~ak~f~~~i~~l---------~~i~~e~~~~~~~~g--l~~~~~D~s~~~l~~~~l~~~~F~~Y~~~~~~~~gi~~~~l~   76 (249)
T 3fds_C            8 NAKDFFSFINSI---------TNVTDSIILNFTEDG--IFSRHLTEDKVLMAIMRIPKDVLSEYSIDSPTSVKLDVSSVK   76 (249)
T ss_dssp             CHHHHHHHHHHH---------TTTCSSEEEEECSSE--EEEEEECTTSSEEEEEEEEGGGSSEEECSSCEEEEECHHHHH
T ss_pred             CHHHHHHHHHHH---------HHHHCCEEEEECCCE--EEEEEECCCCEEEEEEEECHHHCEEEECCCCEEEEEEHHHHH
T ss_conf             879999999999---------986580999983574--899998788189999993867675760689869998899999


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCE--EEEC--CEE--EEEEEECCCCCCCCCCCCCC-CCCCEEEEEHHHHHHHHHHHHHCC
Q ss_conf             2221027764643313345530--1002--506--99985126655322101355-566179984899888898874101
Q gi|254780454|r  207 EILRILSSKDSSVKVSLSESRI--HLNI--ESL--SMSVRLIDGEFPNYQNVIPC-SNDKELRVNCTNLRQAVDRVSIMS  279 (385)
Q Consensus       207 el~k~l~~~~~~v~i~~~~~~i--~~~~--~~~--~~~srLi~g~yPdy~~vip~-~~~~~~~v~r~~l~~al~Rv~i~~  279 (385)
                      .+.|.....+..+.....++..  .+..  ++.  .+..++++.  ....--+|+ +++..+.++.+.|.+.++.+..+.
T Consensus        77 kilk~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~l~l~~~--~~~~~~~p~~~~~~~i~i~s~~f~~~~~~l~~~~  154 (249)
T 3fds_C           77 KILSKASSKKATIELTETDSGLKIIIRDEKSGAKSTIYIKAEKG--QVEQLTEPKVNLAVNFTTDESVLNVIAADVTLVG  154 (249)
T ss_dssp             HHHTTCCCSCEEEEEEECSSEEEEEEEETTTCCEEEEEEECEEC--CCCCCCCCCCCCCEEEEECHHHHHHHHHHHHHHC
T ss_pred             HHHHHCCCCCCEEEEECCCCCEEEEEEECCCCEEEEEEEECCCC--CHHCCCCCCCCCCEEEEECHHHHHHHHHHHHCCC
T ss_conf             99832466640378841798517999955897379999720245--3202578876652689964899999987540249


Q ss_pred             CCCCCCCEEEEECCEEEEEECCCCCEEEEEEEE-----EE-ECCCCEEEEECHHHHHHHHHHCCCCCCCCCEEEEEECCC
Q ss_conf             235553025651765999980787326899999-----89-628843999638899889873575334663389996589
Q gi|254780454|r  280 SVRIQAVKLSLSSDKLCMTVDNPDMGKAIESMN-----VY-YNECPMDICFNYKYLLEIIDNISSDEVVDDEVVFRLDSS  353 (385)
Q Consensus       280 ~~~~~~i~l~~~~~~l~i~~~~~e~g~~~e~i~-----~~-~~G~~~~i~fN~~yl~d~L~~~~~~~~~~e~i~l~~~~~  353 (385)
                      +.    |.+..+++++.+++.+. .+.......     .. ..+++....|+.+||.++++.+.+-   .+.|.++++ +
T Consensus       155 d~----v~i~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~f~l~yl~~~~k~~~~~---s~~v~i~~~-~  225 (249)
T 3fds_C          155 EE----MRISTEEDKIKIEAGEE-GKRYVAFLMKDKPLKELSIDTSASSSYSAEMFKDAVKGLRGF---SAPTMVSFG-E  225 (249)
T ss_dssp             SE----EEEEEETTEEEEEEEET-TEEEEEEEEETBEESEEEESSCCEEEEEHHHHHHHHHTTTTC---CSCEEEEEC-T
T ss_pred             CE----EEEEEECCEEEEEEECC-CCEEEEEECCCCCEEEEECCCCEEEEEEHHHHHHHHHHHHCC---CCEEEEEEC-C
T ss_conf             78----99999899999999027-854799973898515785287311399789999999763214---883899972-9


Q ss_pred             CCCEEEECCCCCCCCCCCCCCCEEEEEEE
Q ss_conf             87589943776544455566763799832
Q gi|254780454|r  354 NSSVFIRGKDKDSKNNKDNKVNAFYVLMP  382 (385)
Q Consensus       354 ~~p~~i~~~~~~~~~~~~~~~~~~~liMP  382 (385)
                      ..|+.+.-.-.+       ...-.|.|-|
T Consensus       226 ~~Pl~~~~~~~~-------~g~~~f~lAP  247 (249)
T 3fds_C          226 NLPMKIDVEAVS-------GGHMIFWIAP  247 (249)
T ss_dssp             TCCEEEEEECTT-------SCEEEEEECC
T ss_pred             CCCEEEEEECCC-------CEEEEEEECC
T ss_conf             998999998289-------8189999925