HHSEARCH alignment of GI: 254780454 and SCOP domain: d1iz5a1

Alignment
>d1iz5a1 d.131.1.2 (A:2-120) Proliferating cell nuclear antigen (PCNA) {Archaeon Pyrococcus furiosus [TaxId: 2261]}
Probab=95.92  E-value=0.042  Score=28.97  Aligned_cols=86  Identities=16%  Similarity=0.181  Sum_probs=36.9

Q ss_pred             CEEEEEEECCEEEEEEECCE--EEEEEEEEE------EECCCCEEEEEHHHHHHHHHCCCCCCCEEEEEECCCCEEEEEE
Q ss_conf             33899998997999996782--899999977------7526807999499877887407777730477733675089998
Q gi|254780454|r   31 CHVLLQANDGLLEIKASGPE--IEITGAIPA------SVDVCGSITVSAHLLYDIVRKLQDGAQISFFKENELGTEVNIS  102 (385)
Q Consensus        31 ~~ilie~~~~~l~l~atd~~--~~i~~~i~~------~i~~~G~~~v~a~~l~~iik~L~~~~~i~~~~~~~~~~~i~i~  102 (385)
                      ..+-+...++++.+.+.|..  .-+...+++      +++++-.+.|+-..|..++|.+..+..+.+..+++....+.+.
T Consensus        24 ~e~~l~~~~~Gi~iq~mD~shv~lv~l~L~~~~F~~Y~~~~~~~iGi~~~~L~kilk~~~~~d~l~l~~~~~~~l~i~~~  103 (119)
T d1iz5a1          24 DEAAFKVTEDGISMRAMDPSRVVLIDLNLPSSIFSKYEVVEPETIGVNLDHLKKILKRGKAKDTLILKKGEENFLEITIQ  103 (119)
T ss_dssp             SEEEEEECSSEEEEEEECTTSSEEEEEEEEGGGSSEEEESSCEEEEEEHHHHHHHHTTCCTTCEEEEEECSSSEEEEEEE
T ss_pred             CEEEEEEECCEEEEEEECCCCEEEEEEEECHHHCEEECCCCCEEEEEEHHHHHHHHHHCCCCCEEEEEECCCCEEEEEEE
T ss_conf             62899990683899996789589999999878885771377779879999999999617799889999768988999996


Q ss_pred             EC-CCEEEEECCCCC
Q ss_conf             67-820243036621
Q gi|254780454|r  103 HG-DSNFYLQSFPES  116 (385)
Q Consensus       103 ~~-~~~~~l~~~~~~  116 (385)
                      .. ..+|+++.+|.+
T Consensus       104 ~~~~~~f~l~Lidid  118 (119)
T d1iz5a1         104 GTATRTFRVPLIDVE  118 (119)
T ss_dssp             SSSEEEEEEECBCCC
T ss_pred             CCCEEEEEEEEECCC
T ss_conf             891579997605578


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: DNA clamp
superfamily: DNA clamp
family: DNA polymerase processivity factor
domain: Proliferating cell nuclear antigen (PCNA)
species: Archaeon Pyrococcus furiosus [TaxId: 2261]